Protein I'm not dead yet

Overview
NameProtein I'm not dead yet
Smed IDSMED30020825
Length (bp)288
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein I'm not dead yet (SMED30020825) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein I'm not dead yet (SMED30020825) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020825

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30020825SMESG000041335.1 dd_Smed_v4_12964_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30020825SMESG000041335.1 dd_Smed_v4_12964_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020825SMESG000041335.1 dd_Smed_v4_12964_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020825SMESG000041335.1 dd_Smed_v4_12964_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30020825SMESG000041335.1 dd_Smed_v4_12964_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020825SMESG000041335.1 dd_Smed_v4_12964_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
proximal tubuleSMED30020825SMESG000041335.1 Smed-slc13a-2smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein I'm not dead yet vs. Ensembl Human
Match: SLC13A5 (solute carrier family 13 member 5 [Source:HGNC Symbol;Acc:HGNC:23089])

HSP 1 Score: 52.373 bits (124), Expect = 5.707e-10
Identity = 23/47 (48.94%), Postives = 36/47 (76.60%), Query Frame = 3
Query:  129 KAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAA 269
            K ++C Y+I ++A++W TEV+ LAVTSL+P++LFP F IL    V++
Sbjct:   34 KFVRCAYVIILMAIYWCTEVIPLAVTSLMPVLLFPLFQILDSRCVSS 80          
BLAST of Protein I'm not dead yet vs. Ensembl Human
Match: SLC13A5 (solute carrier family 13 member 5 [Source:HGNC Symbol;Acc:HGNC:23089])

HSP 1 Score: 55.4546 bits (132), Expect = 6.128e-10
Identity = 26/51 (50.98%), Postives = 37/51 (72.55%), Query Frame = 3
Query:  129 KAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            K ++C Y+I ++A++W TEV+ LAVTSL+P++LFP F IL    V   YMK
Sbjct:   34 KFVRCAYVIILMAIYWCTEVIPLAVTSLMPVLLFPLFQILDSRQVCVQYMK 84          
BLAST of Protein I'm not dead yet vs. Ensembl Human
Match: SLC13A5 (solute carrier family 13 member 5 [Source:HGNC Symbol;Acc:HGNC:23089])

HSP 1 Score: 55.4546 bits (132), Expect = 6.340e-10
Identity = 26/51 (50.98%), Postives = 37/51 (72.55%), Query Frame = 3
Query:  129 KAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            K ++C Y+I ++A++W TEV+ LAVTSL+P++LFP F IL    V   YMK
Sbjct:   34 KFVRCAYVIILMAIYWCTEVIPLAVTSLMPVLLFPLFQILDSRQVCVQYMK 84          
BLAST of Protein I'm not dead yet vs. Ensembl Human
Match: SLC13A5 (solute carrier family 13 member 5 [Source:HGNC Symbol;Acc:HGNC:23089])

HSP 1 Score: 55.4546 bits (132), Expect = 6.418e-10
Identity = 26/51 (50.98%), Postives = 37/51 (72.55%), Query Frame = 3
Query:  129 KAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            K ++C Y+I ++A++W TEV+ LAVTSL+P++LFP F IL    V   YMK
Sbjct:   34 KFVRCAYVIILMAIYWCTEVIPLAVTSLMPVLLFPLFQILDSRQVCVQYMK 84          
BLAST of Protein I'm not dead yet vs. Ensembl Human
Match: SLC13A5 (solute carrier family 13 member 5 [Source:HGNC Symbol;Acc:HGNC:23089])

HSP 1 Score: 50.8322 bits (120), Expect = 2.544e-9
Identity = 22/40 (55.00%), Postives = 33/40 (82.50%), Query Frame = 3
Query:  129 KAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGIL 248
            K ++C Y+I ++A++W TEV+ LAVTSL+P++LFP F IL
Sbjct:   34 KFVRCAYVIILMAIYWCTEVIPLAVTSLMPVLLFPLFQIL 73          
BLAST of Protein I'm not dead yet vs. Ensembl Celegans
Match: nac-3 (Sodium-dependent high-affinity dicarboxylate transporter 3 [Source:UniProtKB/Swiss-Prot;Acc:Q21339])

HSP 1 Score: 55.4546 bits (132), Expect = 2.776e-10
Identity = 24/48 (50.00%), Postives = 36/48 (75.00%), Query Frame = 3
Query:  138 QCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            +C Y + I+AV+W++EVM LAVT+++P+VLFP  G+L  +T A  YM 
Sbjct:   76 KCAYCVCIIAVYWMSEVMPLAVTAMLPVVLFPLVGVLDANTTAKEYMN 123          
BLAST of Protein I'm not dead yet vs. Ensembl Celegans
Match: nac-1 (Sodium-dependent low-affinity dicarboxylate transporter 1 [Source:UniProtKB/Swiss-Prot;Acc:Q93655])

HSP 1 Score: 47.3654 bits (111), Expect = 2.010e-7
Identity = 18/47 (38.30%), Postives = 31/47 (65.96%), Query Frame = 3
Query:  138 QCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYM 278
            +C Y + ++  +W+ E + LA+T+ IP++LFP FGI+    VA  Y+
Sbjct:   43 KCLYCVAVMGSYWVFEALPLAITAFIPMILFPLFGIMRSEEVARAYL 89          
BLAST of Protein I'm not dead yet vs. Ensembl Fly
Match: CG33934 (gene:FBgn0064119 transcript:FBtr0300808)

HSP 1 Score: 51.9878 bits (123), Expect = 5.774e-9
Identity = 24/55 (43.64%), Postives = 34/55 (61.82%), Query Frame = 3
Query:  117 VTGNKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            +  N A QC Y++  +A+FWITE + L +T+L P+V  P FGILT   V + Y  
Sbjct:   43 LENNLAFQCMYLVANMALFWITEAIPLYLTALFPVVFLPLFGILTSEKVCSFYFS 97          
BLAST of Protein I'm not dead yet vs. Ensembl Fly
Match: CG33934 (gene:FBgn0064119 transcript:FBtr0300809)

HSP 1 Score: 51.9878 bits (123), Expect = 5.774e-9
Identity = 24/55 (43.64%), Postives = 34/55 (61.82%), Query Frame = 3
Query:  117 VTGNKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            +  N A QC Y++  +A+FWITE + L +T+L P+V  P FGILT   V + Y  
Sbjct:   43 LENNLAFQCMYLVANMALFWITEAIPLYLTALFPVVFLPLFGILTSEKVCSFYFS 97          
BLAST of Protein I'm not dead yet vs. Ensembl Fly
Match: CG33934 (gene:FBgn0064119 transcript:FBtr0301700)

HSP 1 Score: 51.9878 bits (123), Expect = 5.947e-9
Identity = 24/55 (43.64%), Postives = 34/55 (61.82%), Query Frame = 3
Query:  117 VTGNKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            +  N A QC Y++  +A+FWITE + L +T+L P+V  P FGILT   V + Y  
Sbjct:   43 LENNLAFQCMYLVANMALFWITEAIPLYLTALFPVVFLPLFGILTSEKVCSFYFS 97          
BLAST of Protein I'm not dead yet vs. Ensembl Fly
Match: Indy (gene:FBgn0036816 transcript:FBtr0075081)

HSP 1 Score: 51.2174 bits (121), Expect = 9.825e-9
Identity = 31/79 (39.24%), Postives = 51/79 (64.56%), Query Frame = 3
Query:   48 NFLSHNWKSXXXXXXXXXXXXXAVTGNKA-MQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            NF +++WK L++  VP++ LP+ +    A  +C Y++ ++A+FW+TE + L VTS+IPIV FP  GI++       Y K
Sbjct:   35 NFFANHWKGLVVFLVPLLCLPVMLLNEGAEFRCMYLLLVMAIFWVTEALPLYVTSMIPIVAFPIMGIMSSDQTCRLYFK 113          
BLAST of Protein I'm not dead yet vs. Ensembl Fly
Match: Indy (gene:FBgn0036816 transcript:FBtr0301857)

HSP 1 Score: 51.2174 bits (121), Expect = 1.049e-8
Identity = 31/79 (39.24%), Postives = 51/79 (64.56%), Query Frame = 3
Query:   48 NFLSHNWKSXXXXXXXXXXXXXAVTGNKA-MQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            NF +++WK L++  VP++ LP+ +    A  +C Y++ ++A+FW+TE + L VTS+IPIV FP  GI++       Y K
Sbjct:   17 NFFANHWKGLVVFLVPLLCLPVMLLNEGAEFRCMYLLLVMAIFWVTEALPLYVTSMIPIVAFPIMGIMSSDQTCRLYFK 95          
BLAST of Protein I'm not dead yet vs. Ensembl Zebrafish
Match: slc13a1 (solute carrier family 13 member 1 [Source:ZFIN;Acc:ZDB-GENE-031222-3])

HSP 1 Score: 59.3066 bits (142), Expect = 1.917e-11
Identity = 27/55 (49.09%), Postives = 40/55 (72.73%), Query Frame = 3
Query:  117 VTGNKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            V   K  +C Y++ ++AV+W+TEV+ L+VT+LIP +LFP FGI+  S VA+ Y K
Sbjct:   29 VIKTKEAECAYVLILMAVYWMTEVLPLSVTALIPALLFPLFGIMKSSQVASQYFK 83          
BLAST of Protein I'm not dead yet vs. Ensembl Zebrafish
Match: slc13a1 (solute carrier family 13 member 1 [Source:ZFIN;Acc:ZDB-GENE-031222-3])

HSP 1 Score: 59.3066 bits (142), Expect = 2.289e-11
Identity = 27/55 (49.09%), Postives = 40/55 (72.73%), Query Frame = 3
Query:  117 VTGNKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            V   K  +C Y++ ++AV+W+TEV+ L+VT+LIP +LFP FGI+  S VA+ Y K
Sbjct:   29 VIKTKEAECAYVLILMAVYWMTEVLPLSVTALIPALLFPLFGIMKSSQVASQYFK 83          
BLAST of Protein I'm not dead yet vs. Ensembl Zebrafish
Match: slc13a5a (solute carrier family 13 member 5a [Source:ZFIN;Acc:ZDB-GENE-030131-4628])

HSP 1 Score: 54.6842 bits (130), Expect = 9.010e-10
Identity = 26/55 (47.27%), Postives = 37/55 (67.27%), Query Frame = 3
Query:  117 VTGNKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            V G+K   C Y++ ++AV+W TEV+ LAVT+L+P VLFP F I+    V   Y+K
Sbjct:   32 VIGSKEAGCAYVVVLMAVYWCTEVLPLAVTALLPAVLFPLFRIMESKDVCMQYLK 86          
BLAST of Protein I'm not dead yet vs. Ensembl Zebrafish
Match: slc13a5b (solute carrier family 13 member 5b [Source:ZFIN;Acc:ZDB-GENE-130530-605])

HSP 1 Score: 52.373 bits (124), Expect = 6.089e-9
Identity = 25/55 (45.45%), Postives = 34/55 (61.82%), Query Frame = 3
Query:  117 VTGNKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            V   +   C Y+I ++AV+W TE + LAVTSL+P VLFP  GI+    V   Y+K
Sbjct:   30 VISTREASCAYVIILMAVYWCTEALPLAVTSLLPAVLFPMLGIMQSKMVCMQYLK 84          
BLAST of Protein I'm not dead yet vs. Ensembl Zebrafish
Match: slc13a2 (solute carrier family 13 member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2389])

HSP 1 Score: 52.373 bits (124), Expect = 6.359e-9
Identity = 23/48 (47.92%), Postives = 34/48 (70.83%), Query Frame = 3
Query:  138 QCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            +CG+ I ++A+FW TE M LA+T+L+P+VLFP  GI+    V   Y+K
Sbjct:   42 RCGFAIILMALFWCTECMPLAITALLPVVLFPMMGIMESGKVCVQYLK 89          
BLAST of Protein I'm not dead yet vs. Ensembl Xenopus
Match: pias3 (protein inhibitor of activated STAT 3 [Source:Xenbase;Acc:XB-GENE-486632])

HSP 1 Score: 56.225 bits (134), Expect = 3.013e-10
Identity = 23/51 (45.10%), Postives = 36/51 (70.59%), Query Frame = 3
Query:  129 KAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            K  +C Y++ +VA+FW++E + L+VT+ +P ++FP FGIL    VAA Y K
Sbjct:    9 KETECAYVLFVVAIFWLSEALPLSVTAFLPALMFPLFGILPSKAVAATYFK 59          
BLAST of Protein I'm not dead yet vs. Ensembl Xenopus
Match: pias3 (protein inhibitor of activated STAT 3 [Source:Xenbase;Acc:XB-GENE-486632])

HSP 1 Score: 56.225 bits (134), Expect = 3.102e-10
Identity = 23/51 (45.10%), Postives = 36/51 (70.59%), Query Frame = 3
Query:  129 KAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            K  +C Y++ +VA+FW++E + L+VT+ +P ++FP FGIL    VAA Y K
Sbjct:    9 KETECAYVLFVVAIFWLSEALPLSVTAFLPALMFPLFGILPSKAVAATYFK 59          
BLAST of Protein I'm not dead yet vs. Ensembl Xenopus
Match: pias3 (protein inhibitor of activated STAT 3 [Source:Xenbase;Acc:XB-GENE-486632])

HSP 1 Score: 55.0694 bits (131), Expect = 8.410e-10
Identity = 22/48 (45.83%), Postives = 35/48 (72.92%), Query Frame = 3
Query:  138 QCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            +C Y++ +VA+FW++E + L+VT+ +P ++FP FGIL    VAA Y K
Sbjct:   10 ECAYVLFVVAIFWLSEALPLSVTAFLPALMFPLFGILPSKAVAATYFK 57          
BLAST of Protein I'm not dead yet vs. Ensembl Xenopus
Match: pias3 (protein inhibitor of activated STAT 3 [Source:Xenbase;Acc:XB-GENE-486632])

HSP 1 Score: 55.0694 bits (131), Expect = 8.578e-10
Identity = 22/48 (45.83%), Postives = 35/48 (72.92%), Query Frame = 3
Query:  138 QCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            +C Y++ +VA+FW++E + L+VT+ +P ++FP FGIL    VAA Y K
Sbjct:   12 ECAYVLFVVAIFWLSEALPLSVTAFLPALMFPLFGILPSKAVAATYFK 59          
BLAST of Protein I'm not dead yet vs. Ensembl Xenopus
Match: pias3 (protein inhibitor of activated STAT 3 [Source:Xenbase;Acc:XB-GENE-486632])

HSP 1 Score: 55.0694 bits (131), Expect = 9.975e-10
Identity = 22/48 (45.83%), Postives = 35/48 (72.92%), Query Frame = 3
Query:  138 QCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            +C Y++ +VA+FW++E + L+VT+ +P ++FP FGIL    VAA Y K
Sbjct:   17 ECAYVLFVVAIFWLSEALPLSVTAFLPALMFPLFGILPSKAVAATYFK 64          
BLAST of Protein I'm not dead yet vs. Ensembl Mouse
Match: Slc13a1 (solute carrier family 13 (sodium/sulfate symporters), member 1 [Source:MGI Symbol;Acc:MGI:1859937])

HSP 1 Score: 60.8474 bits (146), Expect = 5.781e-12
Identity = 25/52 (48.08%), Postives = 38/52 (73.08%), Query Frame = 3
Query:  126 NKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
             K  QC YI+ ++A+FWITE + L++T+L+P ++FP FGI+  S VA+ Y K
Sbjct:   32 TKEAQCAYILFVIAIFWITEALPLSITALLPGLMFPMFGIMRSSQVASAYFK 83          
BLAST of Protein I'm not dead yet vs. Ensembl Mouse
Match: Slc13a3 (solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3 [Source:MGI Symbol;Acc:MGI:2149635])

HSP 1 Score: 49.6766 bits (117), Expect = 5.491e-8
Identity = 24/49 (48.98%), Postives = 34/49 (69.39%), Query Frame = 3
Query:  129 KAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACY 275
            K  +C Y+I ++AV+W TE + L+VT+L+PI+LFP  GIL  S V   Y
Sbjct:   37 KEGRCLYVILLMAVYWCTEALPLSVTALLPIILFPFMGILPSSKVCPQY 85          
BLAST of Protein I'm not dead yet vs. Ensembl Mouse
Match: Slc13a3 (solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3 [Source:MGI Symbol;Acc:MGI:2149635])

HSP 1 Score: 49.2914 bits (116), Expect = 6.208e-8
Identity = 24/49 (48.98%), Postives = 34/49 (69.39%), Query Frame = 3
Query:  129 KAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACY 275
            K  +C Y+I ++AV+W TE + L+VT+L+PI+LFP  GIL  S V   Y
Sbjct:   37 KEGRCLYVILLMAVYWCTEALPLSVTALLPIILFPFMGILPSSKVCPQY 85          
BLAST of Protein I'm not dead yet vs. Ensembl Mouse
Match: Slc13a4 (solute carrier family 13 (sodium/sulfate symporters), member 4 [Source:MGI Symbol;Acc:MGI:2442367])

HSP 1 Score: 48.521 bits (114), Expect = 1.427e-7
Identity = 20/47 (42.55%), Postives = 31/47 (65.96%), Query Frame = 3
Query:  141 CGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            C Y++ + AV+W++E + L   +L+P  L+P FG+L  S VAA Y K
Sbjct:   37 CAYVLLVTAVYWVSEAVPLGAAALVPAFLYPFFGVLRSSEVAAEYFK 83          
BLAST of Protein I'm not dead yet vs. Ensembl Mouse
Match: Slc13a2 (solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2 [Source:MGI Symbol;Acc:MGI:1276558])

HSP 1 Score: 47.3654 bits (111), Expect = 3.350e-7
Identity = 24/51 (47.06%), Postives = 31/51 (60.78%), Query Frame = 3
Query:  129 KAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            K   C Y I ++A+ W TE + LAVT+L PI+LFP  GI+  S V   Y K
Sbjct:   34 KEAYCAYSIILMALLWCTEALPLAVTALFPIILFPLMGIMEASKVCLEYFK 84          
BLAST of Protein I'm not dead yet vs. UniProt/SwissProt
Match: sp|Q9JHI4|S13A1_MOUSE (Solute carrier family 13 member 1 OS=Mus musculus OX=10090 GN=Slc13a1 PE=2 SV=2)

HSP 1 Score: 60.8474 bits (146), Expect = 4.044e-11
Identity = 25/52 (48.08%), Postives = 38/52 (73.08%), Query Frame = 3
Query:  126 NKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
             K  QC YI+ ++A+FWITE + L++T+L+P ++FP FGI+  S VA+ Y K
Sbjct:   32 TKEAQCAYILFVIAIFWITEALPLSITALLPGLMFPMFGIMRSSQVASAYFK 83          
BLAST of Protein I'm not dead yet vs. UniProt/SwissProt
Match: sp|Q07782|S13A1_RAT (Solute carrier family 13 member 1 OS=Rattus norvegicus OX=10116 GN=Slc13a1 PE=2 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 3.588e-10
Identity = 23/52 (44.23%), Postives = 39/52 (75.00%), Query Frame = 3
Query:  126 NKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            +K  +C YI+ ++A FWITE + L++T+L+P ++FP FGI++ + VA+ Y K
Sbjct:   32 SKEAECAYILFVIATFWITEALPLSITALLPGLMFPMFGIMSSTHVASAYFK 83          
BLAST of Protein I'm not dead yet vs. UniProt/SwissProt
Match: sp|Q86YT5|S13A5_HUMAN (Solute carrier family 13 member 5 OS=Homo sapiens OX=9606 GN=SLC13A5 PE=1 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 3.082e-9
Identity = 26/51 (50.98%), Postives = 37/51 (72.55%), Query Frame = 3
Query:  129 KAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            K ++C Y+I ++A++W TEV+ LAVTSL+P++LFP F IL    V   YMK
Sbjct:   34 KFVRCAYVIILMAIYWCTEVIPLAVTSLMPVLLFPLFQILDSRQVCVQYMK 84          
BLAST of Protein I'm not dead yet vs. UniProt/SwissProt
Match: sp|Q21339|NAD3_CAEEL (Sodium-dependent high-affinity dicarboxylate transporter 3 OS=Caenorhabditis elegans OX=6239 GN=nac-3 PE=2 SV=3)

HSP 1 Score: 55.4546 bits (132), Expect = 3.532e-9
Identity = 24/48 (50.00%), Postives = 36/48 (75.00%), Query Frame = 3
Query:  138 QCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            +C Y + I+AV+W++EVM LAVT+++P+VLFP  G+L  +T A  YM 
Sbjct:   76 KCAYCVCIIAVYWMSEVMPLAVTAMLPVVLFPLVGVLDANTTAKEYMN 123          
BLAST of Protein I'm not dead yet vs. UniProt/SwissProt
Match: sp|Q9BZW2|S13A1_HUMAN (Solute carrier family 13 member 1 OS=Homo sapiens OX=9606 GN=SLC13A1 PE=1 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 1.375e-8
Identity = 31/89 (34.83%), Postives = 50/89 (56.18%), Query Frame = 3
Query:   15 MNFLNILLIVRNFLSHNWKSXXXXXXXXXXXXXAVTGNKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            M F + +L+ R FL       ++  V ++L    V   K  +C Y + +VA FW+TE + L+VT+L+P ++ P FGI+    VA+ Y K
Sbjct:    1 MKFFSYILVYRRFL------FVVFTVLVLLPLPIVLHTKEAECAYTLFVVATFWLTEALPLSVTALLPSLMLPMFGIMPSKKVASAYFK 83          
BLAST of Protein I'm not dead yet vs. TrEMBL
Match: A0A0H3YIY1 (Slc13a-2 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc13a-2 PE=2 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 2.841e-46
Identity = 91/91 (100.00%), Postives = 91/91 (100.00%), Query Frame = 3
Query:   15 MNFLNILLIVRNFLSHNWKSXXXXXXXXXXXXXAVTGNKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMKVI 287
            MNFLNILLIVRNFLSHNWKSLIIIFVPIVLLPLAVTGNKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMKVI
Sbjct:    1 MNFLNILLIVRNFLSHNWKSLIIIFVPIVLLPLAVTGNKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMKVI 91          
BLAST of Protein I'm not dead yet vs. TrEMBL
Match: A0A0H3YJ28 (Slc13a-5 OS=Schmidtea mediterranea OX=79327 GN=slc13a-5 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 2.062e-23
Identity = 58/78 (74.36%), Postives = 68/78 (87.18%), Query Frame = 3
Query:   54 LSHNWKSXXXXXXXXXXXXXAVTGNKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMKVI 287
            +  NWKSL+II VPI+LLP+ VTGNK MQCGYII IV++FW+TEVM++AVTSLIPIVLFPAFGIL P+ VA CYMK I
Sbjct:   10 MKQNWKSLVIIIVPILLLPMVVTGNKQMQCGYIIAIVSIFWVTEVMHIAVTSLIPIVLFPAFGILKPTQVAGCYMKDI 87          
BLAST of Protein I'm not dead yet vs. TrEMBL
Match: A0A0H3YK55 (Slc13a-4 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc13a-4 PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 7.011e-21
Identity = 50/82 (60.98%), Postives = 62/82 (75.61%), Query Frame = 3
Query:   42 VRNFLSHNWKSXXXXXXXXXXXXXAVTGNKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMKVI 287
            +  F+ HNWK++++  VPIV  PL  TGNK MQCGY+I IV  +W+TE+MN+AV SLIP+VLFP F ILTP  VA CYMK I
Sbjct:   23 IYKFVKHNWKTVLLFTVPIVFSPLTFTGNKPMQCGYVIIIVGAYWVTEIMNIAVASLIPVVLFPIFQILTPEKVATCYMKDI 104          
BLAST of Protein I'm not dead yet vs. TrEMBL
Match: A0A0H3YEZ9 (Slc13a-6 OS=Schmidtea mediterranea OX=79327 GN=slc13a-6 PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.111e-19
Identity = 48/80 (60.00%), Postives = 63/80 (78.75%), Query Frame = 3
Query:   48 NFLSHNWKSXXXXXXXXXXXXXAVTGNKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMKVI 287
             F  HNW+++ +I +PI+ LP+  +GNK +QCGYII IV +FWITEVM++AVTSLIP+VLFP F IL P +VA C+MK I
Sbjct:   10 KFCKHNWRTVFLISIPILFLPMTFSGNKPLQCGYIIIIVGLFWITEVMDIAVTSLIPVVLFPIFKILDPESVATCFMKDI 89          
BLAST of Protein I'm not dead yet vs. TrEMBL
Match: A0A0H3YIY6 (Slc13a-7 OS=Schmidtea mediterranea OX=79327 GN=slc13a-7 PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 5.751e-19
Identity = 40/54 (74.07%), Postives = 47/54 (87.04%), Query Frame = 3
Query:  120 TGNKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            +GNK MQC Y++ +VA+FWITEV+NL VTSLIPIVLFP FGILTP  +AACYMK
Sbjct:   29 SGNKPMQCAYVVLVVAIFWITEVLNLPVTSLIPIVLFPTFGILTPKMIAACYMK 82          
BLAST of Protein I'm not dead yet vs. Ensembl Cavefish
Match: slc13a1 (solute carrier family 13 member 1 [Source:NCBI gene;Acc:103036655])

HSP 1 Score: 56.6102 bits (135), Expect = 1.591e-10
Identity = 26/52 (50.00%), Postives = 36/52 (69.23%), Query Frame = 3
Query:  126 NKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            +K  +C Y + ++AVFW+TE M L+VT+L+P  LFP FGI+  S VA  Y K
Sbjct:   33 SKVSECAYTLILMAVFWMTEAMPLSVTALLPAFLFPLFGIMKSSVVATMYFK 84          
BLAST of Protein I'm not dead yet vs. Ensembl Cavefish
Match: slc13a5a (solute carrier family 13 member 5 [Source:NCBI gene;Acc:103038195])

HSP 1 Score: 56.225 bits (134), Expect = 2.087e-10
Identity = 24/51 (47.06%), Postives = 35/51 (68.63%), Query Frame = 3
Query:  129 KAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            K   C Y+IG++AV+W TEV+ LAVT+L+P +LFP FG++    V   Y+ 
Sbjct:   34 KEASCAYVIGLMAVYWCTEVIPLAVTALLPAILFPLFGVMQSKDVCRQYLN 84          
BLAST of Protein I'm not dead yet vs. Ensembl Cavefish
Match: slc13a5b (solute carrier family 13 member 5-like [Source:NCBI gene;Acc:103022547])

HSP 1 Score: 55.4546 bits (132), Expect = 4.376e-10
Identity = 24/53 (45.28%), Postives = 35/53 (66.04%), Query Frame = 3
Query:  123 GNKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            G +   C Y+I ++AV+W TE + LA+T+L+P VLFP FGI+    V   Y+K
Sbjct:   32 GTREANCAYVIMLMAVYWCTEALPLAITALLPAVLFPLFGIMQSKQVCMQYLK 84          
BLAST of Protein I'm not dead yet vs. Ensembl Cavefish
Match: slc13a2 (solute carrier family 13 member 2-like [Source:NCBI gene;Acc:103044483])

HSP 1 Score: 53.1434 bits (126), Expect = 2.196e-9
Identity = 22/48 (45.83%), Postives = 35/48 (72.92%), Query Frame = 3
Query:  138 QCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            +CGY+I ++A++W TE M LA+T+L+P++LFP  GI+    V   Y+K
Sbjct:   49 KCGYVIIVMALYWCTECMPLAMTALLPVILFPMLGIMESGKVCVLYLK 96          
BLAST of Protein I'm not dead yet vs. Ensembl Cavefish
Match: slc13a4 (solute carrier family 13 member 4 [Source:NCBI gene;Acc:103021794])

HSP 1 Score: 47.3654 bits (111), Expect = 3.034e-7
Identity = 19/48 (39.58%), Postives = 31/48 (64.58%), Query Frame = 3
Query:  138 QCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
             C Y++ + AV+W++E + L   +L+P  L+P FG+L  S VA+ Y K
Sbjct:   43 SCAYVLIVTAVYWVSEAVPLGAAALVPAFLYPLFGVLKSSEVASEYFK 90          
BLAST of Protein I'm not dead yet vs. Ensembl Sea Lamprey
Match: slc13a4 (solute carrier family 13 member 4 [Source:ZFIN;Acc:ZDB-GENE-070424-71])

HSP 1 Score: 43.5134 bits (101), Expect = 1.408e-6
Identity = 18/52 (34.62%), Postives = 30/52 (57.69%), Query Frame = 3
Query:  126 NKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            +K   C Y + + A  W++E + L   +L+P +L+P  G++  S VAA Y K
Sbjct:   30 SKVKACAYTVLLTATLWVSEAVPLGAAALLPAMLYPLLGVMRSSQVAAEYFK 81          
BLAST of Protein I'm not dead yet vs. Ensembl Nematostella
Match: EDO44544 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVB9])

HSP 1 Score: 55.4546 bits (132), Expect = 1.252e-10
Identity = 24/51 (47.06%), Postives = 37/51 (72.55%), Query Frame = 3
Query:  129 KAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            +  +C Y I I+A+FW+TEV+ LAVT+L+P+VLFP  G+L+    +  Y+K
Sbjct:   34 REARCAYAILIMAIFWVTEVIPLAVTALLPLVLFPMLGVLSAQEASLPYLK 84          
BLAST of Protein I'm not dead yet vs. Ensembl Nematostella
Match: EDO42123 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2D4])

HSP 1 Score: 51.6026 bits (122), Expect = 3.515e-9
Identity = 22/48 (45.83%), Postives = 36/48 (75.00%), Query Frame = 3
Query:  138 QCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            +C Y I I+AV+W+TEV++LAVT+L+P+VLFP  G++    ++  Y +
Sbjct:   23 RCAYCILIMAVYWVTEVVSLAVTALLPLVLFPMLGVVGSKQISPPYFQ 70          
BLAST of Protein I'm not dead yet vs. Ensembl Medaka
Match: slc13a5b (solute carrier family 13 member 5 [Source:NCBI gene;Acc:101165907])

HSP 1 Score: 57.3806 bits (137), Expect = 9.051e-11
Identity = 27/55 (49.09%), Postives = 37/55 (67.27%), Query Frame = 3
Query:  117 VTGNKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            V G    +C YII ++AV+W TEV+ LAVT+L+P +LFP FGI+    V   Y+K
Sbjct:   96 VIGTPEAECAYIIILMAVYWCTEVLPLAVTALLPAILFPLFGIMESQDVGMQYLK 150          
BLAST of Protein I'm not dead yet vs. Ensembl Medaka
Match: slc13a1 (solute carrier family 13 member 1 [Source:NCBI gene;Acc:101166470])

HSP 1 Score: 56.225 bits (134), Expect = 2.358e-10
Identity = 23/55 (41.82%), Postives = 39/55 (70.91%), Query Frame = 3
Query:  117 VTGNKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            V   K  +C +++ ++AV+W+TE++ L++T+++P VLFP FGI+  S VA  Y K
Sbjct:   31 VIRTKEAECAFVMLLMAVYWVTEILPLSITAMLPAVLFPLFGIMKSSDVAKWYFK 85          
BLAST of Protein I'm not dead yet vs. Ensembl Medaka
Match: slc13a2 (solute carrier family 13 member 2 [Source:NCBI gene;Acc:101161499])

HSP 1 Score: 53.1434 bits (126), Expect = 2.572e-9
Identity = 24/48 (50.00%), Postives = 35/48 (72.92%), Query Frame = 3
Query:  138 QCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            +CGY I ++A++W TE M LAVT+L+P+VLFP  GI+    V+  Y+K
Sbjct:   40 KCGYAIILMALYWCTECMPLAVTALLPVVLFPMMGIMKAGDVSIEYLK 87          
BLAST of Protein I'm not dead yet vs. Ensembl Medaka
Match: slc13a5a (solute carrier family 13 member 5 [Source:NCBI gene;Acc:101160832])

HSP 1 Score: 52.7582 bits (125), Expect = 3.113e-9
Identity = 23/47 (48.94%), Postives = 33/47 (70.21%), Query Frame = 3
Query:  141 CGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            C Y+I ++AV+W TEV+ LAVT+L+P +LFP  GI+    V   Y+K
Sbjct:   42 CAYVIALMAVYWCTEVLPLAVTALLPTILFPMLGIMESKDVCMQYLK 88          
BLAST of Protein I'm not dead yet vs. Ensembl Medaka
Match: slc13a5a (solute carrier family 13 member 5 [Source:NCBI gene;Acc:101160832])

HSP 1 Score: 52.7582 bits (125), Expect = 3.706e-9
Identity = 23/47 (48.94%), Postives = 33/47 (70.21%), Query Frame = 3
Query:  141 CGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK 281
            C Y+I ++AV+W TEV+ LAVT+L+P +LFP  GI+    V   Y+K
Sbjct:   21 CAYVIALMAVYWCTEVLPLAVTALLPTILFPMLGIMESKDVCMQYLK 67          
BLAST of Protein I'm not dead yet vs. Planmine SMEST
Match: SMESG000041335.1 (SMESG000041335.1)

HSP 1 Score: 150.214 bits (378), Expect = 3.412e-44
Identity = 90/91 (98.90%), Postives = 90/91 (98.90%), Query Frame = 3
Query:   15 MNFLNILLIVRNFLSHNWKSXXXXXXXXXXXXXAVTGNKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMKVI 287
            MNFLNILLIVRNFLSHNWKSLIIIFVPIVLLPLAVTGNKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMK I
Sbjct:    1 MNFLNILLIVRNFLSHNWKSLIIIFVPIVLLPLAVTGNKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMKDI 91          
BLAST of Protein I'm not dead yet vs. Planmine SMEST
Match: SMESG000041352.1 (SMESG000041352.1)

HSP 1 Score: 102.834 bits (255), Expect = 3.775e-27
Identity = 58/78 (74.36%), Postives = 68/78 (87.18%), Query Frame = 3
Query:   54 LSHNWKSXXXXXXXXXXXXXAVTGNKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMKVI 287
            +  NWKSL+II VPI+LLP+ VTGNK MQCGYII IV++FW+TEVM++AVTSLIPIVLFPAFGIL P+ VA CYMK I
Sbjct:   10 MKQNWKSLVIIIVPILLLPMVVTGNKQMQCGYIIAIVSIFWVTEVMHIAVTSLIPIVLFPAFGILKPTQVAGCYMKDI 87          
BLAST of Protein I'm not dead yet vs. Planmine SMEST
Match: SMESG000041352.1 (SMESG000041352.1)

HSP 1 Score: 102.449 bits (254), Expect = 4.347e-27
Identity = 58/78 (74.36%), Postives = 68/78 (87.18%), Query Frame = 3
Query:   54 LSHNWKSXXXXXXXXXXXXXAVTGNKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMKVI 287
            +  NWKSL+II VPI+LLP+ VTGNK MQCGYII IV++FW+TEVM++AVTSLIPIVLFPAFGIL P+ VA CYMK I
Sbjct:    1 MKQNWKSLVIIIVPILLLPMVVTGNKQMQCGYIIAIVSIFWVTEVMHIAVTSLIPIVLFPAFGILKPTQVAGCYMKDI 78          
BLAST of Protein I'm not dead yet vs. Planmine SMEST
Match: SMESG000041352.1 (SMESG000041352.1)

HSP 1 Score: 97.4413 bits (241), Expect = 3.351e-25
Identity = 45/57 (78.95%), Postives = 51/57 (89.47%), Query Frame = 3
Query:  117 VTGNKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMKVI 287
            VTGNK MQCGYII IV++FW+TEVM++AVTSLIPIVLFPAFGIL P+ VA CYMK I
Sbjct:    3 VTGNKQMQCGYIIAIVSIFWVTEVMHIAVTSLIPIVLFPAFGILKPTQVAGCYMKDI 59          
BLAST of Protein I'm not dead yet vs. Planmine SMEST
Match: SMESG000041346.1 (SMESG000041346.1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.237e-24
Identity = 50/82 (60.98%), Postives = 62/82 (75.61%), Query Frame = 3
Query:   42 VRNFLSHNWKSXXXXXXXXXXXXXAVTGNKAMQCGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMKVI 287
            +  F+ HNWK++++  VPIV  PL  TGNK MQCGY+I IV  +W+TE+MN+AV SLIP+VLFP F ILTP  VA CYMK I
Sbjct:   11 IYKFVKHNWKTVLLFTVPIVFSPLTFTGNKPMQCGYVIIIVGAYWVTEIMNIAVASLIPVVLFPIFQILTPEKVATCYMKDI 92          
The following BLAST results are available for this feature:
BLAST of Protein I'm not dead yet vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC13A55.707e-1048.94solute carrier family 13 member 5 [Source:HGNC Sym... [more]
SLC13A56.128e-1050.98solute carrier family 13 member 5 [Source:HGNC Sym... [more]
SLC13A56.340e-1050.98solute carrier family 13 member 5 [Source:HGNC Sym... [more]
SLC13A56.418e-1050.98solute carrier family 13 member 5 [Source:HGNC Sym... [more]
SLC13A52.544e-955.00solute carrier family 13 member 5 [Source:HGNC Sym... [more]
back to top
BLAST of Protein I'm not dead yet vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nac-32.776e-1050.00Sodium-dependent high-affinity dicarboxylate trans... [more]
nac-12.010e-738.30Sodium-dependent low-affinity dicarboxylate transp... [more]
back to top
BLAST of Protein I'm not dead yet vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG339345.774e-943.64gene:FBgn0064119 transcript:FBtr0300808[more]
CG339345.774e-943.64gene:FBgn0064119 transcript:FBtr0300809[more]
CG339345.947e-943.64gene:FBgn0064119 transcript:FBtr0301700[more]
Indy9.825e-939.24gene:FBgn0036816 transcript:FBtr0075081[more]
Indy1.049e-839.24gene:FBgn0036816 transcript:FBtr0301857[more]
back to top
BLAST of Protein I'm not dead yet vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc13a11.917e-1149.09solute carrier family 13 member 1 [Source:ZFIN;Acc... [more]
slc13a12.289e-1149.09solute carrier family 13 member 1 [Source:ZFIN;Acc... [more]
slc13a5a9.010e-1047.27solute carrier family 13 member 5a [Source:ZFIN;Ac... [more]
slc13a5b6.089e-945.45solute carrier family 13 member 5b [Source:ZFIN;Ac... [more]
slc13a26.359e-947.92solute carrier family 13 member 2 [Source:ZFIN;Acc... [more]
back to top
BLAST of Protein I'm not dead yet vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pias33.013e-1045.10protein inhibitor of activated STAT 3 [Source:Xenb... [more]
pias33.102e-1045.10protein inhibitor of activated STAT 3 [Source:Xenb... [more]
pias38.410e-1045.83protein inhibitor of activated STAT 3 [Source:Xenb... [more]
pias38.578e-1045.83protein inhibitor of activated STAT 3 [Source:Xenb... [more]
pias39.975e-1045.83protein inhibitor of activated STAT 3 [Source:Xenb... [more]
back to top
BLAST of Protein I'm not dead yet vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc13a15.781e-1248.08solute carrier family 13 (sodium/sulfate symporter... [more]
Slc13a35.491e-848.98solute carrier family 13 (sodium-dependent dicarbo... [more]
Slc13a36.208e-848.98solute carrier family 13 (sodium-dependent dicarbo... [more]
Slc13a41.427e-742.55solute carrier family 13 (sodium/sulfate symporter... [more]
Slc13a23.350e-747.06solute carrier family 13 (sodium-dependent dicarbo... [more]
back to top
BLAST of Protein I'm not dead yet vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JHI4|S13A1_MOUSE4.044e-1148.08Solute carrier family 13 member 1 OS=Mus musculus ... [more]
sp|Q07782|S13A1_RAT3.588e-1044.23Solute carrier family 13 member 1 OS=Rattus norveg... [more]
sp|Q86YT5|S13A5_HUMAN3.082e-950.98Solute carrier family 13 member 5 OS=Homo sapiens ... [more]
sp|Q21339|NAD3_CAEEL3.532e-950.00Sodium-dependent high-affinity dicarboxylate trans... [more]
sp|Q9BZW2|S13A1_HUMAN1.375e-834.83Solute carrier family 13 member 1 OS=Homo sapiens ... [more]
back to top
BLAST of Protein I'm not dead yet vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YIY12.841e-46100.00Slc13a-2 (Fragment) OS=Schmidtea mediterranea OX=7... [more]
A0A0H3YJ282.062e-2374.36Slc13a-5 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YK557.011e-2160.98Slc13a-4 (Fragment) OS=Schmidtea mediterranea OX=7... [more]
A0A0H3YEZ91.111e-1960.00Slc13a-6 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YIY65.751e-1974.07Slc13a-7 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
back to top
BLAST of Protein I'm not dead yet vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc13a11.591e-1050.00solute carrier family 13 member 1 [Source:NCBI gen... [more]
slc13a5a2.087e-1047.06solute carrier family 13 member 5 [Source:NCBI gen... [more]
slc13a5b4.376e-1045.28solute carrier family 13 member 5-like [Source:NCB... [more]
slc13a22.196e-945.83solute carrier family 13 member 2-like [Source:NCB... [more]
slc13a43.034e-739.58solute carrier family 13 member 4 [Source:NCBI gen... [more]
back to top
BLAST of Protein I'm not dead yet vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc13a41.408e-634.62solute carrier family 13 member 4 [Source:ZFIN;Acc... [more]
back to top
BLAST of Protein I'm not dead yet vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein I'm not dead yet vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO445441.252e-1047.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421233.515e-945.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein I'm not dead yet vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc13a5b9.051e-1149.09solute carrier family 13 member 5 [Source:NCBI gen... [more]
slc13a12.358e-1041.82solute carrier family 13 member 1 [Source:NCBI gen... [more]
slc13a22.572e-950.00solute carrier family 13 member 2 [Source:NCBI gen... [more]
slc13a5a3.113e-948.94solute carrier family 13 member 5 [Source:NCBI gen... [more]
slc13a5a3.706e-948.94solute carrier family 13 member 5 [Source:NCBI gen... [more]
back to top
BLAST of Protein I'm not dead yet vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041335.13.412e-4498.90SMESG000041335.1[more]
SMESG000041352.13.775e-2774.36SMESG000041352.1[more]
SMESG000041352.14.347e-2774.36SMESG000041352.1[more]
SMESG000041352.13.351e-2578.95SMESG000041352.1[more]
SMESG000041346.12.237e-2460.98SMESG000041346.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020825 ID=SMED30020825|Name=Protein I'm not dead yet|organism=Schmidtea mediterranea sexual|type=transcript|length=288bp
CATAGTTTTGTTAAATGAATTTTTTAAATATTTTATTAATCGTCAGAAAT
TTTCTTTCTCACAATTGGAAATCGTTGATAATCATTTTCGTACCAATTGT
ATTGTTACCCCTAGCTGTCACTGGAAATAAAGCCATGCAATGTGGATATA
TCATTGGAATTGTTGCTGTTTTTTGGATTACCGAAGTCATGAATTTAGCG
GTTACATCGCTGATCCCGATCGTTCTCTTTCCCGCTTTCGGGATACTGAC
TCCGTCAACTGTCGCAGCATGCTATATGAAGGTGATCT
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0005215transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000087proximal tubule
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR001898SLC13A/DASS
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001898Solute carrier family 13PFAMPF00939Na_sulph_sympcoord: 20..86
e-value: 3.7E-6
score: 26.3
NoneNo IPR availablePANTHERPTHR10283SOLUTE CARRIER FAMILY 13 MEMBERcoord: 14..89
NoneNo IPR availablePANTHERPTHR10283:SF66SOLUTE CARRIER FAMILY 13 MEMBER 2coord: 14..89
NoneNo IPR availableTMHMMTMhelixcoord: 66..88
NoneNo IPR availableTMHMMTMhelixcoord: 20..37
NoneNo IPR availableTMHMMTMhelixcoord: 44..61