SMED30020834

Overview
NameSMED30020834
Smed IDSMED30020834
Length (bp)1687
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30020834 (SMED30020834) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30020834 (SMED30020834) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020834

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30020834SMESG000060160.1 dd_Smed_v4_10167_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30020834SMESG000060160.1 dd_Smed_v4_10167_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020834SMESG000060160.1 dd_Smed_v4_10167_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30020834SMESG000060160.1 dd_Smed_v4_10167_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30020834SMESG000060160.1 dd_Smed_v4_10167_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30020834SMESG000060160.1 dd_Smed_v4_10167_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30020834 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001900:2490..11414 -8357
Homology
BLAST of SMED30020834 vs. Ensembl Human
Match: STXBP2 (syntaxin binding protein 2 [Source:HGNC Symbol;Acc:HGNC:11445])

HSP 1 Score: 88.5817 bits (218), Expect = 6.548e-20
Identity = 37/81 (45.68%), Postives = 60/81 (74.07%), Query Frame = -3
Query: 1317 WRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFESTP--VYSKAHVFFVD 1550
            W++L++D  S +I++   KM D+  +G+T+V+D+ KRREP+P LEAIYL+SP +K ++ +++DF+ TP   Y  AH+FF D
Sbjct:   12 WKVLIMDHPSMRILSSCCKMSDILAEGITIVEDINKRREPIPSLEAIYLLSPTEKSVQALIKDFQGTPTFTYKAAHIFFTD 92          
BLAST of SMED30020834 vs. Ensembl Human
Match: STXBP2 (syntaxin binding protein 2 [Source:HGNC Symbol;Acc:HGNC:11445])

HSP 1 Score: 90.8929 bits (224), Expect = 6.010e-19
Identity = 40/99 (40.40%), Postives = 68/99 (68.69%), Query Frame = -3
Query: 1317 IHREICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFESTP--VYSKAHVFFVD 1604
            +  +I S V   + ++  W++L++D  S +I++   KM D+  +G+T+V+D+ KRREP+P LEAIYL+SP +K ++ +++DF+ TP   Y  AH+FF D
Sbjct:   10 VGEKILSGVIRSVKKDGEWKVLIMDHPSMRILSSCCKMSDILAEGITIVEDINKRREPIPSLEAIYLLSPTEKSVQALIKDFQGTPTFTYKAAHIFFTD 108          
BLAST of SMED30020834 vs. Ensembl Human
Match: STXBP2 (syntaxin binding protein 2 [Source:HGNC Symbol;Acc:HGNC:11445])

HSP 1 Score: 91.2781 bits (225), Expect = 1.135e-18
Identity = 40/99 (40.40%), Postives = 68/99 (68.69%), Query Frame = -3
Query: 1317 IHREICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFESTP--VYSKAHVFFVD 1604
            +  +I S V   + ++  W++L++D  S +I++   KM D+  +G+T+V+D+ KRREP+P LEAIYL+SP +K ++ +++DF+ TP   Y  AH+FF D
Sbjct:   10 VGEKILSGVIRSVKKDGEWKVLIMDHPSMRILSSCCKMSDILAEGITIVEDINKRREPIPSLEAIYLLSPTEKSVQALIKDFQGTPTFTYKAAHIFFTD 108          
BLAST of SMED30020834 vs. Ensembl Human
Match: STXBP1 (syntaxin binding protein 1 [Source:HGNC Symbol;Acc:HGNC:11444])

HSP 1 Score: 81.6481 bits (200), Expect = 2.898e-18
Identity = 36/82 (43.90%), Postives = 58/82 (70.73%), Query Frame = -3
Query: 1314 WRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFESTPV--YSKAHVFFVDG 1550
            W++LV+D+ S ++++   KM D+  +G+T+V+D+ KRREP+P LEA+YLI+P +K +  ++ DF+  P   Y  AHVFF D 
Sbjct:   14 WKVLVVDQLSMRMLSSCCKMTDIMTEGITIVEDINKRREPLPSLEAVYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDS 95          
BLAST of SMED30020834 vs. Ensembl Human
Match: STXBP1 (syntaxin binding protein 1 [Source:HGNC Symbol;Acc:HGNC:11444])

HSP 1 Score: 82.0333 bits (201), Expect = 7.830e-18
Identity = 36/82 (43.90%), Postives = 58/82 (70.73%), Query Frame = -3
Query: 1314 WRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFESTPV--YSKAHVFFVDG 1550
            W++LV+D+ S ++++   KM D+  +G+T+V+D+ KRREP+P LEA+YLI+P +K +  ++ DF+  P   Y  AHVFF D 
Sbjct:   14 WKVLVVDQLSMRMLSSCCKMTDIMTEGITIVEDINKRREPLPSLEAVYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDS 95          
BLAST of SMED30020834 vs. Ensembl Celegans
Match: unc-18 (Putative acetylcholine regulator unc-18 [Source:UniProtKB/Swiss-Prot;Acc:P34815])

HSP 1 Score: 79.337 bits (194), Expect = 2.677e-15
Identity = 33/82 (40.24%), Postives = 60/82 (73.17%), Query Frame = -3
Query: 1314 NIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFESTPVYSKAHVFFVDG 1556
            + W +L++D  + ++++   KMH++ ++G+T+V+DL KRREP+P LEAIYLI+P  + I+ +++D+ +  +Y  AHVFF + 
Sbjct:   26 SAWNVLIVDTLAMRMLSSCCKMHNIMEEGITIVEDLNKRREPLPTLEAIYLIAPTAESIDKLIQDYCARNLYKCAHVFFTEA 107          
BLAST of SMED30020834 vs. Ensembl Celegans
Match: T07A9.10 (pep chromosome:WBcel235:IV:390512:393158:1 gene:WBGene00020298.1 transcript:T07A9.10.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T07A9.10)

HSP 1 Score: 68.9366 bits (167), Expect = 4.758e-12
Identity = 33/85 (38.82%), Postives = 58/85 (68.24%), Query Frame = -3
Query: 1317 WRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFESTP------VYSKAHVFFVD 1550
            + +LVLD+ +  ++   L ++++F++GVTLV+DLT+ REP+P ++AIY+ISP  + I++++ DF           Y  AH+FF+D
Sbjct:   29 FSVLVLDKSAMVVVNSCLSLNEVFEEGVTLVEDLTRNREPMPSMDAIYIISPVAESIDILINDFSRKTKFNPGNSYRSAHIFFLD 113          
BLAST of SMED30020834 vs. Ensembl Celegans
Match: sly-1 (SLY1 homolog [Source:UniProtKB/TrEMBL;Acc:Q20364])

HSP 1 Score: 48.9062 bits (115), Expect = 8.095e-6
Identity = 27/75 (36.00%), Postives = 43/75 (57.33%), Query Frame = -3
Query: 1359 VFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFE 1580
            V +    E +W++LVLD     II+ +L +  L + GVTL   +  RREP+  + A+Y +SP  + I+LM  D +
Sbjct:   26 VVNSGVREPVWKVLVLDRTGQDIISPLLPVKQLRELGVTLHLLIGARREPLTDVPAVYFVSPNDENIDLMSEDLK 100          
BLAST of SMED30020834 vs. Ensembl Celegans
Match: sly-1 (SLY1 homolog [Source:UniProtKB/TrEMBL;Acc:Q20364])

HSP 1 Score: 48.9062 bits (115), Expect = 9.358e-6
Identity = 27/75 (36.00%), Postives = 43/75 (57.33%), Query Frame = -3
Query: 1359 VFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFE 1580
            V +    E +W++LVLD     II+ +L +  L + GVTL   +  RREP+  + A+Y +SP  + I+LM  D +
Sbjct:   26 VVNSGVREPVWKVLVLDRTGQDIISPLLPVKQLRELGVTLHLLIGARREPLTDVPAVYFVSPNDENIDLMSEDLK 100          
BLAST of SMED30020834 vs. Ensembl Fly
Match: Rop (gene:FBgn0004574 transcript:FBtr0310632)

HSP 1 Score: 81.2629 bits (199), Expect = 7.530e-16
Identity = 35/81 (43.21%), Postives = 60/81 (74.07%), Query Frame = -3
Query: 1317 WRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFE--STPVYSKAHVFFVD 1550
            WR+LV+D+   ++++   KMH++  +G+TLV+D+ K+REP+P ++AIYLI+P  + +  ++RDFE  + P+Y  AHVFF +
Sbjct:   39 WRVLVVDKLGMRMVSACTKMHEISAEGITLVEDINKKREPLPTMDAIYLITPSDESVRGLIRDFENPARPMYRYAHVFFTE 119          
BLAST of SMED30020834 vs. Ensembl Fly
Match: Rop (gene:FBgn0004574 transcript:FBtr0073263)

HSP 1 Score: 81.2629 bits (199), Expect = 7.530e-16
Identity = 35/81 (43.21%), Postives = 60/81 (74.07%), Query Frame = -3
Query: 1317 WRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFE--STPVYSKAHVFFVD 1550
            WR+LV+D+   ++++   KMH++  +G+TLV+D+ K+REP+P ++AIYLI+P  + +  ++RDFE  + P+Y  AHVFF +
Sbjct:   39 WRVLVVDKLGMRMVSACTKMHEISAEGITLVEDINKKREPLPTMDAIYLITPSDESVRGLIRDFENPARPMYRYAHVFFTE 119          
BLAST of SMED30020834 vs. Ensembl Zebrafish
Match: stxbp2 (syntaxin binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2482])

HSP 1 Score: 85.5001 bits (210), Expect = 4.094e-17
Identity = 42/97 (43.30%), Postives = 64/97 (65.98%), Query Frame = -3
Query: 1317 HREICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFESTP-VYSKAHVFFVD 1601
            + +I S V   + ++  W++L++D  S +I++   KM D+  +GVT+V+D++KRREP+P LEAIYLISP  K +  ++ DF  T   Y  AHVFF D
Sbjct:   11 NEKILSGVIKSVKKDGDWKVLIVDHISMRILSSCCKMSDIMAEGVTIVEDISKRREPIPSLEAIYLISPVPKSVHALIADFRETAFTYKAAHVFFTD 107          
BLAST of SMED30020834 vs. Ensembl Zebrafish
Match: stxbp1b (syntaxin binding protein 1b [Source:ZFIN;Acc:ZDB-GENE-060531-166])

HSP 1 Score: 82.8037 bits (203), Expect = 3.417e-16
Identity = 37/100 (37.00%), Postives = 67/100 (67.00%), Query Frame = -3
Query: 1314 IHREICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFES--TPVYSKAHVFFVDG 1604
            +  +I + V   + ++  W++LV+D+ S ++++   KM D+  +G+T+V+D+TK+REP+P +EAI+LI+P  + +E ++ DF     P+Y  AHVFF D 
Sbjct:   10 VGEKIMNDVIRKVKKKGEWKVLVVDKLSMRMVSSCCKMTDIMSEGITIVEDITKKREPLPTMEAIFLITPSDESVEGLINDFRDPRNPIYRGAHVFFTDA 109          
BLAST of SMED30020834 vs. Ensembl Zebrafish
Match: stxbp1b (syntaxin binding protein 1b [Source:ZFIN;Acc:ZDB-GENE-060531-166])

HSP 1 Score: 82.8037 bits (203), Expect = 3.417e-16
Identity = 37/100 (37.00%), Postives = 67/100 (67.00%), Query Frame = -3
Query: 1314 IHREICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFES--TPVYSKAHVFFVDG 1604
            +  +I + V   + ++  W++LV+D+ S ++++   KM D+  +G+T+V+D+TK+REP+P +EAI+LI+P  + +E ++ DF     P+Y  AHVFF D 
Sbjct:   10 VGEKIMNDVIRKVKKKGEWKVLVVDKLSMRMVSSCCKMTDIMSEGITIVEDITKKREPLPTMEAIFLITPSDESVEGLINDFRDPRNPIYRGAHVFFTDA 109          
BLAST of SMED30020834 vs. Ensembl Zebrafish
Match: stxbp1a (syntaxin binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-050626-106])

HSP 1 Score: 77.411 bits (189), Expect = 1.850e-14
Identity = 35/81 (43.21%), Postives = 57/81 (70.37%), Query Frame = -3
Query: 1317 WRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFES--TPVYSKAHVFFVD 1550
            W+ L++D+ S ++++   KM D+  +G+T+V+D+ KRREP+P LEAIYLI+P  K ++ ++ DF+   +  Y  AHVFF D
Sbjct:   28 WKALIVDQLSMRMLSSCCKMTDIMTEGITIVEDIMKRREPLPSLEAIYLITPTDKSVQTLINDFKDPHSAKYKGAHVFFTD 108          
BLAST of SMED30020834 vs. Ensembl Zebrafish
Match: stxbp1a (syntaxin binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-050626-106])

HSP 1 Score: 77.0258 bits (188), Expect = 2.190e-14
Identity = 35/82 (42.68%), Postives = 57/82 (69.51%), Query Frame = -3
Query: 1314 WRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFES--TPVYSKAHVFFVDG 1550
            W+ L++D+ S ++++   KM D+  +G+T+V+D+ KRREP+P LEAIYLI+P  K ++ ++ DF+   +  Y  AHVFF D 
Sbjct:   28 WKALIVDQLSMRMLSSCCKMTDIMTEGITIVEDIMKRREPLPSLEAIYLITPTDKSVQTLINDFKDPHSAKYKGAHVFFTDS 109          
BLAST of SMED30020834 vs. Ensembl Xenopus
Match: krt8.1 (keratin 8, gene 1 [Source:Xenbase;Acc:XB-GENE-876929])

HSP 1 Score: 84.7297 bits (208), Expect = 1.064e-16
Identity = 38/99 (38.38%), Postives = 66/99 (66.67%), Query Frame = -3
Query: 1317 IHREICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFE--STPVYSKAHVFFVD 1604
            +  +I + V   + ++  W++L++D  S +I++   KM D+ D+G+T+V+D+ KRREP+P LEAIY I+P +K +  ++ DF+    P+Y  AH+FF D
Sbjct:   10 VGDKIVAGVITSVKKDGEWKVLLVDHTSMRILSSCCKMSDMLDEGITIVEDVNKRREPIPSLEAIYFITPCEKSVRAIISDFKDMGAPMYKAAHIFFTD 108          
BLAST of SMED30020834 vs. Ensembl Xenopus
Match: stxbp1 (syntaxin binding protein 1 [Source:NCBI gene;Acc:779976])

HSP 1 Score: 81.2629 bits (199), Expect = 1.212e-15
Identity = 36/82 (43.90%), Postives = 58/82 (70.73%), Query Frame = -3
Query: 1314 WRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFESTPV--YSKAHVFFVDG 1550
            W++LV+D+ S ++++   KM D+  +G+T+V+D+ KRREP+P LEA+YLI+P +K +  ++ DF+  P   Y  AHVFF D 
Sbjct:   14 WKVLVVDQLSMRMLSSCCKMTDIMTEGITIVEDINKRREPIPSLEAVYLITPSEKSVHSLISDFKDPPSSKYRAAHVFFTDS 95          
BLAST of SMED30020834 vs. Ensembl Xenopus
Match: stxbp1 (syntaxin binding protein 1 [Source:NCBI gene;Acc:779976])

HSP 1 Score: 81.2629 bits (199), Expect = 1.266e-15
Identity = 38/100 (38.00%), Postives = 65/100 (65.00%), Query Frame = -3
Query: 1314 IHREICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFESTPV--YSKAHVFFVDG 1604
            +  +I   V   + ++  W++LV+D+ S ++++   KM D+  +G+T+V+D+ KRREP+P LEA+YLI+P +K +  ++ DF+  P   Y  AHVFF D 
Sbjct:   10 VGEKIMHDVIRKVKKKGEWKVLVVDQLSMRMLSSCCKMTDIMTEGITIVEDINKRREPIPSLEAVYLITPSEKSVHSLISDFKDPPSSKYRAAHVFFTDS 109          
BLAST of SMED30020834 vs. Ensembl Xenopus
Match: stxbp1 (syntaxin binding protein 1 [Source:NCBI gene;Acc:779976])

HSP 1 Score: 81.2629 bits (199), Expect = 1.338e-15
Identity = 36/82 (43.90%), Postives = 58/82 (70.73%), Query Frame = -3
Query: 1314 WRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFESTPV--YSKAHVFFVDG 1550
            W++LV+D+ S ++++   KM D+  +G+T+V+D+ KRREP+P LEA+YLI+P +K +  ++ DF+  P   Y  AHVFF D 
Sbjct:   14 WKVLVVDQLSMRMLSSCCKMTDIMTEGITIVEDINKRREPIPSLEAVYLITPSEKSVHSLISDFKDPPSSKYRAAHVFFTDS 95          
BLAST of SMED30020834 vs. Ensembl Xenopus
Match: stxbp1 (syntaxin binding protein 1 [Source:NCBI gene;Acc:779976])

HSP 1 Score: 81.2629 bits (199), Expect = 1.379e-15
Identity = 36/82 (43.90%), Postives = 58/82 (70.73%), Query Frame = -3
Query: 1314 WRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFESTPV--YSKAHVFFVDG 1550
            W++LV+D+ S ++++   KM D+  +G+T+V+D+ KRREP+P LEA+YLI+P +K +  ++ DF+  P   Y  AHVFF D 
Sbjct:   14 WKVLVVDQLSMRMLSSCCKMTDIMTEGITIVEDINKRREPIPSLEAVYLITPSEKSVHSLISDFKDPPSSKYRAAHVFFTDS 95          
BLAST of SMED30020834 vs. Ensembl Mouse
Match: Stxbp2 (syntaxin binding protein 2 [Source:MGI Symbol;Acc:MGI:107370])

HSP 1 Score: 90.1225 bits (222), Expect = 1.731e-18
Identity = 40/99 (40.40%), Postives = 67/99 (67.68%), Query Frame = -3
Query: 1317 IHREICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFESTP--VYSKAHVFFVD 1604
            +  +I S V   + ++  W++L++D  S +I++   KM D+  +G+T+V+D+ KRREP+P LEAIYL+SP +K ++ ++ DF+ TP   Y  AH+FF D
Sbjct:   10 VGEKILSGVIRSVKKDGEWKVLIMDHPSMRILSSCCKMSDILAEGITIVEDINKRREPIPSLEAIYLLSPTEKSVQALIADFQGTPTFTYKAAHIFFTD 108          
BLAST of SMED30020834 vs. Ensembl Mouse
Match: Stxbp2 (syntaxin binding protein 2 [Source:MGI Symbol;Acc:MGI:107370])

HSP 1 Score: 90.1225 bits (222), Expect = 1.774e-18
Identity = 40/99 (40.40%), Postives = 67/99 (67.68%), Query Frame = -3
Query: 1317 IHREICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFESTP--VYSKAHVFFVD 1604
            +  +I S V   + ++  W++L++D  S +I++   KM D+  +G+T+V+D+ KRREP+P LEAIYL+SP +K ++ ++ DF+ TP   Y  AH+FF D
Sbjct:   10 VGEKILSGVIRSVKKDGEWKVLIMDHPSMRILSSCCKMSDILAEGITIVEDINKRREPIPSLEAIYLLSPTEKSVQALIADFQGTPTFTYKAAHIFFTD 108          
BLAST of SMED30020834 vs. Ensembl Mouse
Match: Stxbp1 (syntaxin binding protein 1 [Source:MGI Symbol;Acc:MGI:107363])

HSP 1 Score: 81.6481 bits (200), Expect = 9.406e-16
Identity = 36/82 (43.90%), Postives = 58/82 (70.73%), Query Frame = -3
Query: 1314 WRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFESTPV--YSKAHVFFVDG 1550
            W++LV+D+ S ++++   KM D+  +G+T+V+D+ KRREP+P LEA+YLI+P +K +  ++ DF+  P   Y  AHVFF D 
Sbjct:   28 WKVLVVDQLSMRMLSSCCKMTDIMTEGITIVEDINKRREPLPSLEAVYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDS 109          
BLAST of SMED30020834 vs. Ensembl Mouse
Match: Stxbp3 (syntaxin binding protein 3 [Source:MGI Symbol;Acc:MGI:107362])

HSP 1 Score: 81.2629 bits (199), Expect = 9.876e-16
Identity = 38/99 (38.38%), Postives = 68/99 (68.69%), Query Frame = -3
Query: 1317 IHREICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPV-PLEAIYLISPEKKKIELMLRDF--ESTPVYSKAHVFFVD 1604
            + R+I + VFD   +E  W+I++LDE++T++++   KM DL ++G+T+++++ K REPV  ++A+Y ISP  K ++  LRDF  +S   Y  A+++F D
Sbjct:   14 VWRKIKTAVFDDCRKEGEWKIMLLDEFTTKLLSSCCKMTDLLEEGITVIENIYKNREPVRQMKALYFISPTPKSVDCFLRDFGSKSEKKYKAAYIYFTD 112          
BLAST of SMED30020834 vs. Ensembl Mouse
Match: Stxbp1 (syntaxin binding protein 1 [Source:MGI Symbol;Acc:MGI:107363])

HSP 1 Score: 81.2629 bits (199), Expect = 1.091e-15
Identity = 36/82 (43.90%), Postives = 58/82 (70.73%), Query Frame = -3
Query: 1314 WRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFESTPV--YSKAHVFFVDG 1550
            W++LV+D+ S ++++   KM D+  +G+T+V+D+ KRREP+P LEA+YLI+P +K +  ++ DF+  P   Y  AHVFF D 
Sbjct:   28 WKVLVVDQLSMRMLSSCCKMTDIMTEGITIVEDINKRREPLPSLEAVYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDS 109          
BLAST of SMED30020834 vs. UniProt/SwissProt
Match: sp|Q29268|STXB2_PIG (Syntaxin-binding protein 2 (Fragment) OS=Sus scrofa OX=9823 GN=STXBP2 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.060e-18
Identity = 39/98 (39.80%), Postives = 64/98 (65.31%), Query Frame = -3
Query: 1320 IHREICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFESTP--VYSKAHVFFV 1604
            +  +I S V   + ++  W++L++D  S +I++   KM D+  +G+T+V+D+ KRREP+P LEAIYL+SP +K ++ ++ DF   P   Y  AHVFF 
Sbjct:   10 VGEKILSGVIRSVKKDGEWKVLIMDHPSMRILSSCCKMSDILAEGITIVEDINKRREPIPSLEAIYLLSPTEKSVQALIXDFRGXPTXTYKAAHVFFT 107          
BLAST of SMED30020834 vs. UniProt/SwissProt
Match: sp|Q15833|STXB2_HUMAN (Syntaxin-binding protein 2 OS=Homo sapiens OX=9606 GN=STXBP2 PE=1 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 5.452e-18
Identity = 40/99 (40.40%), Postives = 68/99 (68.69%), Query Frame = -3
Query: 1317 IHREICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFESTP--VYSKAHVFFVD 1604
            +  +I S V   + ++  W++L++D  S +I++   KM D+  +G+T+V+D+ KRREP+P LEAIYL+SP +K ++ +++DF+ TP   Y  AH+FF D
Sbjct:   10 VGEKILSGVIRSVKKDGEWKVLIMDHPSMRILSSCCKMSDILAEGITIVEDINKRREPIPSLEAIYLLSPTEKSVQALIKDFQGTPTFTYKAAHIFFTD 108          
BLAST of SMED30020834 vs. UniProt/SwissProt
Match: sp|Q64324|STXB2_MOUSE (Syntaxin-binding protein 2 OS=Mus musculus OX=10090 GN=Stxbp2 PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.241e-17
Identity = 40/99 (40.40%), Postives = 67/99 (67.68%), Query Frame = -3
Query: 1317 IHREICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFESTP--VYSKAHVFFVD 1604
            +  +I S V   + ++  W++L++D  S +I++   KM D+  +G+T+V+D+ KRREP+P LEAIYL+SP +K ++ ++ DF+ TP   Y  AH+FF D
Sbjct:   10 VGEKILSGVIRSVKKDGEWKVLIMDHPSMRILSSCCKMSDILAEGITIVEDINKRREPIPSLEAIYLLSPTEKSVQALIADFQGTPTFTYKAAHIFFTD 108          
BLAST of SMED30020834 vs. UniProt/SwissProt
Match: sp|Q62753|STXB2_RAT (Syntaxin-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Stxbp2 PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.328e-17
Identity = 40/96 (41.67%), Postives = 66/96 (68.75%), Query Frame = -3
Query: 1317 EICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFESTP--VYSKAHVFFVD 1595
            +I S V   + ++  W++L++D  S +I++   KM D+  +G+T+V+D+ KRREP+P LEAIYL+SP +K ++ ++ DF+ TP   Y  AH+FF D
Sbjct:   13 KILSGVIRSVKKDGEWKVLIMDHPSMRILSSCCKMSDILAEGITIVEDINKRREPIPSLEAIYLLSPTEKSVQALIADFQGTPTFTYKAAHIFFTD 108          
BLAST of SMED30020834 vs. UniProt/SwissProt
Match: sp|Q28288|STXB2_CANLF (Syntaxin-binding protein 2 OS=Canis lupus familiaris OX=9615 GN=STXBP2 PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 6.243e-17
Identity = 39/99 (39.39%), Postives = 66/99 (66.67%), Query Frame = -3
Query: 1317 IHREICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFESTP--VYSKAHVFFVD 1604
            +  +I + V   + ++  W++L++D  S +I++   KM D+  +G+T+V+D+ KRREP+P LEAIYL+SP +K ++ ++ DF  TP   Y  AH+FF D
Sbjct:   10 VGEKILNGVIRSVKKDGEWKVLIMDHPSMRILSSCCKMSDILAEGITIVEDINKRREPIPSLEAIYLLSPTEKSVQALIADFRGTPTFTYKAAHIFFTD 108          
BLAST of SMED30020834 vs. TrEMBL
Match: A0A2D4FWY2 (Uncharacterized protein (Fragment) OS=Micrurus corallinus OX=54390 PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 8.224e-19
Identity = 46/106 (43.40%), Postives = 69/106 (65.09%), Query Frame = -3
Query: 1296 IHREICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFESTP--VYSKAHVFFVDGEAGDLL 1604
            +  +I S V   + +E  W++L++D  ST+I++   KM DL  +G+T+++D+ KRREP+P LEAIYLISP +  +  ++ DF+STP   Y  AHVFF D    DL 
Sbjct:   10 VGEKILSDVIHSMKKEGEWKVLIMDHSSTRILSSCFKMSDLLAEGITIIEDINKRREPLPSLEAIYLISPIETSVRALINDFKSTPTFTYKAAHVFFTDTCPDDLF 115          
BLAST of SMED30020834 vs. TrEMBL
Match: A0A2D4FWZ1 (Uncharacterized protein (Fragment) OS=Micrurus corallinus OX=54390 PE=3 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.977e-18
Identity = 46/106 (43.40%), Postives = 69/106 (65.09%), Query Frame = -3
Query: 1296 IHREICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFESTP--VYSKAHVFFVDGEAGDLL 1604
            +  +I S V   + +E  W++L++D  ST+I++   KM DL  +G+T+++D+ KRREP+P LEAIYLISP +  +  ++ DF+STP   Y  AHVFF D    DL 
Sbjct:   38 VGEKILSDVIHSMKKEGEWKVLIMDHSSTRILSSCFKMSDLLAEGITIIEDINKRREPLPSLEAIYLISPIETSVRALINDFKSTPTFTYKAAHVFFTDTCPDDLF 143          
BLAST of SMED30020834 vs. TrEMBL
Match: A0A5J4NQ93 (Syntaxin-binding protein 1 OS=Paragonimus westermani OX=34504 GN=DEA37_0000528 PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.143e-18
Identity = 43/95 (45.26%), Postives = 68/95 (71.58%), Query Frame = -3
Query: 1314 EICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVPLEAIYLISPEKKKIELMLRDFESTP-VYSKAHVFFVDG 1595
            E+  ++  PL     W++LVLD  ST+I++   KMH++ + G+TLV+D+TKRRE +P+EAIYLI+P ++ I+L++ DF+S+   Y  AHVFF + 
Sbjct:   23 ELMEEIILPLKNSKDWKVLVLDRLSTRIVSSCCKMHEIMNNGITLVEDITKRREVLPIEAIYLITPTEQSIQLLMDDFQSSSNQYRFAHVFFTEA 117          
BLAST of SMED30020834 vs. TrEMBL
Match: A0A1S8X7V6 (Sec1 family protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_01303 PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 3.549e-17
Identity = 41/88 (46.59%), Postives = 64/88 (72.73%), Query Frame = -3
Query: 1320 VFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVPLEAIYLISPEKKKIELMLRDFES-TPVYSKAHVFFV 1580
            VF PLY+   W+IL++DE +T++++ + KMHD+ + G+TLV+ L K R P  +EAIY++ P +++++L LRDF S  P Y  AHVFF+
Sbjct:   15 VFQPLYQPGSWKILIMDERATRVVSSVYKMHDITEFGITLVESLYKVRRPFNMEAIYIMYPHRREVDLFLRDFSSEMPTYPAAHVFFL 102          
BLAST of SMED30020834 vs. TrEMBL
Match: A0A2D4JZP0 (Uncharacterized protein (Fragment) OS=Micrurus paraensis OX=1970185 PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 3.594e-17
Identity = 44/98 (44.90%), Postives = 65/98 (66.33%), Query Frame = -3
Query: 1296 VFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFESTP--VYSKAHVFFVDGEAGDLL 1580
            V   + +E  W++L++D  ST+I++   KM DL  +G+T+++D+ KRREP+P LEAIYLISP +  +  ++ DF+STP   Y  AHVFF D    DL 
Sbjct:    1 VIHSMKKEGEWKVLIMDYSSTRILSSCFKMSDLLAEGITIIEDINKRREPLPSLEAIYLISPIETSVRALINDFKSTPTFTYKAAHVFFTDTCPDDLF 98          
BLAST of SMED30020834 vs. Ensembl Cavefish
Match: stxbp2 (syntaxin binding protein 2 [Source:NCBI gene;Acc:103039197])

HSP 1 Score: 77.7962 bits (190), Expect = 1.091e-14
Identity = 37/98 (37.76%), Postives = 63/98 (64.29%), Query Frame = -3
Query: 1317 IHREICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPV-PLEAIYLISPEKKKIELMLRDF-ESTPVYSKAHVFFVD 1604
            +  +I + V   + ++  W++L++D  S +I++   KM D+  +GVT+V+D+ KRREP+  LEAIY ISP  K ++ ++ DF +S   Y  AH+FF +
Sbjct:   10 VGEKIINGVLKSIKKDGEWKVLIVDHISMRILSSCCKMSDIMAEGVTIVEDINKRREPISSLEAIYFISPVSKSVDGLISDFKDSAFTYKAAHIFFTE 107          
BLAST of SMED30020834 vs. Ensembl Cavefish
Match: stxbp1a (syntaxin binding protein 1 [Source:NCBI gene;Acc:103024456])

HSP 1 Score: 77.411 bits (189), Expect = 1.266e-14
Identity = 35/81 (43.21%), Postives = 58/81 (71.60%), Query Frame = -3
Query: 1317 WRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFES--TPVYSKAHVFFVD 1550
            W+ L++D+ S ++++   KM D+  +G+T+V+D+ KRREP+P LEAIYLI+P +K ++ ++ DF+   +  Y  AHVFF D
Sbjct:   28 WKALIVDQLSMRMLSSCCKMTDIMTEGITIVEDINKRREPLPTLEAIYLITPTEKSVQTLVGDFKDPHSSKYRAAHVFFTD 108          
BLAST of SMED30020834 vs. Ensembl Cavefish
Match: stxbp1a (syntaxin binding protein 1 [Source:NCBI gene;Acc:103024456])

HSP 1 Score: 77.411 bits (189), Expect = 1.453e-14
Identity = 35/82 (42.68%), Postives = 58/82 (70.73%), Query Frame = -3
Query: 1314 WRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFES--TPVYSKAHVFFVDG 1550
            W+ L++D+ S ++++   KM D+  +G+T+V+D+ KRREP+P LEAIYLI+P +K ++ ++ DF+   +  Y  AHVFF D 
Sbjct:   28 WKALIVDQLSMRMLSSCCKMTDIMTEGITIVEDINKRREPLPTLEAIYLITPTEKSVQTLVGDFKDPHSSKYRAAHVFFTDS 109          
BLAST of SMED30020834 vs. Ensembl Cavefish
Match: stxbp3 (syntaxin binding protein 3 [Source:NCBI gene;Acc:103044348])

HSP 1 Score: 76.6406 bits (187), Expect = 2.407e-14
Identity = 34/87 (39.08%), Postives = 58/87 (66.67%), Query Frame = -3
Query: 1296 IWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPV-PLEAIYLISPEKKKIELMLRDFESTPVYSKAHVFFVDGEAGDLL 1553
            +W+I++LD ++T++++   KM DL  +G+T+V+DL K REPV  ++A+Y +SP  K ++  + DF+  P Y  A+V+F D    DL 
Sbjct:   30 VWKIMILDSFTTRLLSSCCKMSDLMAEGITIVEDLFKSREPVLEMKAVYFMSPTTKCVDAFINDFKLKPKYKAAYVYFTDYCPDDLF 116          
BLAST of SMED30020834 vs. Ensembl Sea Lamprey
Match: stxbp1a (syntaxin binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-050626-106])

HSP 1 Score: 82.8037 bits (203), Expect = 5.314e-17
Identity = 37/99 (37.37%), Postives = 66/99 (66.67%), Query Frame = -3
Query: 1317 IHREICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFESTPV--YSKAHVFFVD 1604
            +  +I  +V   + ++  W++LV+D+ S ++++   KM D+  +G+T+V+D+ KRREP+P LEA+YLI+P +K +  ++ DF+   +  Y  AHVFF D
Sbjct:   11 VGEKIMKEVIQKVKKKGEWKVLVVDQLSMRMLSSCCKMTDIMTEGITIVEDINKRREPIPSLEALYLITPSEKSVRALINDFKDASIFKYKGAHVFFTD 109          
BLAST of SMED30020834 vs. Ensembl Yeast
Match: SLY1 (Hydrophilic protein involved in ER/Golgi vesicle trafficking; SM (Sec1/Munc-18) family protein that binds the tSNARE Sed5p and stimulates its assembly into a trans-SNARE membrane-protein complex [Source:SGD;Acc:S000002597])

HSP 1 Score: 59.3066 bits (142), Expect = 1.003e-9
Identity = 31/90 (34.44%), Postives = 57/90 (63.33%), Query Frame = -3
Query: 1296 EENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFESTPVYSKAHVFFVDGEAGDLL 1562
            +E IW++L+LD  ST  I+ +L+++DL   G+T+   + + R P+P + AIY +SP K+ I++++ D +S   YS+ ++ F      +LL
Sbjct:   49 QEIIWKVLILDIKSTATISSVLRVNDLLKAGITVHSLIKQDRSPLPDVPAIYFVSPTKENIDIIVNDLKSDK-YSEFYINFTSSLPRNLL 137          
BLAST of SMED30020834 vs. Ensembl Nematostella
Match: EDO43368 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYS1])

HSP 1 Score: 83.9593 bits (206), Expect = 3.933e-17
Identity = 43/85 (50.59%), Postives = 62/85 (72.94%), Query Frame = -3
Query: 1293 LVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFESTPV-YSKAHVFFVDGEAGDLLI 1541
            LVLD  ST++I+  +KMHDL D GVT+V++L KRREP+P LEAIY+++PE+  I L++ DF+  P+ Y  AH+FF +     LL+
Sbjct:    1 LVLDHLSTRMISSCVKMHDLIDNGVTVVENLEKRREPLPQLEAIYILTPEEDSISLLVADFKEYPLKYKGAHLFFTEVCPDSLLV 85          
BLAST of SMED30020834 vs. Ensembl Nematostella
Match: EDO43369 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYS2])

HSP 1 Score: 79.337 bits (194), Expect = 1.101e-15
Identity = 40/94 (42.55%), Postives = 66/94 (70.21%), Query Frame = -3
Query: 1317 ICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFES-TPVYSKAHVFFVD 1592
            I   VF PL++   W++LV+D  S ++++  LKMHDL + G+T+V+++  +REP+  LEAIYLI+P++K +E ++ DF+S    Y  AH+FF +
Sbjct:    6 IIDNVFKPLHKVGEWKVLVVDHLSMRMVSSCLKMHDLLEVGITIVENVHIQREPLNRLEAIYLITPDEKVLEEVIEDFDSFFLTYKSAHIFFTE 99          
BLAST of SMED30020834 vs. Ensembl Medaka
Match: stxbp1b (syntaxin-binding protein 1 [Source:NCBI gene;Acc:101159753])

HSP 1 Score: 86.2705 bits (212), Expect = 1.962e-17
Identity = 40/99 (40.40%), Postives = 65/99 (65.66%), Query Frame = -3
Query: 1317 IHREICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFE--STPVYSKAHVFFVD 1604
            +  +I + V     E+  W++LV+D+ S ++++   KM D+  +G+T+V+D+TKRREP+P +EAIYLI+P  + +E ++ DF     P Y  AHVFF D
Sbjct:   10 VGEKIMNNVIKKAREKGKWKVLVVDKLSMKMVSSCCKMTDIMSEGITIVEDITKRREPLPSMEAIYLITPSDESVEGLIEDFRDPQNPRYRAAHVFFTD 108          
BLAST of SMED30020834 vs. Ensembl Medaka
Match: stxbp1b (syntaxin-binding protein 1 [Source:NCBI gene;Acc:101159753])

HSP 1 Score: 86.2705 bits (212), Expect = 2.041e-17
Identity = 40/99 (40.40%), Postives = 65/99 (65.66%), Query Frame = -3
Query: 1317 IHREICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFE--STPVYSKAHVFFVD 1604
            +  +I + V     E+  W++LV+D+ S ++++   KM D+  +G+T+V+D+TKRREP+P +EAIYLI+P  + +E ++ DF     P Y  AHVFF D
Sbjct:   10 VGEKIMNNVIKKAREKGKWKVLVVDKLSMKMVSSCCKMTDIMSEGITIVEDITKRREPLPSMEAIYLITPSDESVEGLIEDFRDPQNPRYRAAHVFFTD 108          
BLAST of SMED30020834 vs. Ensembl Medaka
Match: stxbp1b (syntaxin-binding protein 1 [Source:NCBI gene;Acc:101159753])

HSP 1 Score: 86.2705 bits (212), Expect = 2.206e-17
Identity = 40/99 (40.40%), Postives = 65/99 (65.66%), Query Frame = -3
Query: 1317 IHREICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFE--STPVYSKAHVFFVD 1604
            +  +I + V     E+  W++LV+D+ S ++++   KM D+  +G+T+V+D+TKRREP+P +EAIYLI+P  + +E ++ DF     P Y  AHVFF D
Sbjct:   10 VGEKIMNNVIKKAREKGKWKVLVVDKLSMKMVSSCCKMTDIMSEGITIVEDITKRREPLPSMEAIYLITPSDESVEGLIEDFRDPQNPRYRAAHVFFTD 108          
BLAST of SMED30020834 vs. Ensembl Medaka
Match: stxbp1b (syntaxin-binding protein 1 [Source:NCBI gene;Acc:101159753])

HSP 1 Score: 85.8853 bits (211), Expect = 2.928e-17
Identity = 40/99 (40.40%), Postives = 65/99 (65.66%), Query Frame = -3
Query: 1317 IHREICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFE--STPVYSKAHVFFVD 1604
            +  +I + V     E+  W++LV+D+ S ++++   KM D+  +G+T+V+D+TKRREP+P +EAIYLI+P  + +E ++ DF     P Y  AHVFF D
Sbjct:   10 VGEKIMNNVIKKAREKGKWKVLVVDKLSMKMVSSCCKMTDIMSEGITIVEDITKRREPLPSMEAIYLITPSDESVEGLIEDFRDPQNPRYRAAHVFFTD 108          
BLAST of SMED30020834 vs. Ensembl Medaka
Match: stxbp1b (syntaxin-binding protein 1 [Source:NCBI gene;Acc:101159753])

HSP 1 Score: 85.8853 bits (211), Expect = 2.966e-17
Identity = 40/99 (40.40%), Postives = 65/99 (65.66%), Query Frame = -3
Query: 1317 IHREICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVP-LEAIYLISPEKKKIELMLRDFE--STPVYSKAHVFFVD 1604
            +  +I + V     E+  W++LV+D+ S ++++   KM D+  +G+T+V+D+TKRREP+P +EAIYLI+P  + +E ++ DF     P Y  AHVFF D
Sbjct:   10 VGEKIMNNVIKKAREKGKWKVLVVDKLSMKMVSSCCKMTDIMSEGITIVEDITKRREPLPSMEAIYLITPSDESVEGLIEDFRDPQNPRYRAAHVFFTD 108          
BLAST of SMED30020834 vs. Planmine SMEST
Match: SMESG000060160.1 (SMESG000060160.1)

HSP 1 Score: 199.519 bits (506), Expect = 5.224e-56
Identity = 96/97 (98.97%), Postives = 96/97 (98.97%), Query Frame = -3
Query: 1317 NIHREICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVPLEAIYLISPEKKKIELMLRDFESTPVYSKAHVFFVD 1607
            NIHREICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDL KRREPVPLEAIYLISPEKKKIELMLRDFESTPVYSKAHVFFVD
Sbjct:    6 NIHREICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLAKRREPVPLEAIYLISPEKKKIELMLRDFESTPVYSKAHVFFVD 102          
BLAST of SMED30020834 vs. Planmine SMEST
Match: SMESG000060160.1 (SMESG000060160.1)

HSP 1 Score: 105.916 bits (263), Expect = 9.318e-24
Identity = 50/53 (94.34%), Postives = 51/53 (96.23%), Query Frame = -3
Query: 1308 TLVDDLTKRREPVPLEAIYLISPEKKKIELMLRDFESTPVYSKAHVFFVDGEA 1466
            + VDDL KRREPVPLEAIYLISPEKKKIELMLRDFESTPVYSKAHVFFVDGEA
Sbjct:  109 SFVDDLAKRREPVPLEAIYLISPEKKKIELMLRDFESTPVYSKAHVFFVDGEA 161          
BLAST of SMED30020834 vs. Planmine SMEST
Match: SMESG000013817.1 (SMESG000013817.1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.468e-18
Identity = 41/99 (41.41%), Postives = 69/99 (69.70%), Query Frame = -3
Query: 1314 NIHREICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDKGVTLVDDLTKRREPVPLEAIYLISPEKKKIELMLRDF-ESTPVYSKAHVFFVDG 1607
            ++ ++I   V   + +E  W++L++D+ ST++I+   KMHD+ ++G+TLV+D+ K+RE +PLEAIYLI+P +K I+ ++ DF  S   Y  AHVFF + 
Sbjct:    5 SVAKKILDDVIRTIKKEGEWKVLIVDKLSTRMISSCCKMHDIMNEGITLVEDINKKREILPLEAIYLITPTEKSIKSLMADFTGSKNQYKAAHVFFTEA 103          
The following BLAST results are available for this feature:
BLAST of SMED30020834 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STXBP26.548e-2045.68syntaxin binding protein 2 [Source:HGNC Symbol;Acc... [more]
STXBP26.010e-1940.40syntaxin binding protein 2 [Source:HGNC Symbol;Acc... [more]
STXBP21.135e-1840.40syntaxin binding protein 2 [Source:HGNC Symbol;Acc... [more]
STXBP12.898e-1843.90syntaxin binding protein 1 [Source:HGNC Symbol;Acc... [more]
STXBP17.830e-1843.90syntaxin binding protein 1 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of SMED30020834 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
unc-182.677e-1540.24Putative acetylcholine regulator unc-18 [Source:U... [more]
T07A9.104.758e-1238.82pep chromosome:WBcel235:IV:390512:393158:1 gene:WB... [more]
sly-18.095e-636.00SLY1 homolog [Source:UniProtKB/TrEMBL;Acc:Q20364][more]
sly-19.358e-636.00SLY1 homolog [Source:UniProtKB/TrEMBL;Acc:Q20364][more]
back to top
BLAST of SMED30020834 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Rop7.530e-1643.21gene:FBgn0004574 transcript:FBtr0310632[more]
Rop7.530e-1643.21gene:FBgn0004574 transcript:FBtr0073263[more]
back to top
BLAST of SMED30020834 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stxbp24.094e-1743.30syntaxin binding protein 2 [Source:ZFIN;Acc:ZDB-GE... [more]
stxbp1b3.417e-1637.00syntaxin binding protein 1b [Source:ZFIN;Acc:ZDB-G... [more]
stxbp1b3.417e-1637.00syntaxin binding protein 1b [Source:ZFIN;Acc:ZDB-G... [more]
stxbp1a1.850e-1443.21syntaxin binding protein 1a [Source:ZFIN;Acc:ZDB-G... [more]
stxbp1a2.190e-1442.68syntaxin binding protein 1a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of SMED30020834 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
krt8.11.064e-1638.38keratin 8, gene 1 [Source:Xenbase;Acc:XB-GENE-8769... [more]
stxbp11.212e-1543.90syntaxin binding protein 1 [Source:NCBI gene;Acc:7... [more]
stxbp11.266e-1538.00syntaxin binding protein 1 [Source:NCBI gene;Acc:7... [more]
stxbp11.338e-1543.90syntaxin binding protein 1 [Source:NCBI gene;Acc:7... [more]
stxbp11.379e-1543.90syntaxin binding protein 1 [Source:NCBI gene;Acc:7... [more]
back to top
BLAST of SMED30020834 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Stxbp21.731e-1840.40syntaxin binding protein 2 [Source:MGI Symbol;Acc:... [more]
Stxbp21.774e-1840.40syntaxin binding protein 2 [Source:MGI Symbol;Acc:... [more]
Stxbp19.406e-1643.90syntaxin binding protein 1 [Source:MGI Symbol;Acc:... [more]
Stxbp39.876e-1638.38syntaxin binding protein 3 [Source:MGI Symbol;Acc:... [more]
Stxbp11.091e-1543.90syntaxin binding protein 1 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of SMED30020834 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q29268|STXB2_PIG1.060e-1839.80Syntaxin-binding protein 2 (Fragment) OS=Sus scrof... [more]
sp|Q15833|STXB2_HUMAN5.452e-1840.40Syntaxin-binding protein 2 OS=Homo sapiens OX=9606... [more]
sp|Q64324|STXB2_MOUSE1.241e-1740.40Syntaxin-binding protein 2 OS=Mus musculus OX=1009... [more]
sp|Q62753|STXB2_RAT2.328e-1741.67Syntaxin-binding protein 2 OS=Rattus norvegicus OX... [more]
sp|Q28288|STXB2_CANLF6.243e-1739.39Syntaxin-binding protein 2 OS=Canis lupus familiar... [more]
back to top
BLAST of SMED30020834 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2D4FWY28.224e-1943.40Uncharacterized protein (Fragment) OS=Micrurus cor... [more]
A0A2D4FWZ11.977e-1843.40Uncharacterized protein (Fragment) OS=Micrurus cor... [more]
A0A5J4NQ932.143e-1845.26Syntaxin-binding protein 1 OS=Paragonimus westerma... [more]
A0A1S8X7V63.549e-1746.59Sec1 family protein (Fragment) OS=Opisthorchis viv... [more]
A0A2D4JZP03.594e-1744.90Uncharacterized protein (Fragment) OS=Micrurus par... [more]
back to top
BLAST of SMED30020834 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
stxbp21.091e-1437.76syntaxin binding protein 2 [Source:NCBI gene;Acc:1... [more]
stxbp1a1.266e-1443.21syntaxin binding protein 1 [Source:NCBI gene;Acc:1... [more]
stxbp1a1.453e-1442.68syntaxin binding protein 1 [Source:NCBI gene;Acc:1... [more]
stxbp32.407e-1439.08syntaxin binding protein 3 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of SMED30020834 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
stxbp1a5.314e-1737.37syntaxin binding protein 1a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of SMED30020834 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SLY11.003e-934.44Hydrophilic protein involved in ER/Golgi vesicle t... [more]
back to top
BLAST of SMED30020834 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO433683.933e-1750.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433691.101e-1542.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30020834 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stxbp1b1.962e-1740.40syntaxin-binding protein 1 [Source:NCBI gene;Acc:1... [more]
stxbp1b2.041e-1740.40syntaxin-binding protein 1 [Source:NCBI gene;Acc:1... [more]
stxbp1b2.206e-1740.40syntaxin-binding protein 1 [Source:NCBI gene;Acc:1... [more]
stxbp1b2.928e-1740.40syntaxin-binding protein 1 [Source:NCBI gene;Acc:1... [more]
stxbp1b2.966e-1740.40syntaxin-binding protein 1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of SMED30020834 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000060160.15.224e-5698.97SMESG000060160.1[more]
SMESG000060160.19.318e-2494.34SMESG000060160.1[more]
SMESG000013817.12.468e-1841.41SMESG000013817.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020834 ID=SMED30020834|Name=SMED30020834|organism=Schmidtea mediterranea sexual|type=transcript|length=1687bp
CTACAAATGGTGAAATTTAAATTCAATATAGAAATAATATAACTAAATGT
TATGCGAAACTTAAAATCCAACTTAAATAAAAATGAAATATATTTCAACG
AAATGGTCGTCATTTCAGTTATCAGTGTTAAAACTCAATAAATCAAATAA
ATACCATCAATAAATTAGTTATTGATTGGGTATTAATGGAAGAGGATTGA
CAGACAGTTTTCAATATTTTACAGGAAATCTTTTCTCTATAATTGTCAAA
ATTTCTAAGTTAAATTTATGTTGGAGATTCACTTGTAGATTTTTCTATGT
TGAATAATATTACTCAAACTCTTCATAACACTCTTTACTTGAGCACTAGT
GTAAAGAGTTTCGTGAGTCTTCCATTGTATGTGACAGTTTCACTCTACGG
ATACTCAAACAAAAAATATTAATAATAAATATTTGTTCTTTAATGTATTT
GAAACTATTCTCTTTCAAATTTGAATGATTAAAATATTTGAAACCTTTCA
AAATGATGGGCAATTTTCTAACGGAAACTCGTGGTTAAACAATGATGATA
GATAAGAATCAAAGATATATAAGAGCGATTAATTTTATTTAGATTTGTCA
TTATTAGTCGAAGAAATTACGTTACCATAAAGAAAAATAAAAAAGATAAA
CCAAAACTAAGTTCAAAACACAGCTACAAGCTACTTACGGATCAACCCTT
ATGAAGATTTACCTTATTTTGAAATATTAAAAAAAGAAAATACATTCCTT
ATGTGATAACTGGATCTTAATTGTTGTCAATTATGTATTTTAAATAAAGT
TTTAATAATGCTTGTTATTAGTTTTATATAGTGAAAGATGAAATGACTTA
CTGGCCGAAAGATTTATGAATTCAACAGCGCCTACTTCCAAATTAATTGT
AATATATCTAAATGTAAATGACTTTTTAATCAAATTTATAATCTCACTTA
AATACCAAAATAGCCTTGAACATCTAGAGAAAAACCTTTATAATTTAGGG
TCTTTATTAATTTGTAAAAGCGGTAAAAGTATTTCCCAAAGTTTTGTTTA
AGTAAATGGACTGCTGTGGACTCTTATAATTCAATGAAATAGTCAATTAC
CGATCCAGCTCACCCAATATCAATTATCAATACAATAAGAATTTGGTCGG
CATCAAAAGATGTTTGGCGCCCACGTTTGACGGATCAGCACTATGAACAA
GGTCCAACGACAAGTATTAGAGATCAATTATTCTAACACAGTCAAAAATC
GTCAATATTATCATAATAAAATAAACAAATTTGTGGCTAATAAATCAACA
AATCACCAGCCTCACCGTCAACAAAAAACACATGTGCCTTGCTGTAGACC
GGGGTTGATTCAAAATCACGAAGCATCAATTCAATTTTCTTTTTTTCTGG
GGATATTAAATAAATGGCTTCCAGCGGCACGGGTTCTCGTCGTTTGGTTA
AGTCATCGACAAGAGTTACTCCTTTATCGAATAGATCGTGCATTTTAAGG
ATTTTTGCAATAATTTGCGTACTATATTCATCAAGAACGAGAATCCTCCA
GATGTTTTCTTCGTATAGAGGATCAAACACTTTCGAACATATCTCTCTAT
GAATATTTAATTTCAGAGACATTCATAAAATAGAAAAACTTTTAAATAAA
AGTTAATGTAATTTAATGAACTAAAACAATATACAAA
back to top

protein sequence of SMED30020834-orf-1

>SMED30020834-orf-1 ID=SMED30020834-orf-1|Name=SMED30020834-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=112bp
MSLKLNIHREICSKVFDPLYEENIWRILVLDEYSTQIIAKILKMHDLFDK
GVTLVDDLTKRREPVPLEAIYLISPEKKKIELMLRDFESTPVYSKAHVFF
VDGEAGDLLIY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR043154Sec-1-like_dom1
IPR036045Sec1-like_sf
IPR001619Sec1-like
Vocabulary: biological process
TermDefinition
GO:0006904vesicle docking involved in exocytosis
GO:0016192vesicle-mediated transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001619Sec1-like proteinPFAMPF00995Sec1coord: 27..102
e-value: 5.9E-15
score: 55.5
IPR001619Sec1-like proteinPANTHERPTHR11679VESICLE PROTEIN SORTING-ASSOCIATEDcoord: 7..104
IPR043154Sec1-like, domain 1GENE3DG3DSA:3.40.50.2060coord: 1..109
e-value: 4.7E-32
score: 112.3
NoneNo IPR availablePANTHERPTHR11679:SF27SYNTAXIN-BINDING PROTEIN 2coord: 7..104
IPR036045Sec1-like superfamilySUPERFAMILYSSF56815Sec1/munc18-like (SM) proteinscoord: 15..102