slc39a-9

Overview
Nameslc39a-9 (AKN21674.1)
Smed IDSMED30020824
Length (bp)1188
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc39a-9 (SMED30020824) t-SNE clustered cells

Violin plots show distribution of expression levels for slc39a-9 (SMED30020824) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc39a-9 (SMED30020824) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc39a-9 (SMED30020824) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020824

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30020824h1SMcG0015927 SmedASXL_013334SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30020824h1SMcG0015927 SmedASXL_013334SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30020824h1SMcG0015927 dd_Smed_v6_17213_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30020824h1SMcG0015927 OX_Smed_1.0.22028ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc39a-9 vs. Ensembl Human
Match: SLC39A13 (solute carrier family 39 member 13 [Source:HGNC Symbol;Acc:HGNC:20859])

HSP 1 Score: 104.76 bits (260), Expect = 2.036e-24
Identity = 88/285 (30.88%), Postives = 138/285 (48.42%), Query Frame = 2
Query:  131 VMPLIMLKIFKNIDFVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWRNYKVKSN--------LNLLVAGLWTIGGLITFFICEK---SLNIIGITVGRSADMTLKCYDQSDLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIG-GLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACISL 949
            V PL+++ +       S+   + L  K+LLSF +G LLG+VFL+++P  W  Y   ++              GLW I G++TF   EK        G +   + D T      + LN         A        + IK  GYL L+ + ++N  +G+ +  +F ++ KIGL TT+ +L+HEIP+E+ DF +L+ +GFD +     Q  ++   ++G G        K       W+LP   G  LYIALV + P ++ E+ P  S  QLL +C GI +    SL
Sbjct:   83 VFPLLVIPLEMGTMLRSEAGAWRL--KQLLSFALGGLLGNVFLHLLPEAWA-YTCSASPGGEGQSLQQQQQLGLWVIAGILTFLALEKMFLDSKEEGTSQAPNKDPTAAA---AALNGGHCLAQPAAEPGLGAVVRSIKVSGYLNLLANTIDNFTHGLAVAASFLVSKKIGLLTTMAILLHEIPHEVGDFAILLRAGFDRWSAAKLQLSTALGGLLGAGFAICTQSPKGVEETAAWVLPFTSGGFLYIALVNVLPDLLEEEDPWRSLQQLLLLCAGIVVMVLFSL 361          
BLAST of slc39a-9 vs. Ensembl Human
Match: SLC39A13 (solute carrier family 39 member 13 [Source:HGNC Symbol;Acc:HGNC:20859])

HSP 1 Score: 101.679 bits (252), Expect = 2.218e-23
Identity = 90/296 (30.41%), Postives = 140/296 (47.30%), Query Frame = 2
Query:  131 VMPLIMLKIFKNIDFVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWRNYKVKSN--------LNLLVAGLWTIGGLITFFICEK---SLNIIGITVGRSADMTLKCYDQSDLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLL------CXXXX------XXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACISL 949
            V PL+++ +       S+   + L  K+LLSF +G LLG+VFL+++P  W  Y   ++              GLW I G++TF   EK        G +   + D T      + LN         A        + IK  GYL L+ + ++N  +G+ +  +F ++ KIGL TT+ +L+HEIP+E+ DF +L+ +GFD +     Q  ++    +GGLL      C             +     W+LP   G  LYIALV + P ++ E+ P  S  QLL +C GI +    SL
Sbjct:   83 VFPLLVIPLEMGTMLRSEAGAWRL--KQLLSFALGGLLGNVFLHLLPEAWA-YTCSASPGGEGQSLQQQQQLGLWVIAGILTFLALEKMFLDSKEEGTSQAPNKDPTAAA---AALNGGHCLAQPAAEPGLGAVVRSIKVSGYLNLLANTIDNFTHGLAVAASFLVSKKIGLLTTMAILLHEIPHEVGDFAILLRAGFDRWSAAKLQLSTA----LGGLLGAGFAICTQSPKGVVGCSPAAEETAAWVLPFTSGGFLYIALVNVLPDLLEEEDPWRSLQQLLLLCAGIVVMVLFSL 368          
BLAST of slc39a-9 vs. Ensembl Human
Match: SLC39A13 (solute carrier family 39 member 13 [Source:HGNC Symbol;Acc:HGNC:20859])

HSP 1 Score: 85.1149 bits (209), Expect = 7.587e-18
Identity = 67/220 (30.45%), Postives = 109/220 (49.55%), Query Frame = 2
Query:  131 VMPLIMLKIFKNIDFVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWRNYKVKSN--------LNLLVAGLWTIGGLITFFICEK---SLNIIGITVGRSADMTLKCYDQSDLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLL 757
            V PL+++ +       S+   + L  K+LLSF +G LLG+VFL+++P  W  Y   ++              GLW I G++TF   EK        G +   + D T      + LN         A        + IK  GYL L+ + ++N  +G+ +  +F ++ KIGL TT+ +L+HEIP+E+ DF +L+ +GFD +     Q  ++    +GGLL
Sbjct:   83 VFPLLVIPLEMGTMLRSEAGAWRL--KQLLSFALGGLLGNVFLHLLPEAW-AYTCSASPGGEGQSLQQQQQLGLWVIAGILTFLALEKMFLDSKEEGTSQAPNKDPTAAA---AALNGGHCLAQPAAEPGLGAVVRSIKVSGYLNLLANTIDNFTHGLAVAASFLVSKKIGLLTTMAILLHEIPHEVGDFAILLRAGFDRWSAAKLQLSTA----LGGLL 292          
BLAST of slc39a-9 vs. Ensembl Human
Match: SLC39A13 (solute carrier family 39 member 13 [Source:HGNC Symbol;Acc:HGNC:20859])

HSP 1 Score: 79.337 bits (194), Expect = 3.365e-16
Identity = 61/217 (28.11%), Postives = 102/217 (47.00%), Query Frame = 2
Query:  131 VMPLIMLKIFKNIDFVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWRNYKVKSN--------LNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLKCYDQSDLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLL 757
            V PL+++ +       S+   + L  K+LLSF +G LLG+VFL+++P  W  Y   ++              GLW I G++TF   EK              M L   ++                         +  GYL L+ + ++N  +G+ +  +F ++ KIGL TT+ +L+HEIP+E+ DF +L+ +GFD +     Q  ++    +GGLL
Sbjct:   83 VFPLLVIPLEMGTMLRSEAGAWRL--KQLLSFALGGLLGNVFLHLLPEAW-AYTCSASPGGEGQSLQQQQQLGLWVIAGILTFLALEK--------------MFLDSKEEG----------------------TSQVSGYLNLLANTIDNFTHGLAVAASFLVSKKIGLLTTMAILLHEIPHEVGDFAILLRAGFDRWSAAKLQLSTA----LGGLL 256          
BLAST of slc39a-9 vs. Ensembl Human
Match: SLC39A12 (solute carrier family 39 member 12 [Source:HGNC Symbol;Acc:HGNC:20860])

HSP 1 Score: 55.4546 bits (132), Expect = 1.063e-7
Identity = 68/272 (25.00%), Postives = 121/272 (44.49%), Query Frame = 2
Query:  173 FVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWRNYKVKS----NLNLLVAGLWT----IGGLITFFICEK------SLNIIGIT-----VGRSADMTLKCY--DQSDLXXXXXXXXXQAXXXXXXXX-------------XXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPK 886
            F S    Y L  +  +   +G L GD  L+++P V   +K ++    + +     +W     IGG+  FF+ EK      S N  G++     VG S  + L     DQ+    +++    ++ +  +                K I  +  + L+   L N   G+ +G AF+ + + G+ TT+ +L HEIP+E+ DF +L+ SG  +   +L  + SS    +G  L + L       ++ W+  V  G  LY++LV M P +   Q+ +
Sbjct:  390 FHSCEENYRLILQLFVGLAVGTLSGDALLHLIPQVLGLHKQEAPEFGHFHESKGHIWKLMGLIGGIHGFFLIEKCFILLVSPNDKGLSLVNGHVGHSHHLALNSELSDQAGRGKSASTIQLKSPEDSQAAEMPIGSMTASNRKCKAISLLAIMILVGDSLHNFADGLAIGAAFSSSSESGVTTTIAILCHEIPHEMGDFAVLLSSGLSMKTAILMNFISSLTAFMG--LYIGLSVSADPCVQDWIFTVTAGMFLYLSLVEMLPEMTHVQTQR 659          
BLAST of slc39a-9 vs. Ensembl Celegans
Match: zipt-13 (Zrt (ZRT), Irt-(IRT-) like Protein Transporter [Source:UniProtKB/TrEMBL;Acc:Q17996])

HSP 1 Score: 84.3445 bits (207), Expect = 8.566e-18
Identity = 64/237 (27.00%), Postives = 111/237 (46.84%), Query Frame = 2
Query:  215 LLSFTMGLLLGDVFLNIMPMVWRNYKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLKCYDQSDLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGI 925
            LL F +G LL DVFL+++P  +     +SN N +  GL  + G +TF +  K        +  S +   K                                 YL L  +  +N  +G+ +G++F ++ K G+ TT+ +L+HEIP+E+ DF +L+ + F   + +L Q  ++++ ++G L+  +     +  +   LLP   G  L IAL  + P + +E SP E   QL+ I  G+
Sbjct:  150 LLGFAIGSLLADVFLHLLPEAY-----ESNENHVSIGLCVLAGYLTFSLISK--------LASSEEEQHKA------------------------------CAYLNLFANIGDNFAHGLAVGSSFLVSTKFGIMTTITILLHEIPHEISDFAILLRADFGKTNAILAQLTTAAFGVLGSLVA-LHLHTSNVPVIETLLPFTAGGFLNIALTELLPEISAETSPVEILKQLVMIVTGV 342          
BLAST of slc39a-9 vs. Ensembl Celegans
Match: zipt-7.1 (Zinc transporter zipt-7.1 [Source:UniProtKB/Swiss-Prot;Acc:Q9XUC4])

HSP 1 Score: 79.7221 bits (195), Expect = 3.783e-16
Identity = 72/288 (25.00%), Postives = 126/288 (43.75%), Query Frame = 2
Query:  173 FVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMP-----------------MVWRNYKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLKCYDQSDLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIG---GLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPK---------ESGLQLLFICVGISITACISL 949
            F+      G F K LL+F  G LLGD  L+I+P                     +     + N L  G + I G++ F + E+ + II      S +      D+    +  ++ +++  K +    K +K   YL L+   + N+  G+ +G +F+    +G  TTL VL+HE+P+E+ DF +L+ SGF  Y  +  Q  ++   I G    LL        ++     ++P   G  +YIA V + P ++               +S + +L IC+G+ +   +SL
Sbjct:  104 FIPAQHANGPFLKILLAFGAGGLLGDALLHIIPHSLSPHDHSHDHHDHNHSHKEHDHSHDHSNQLRVGTFVIAGILVFMMVEQLVRIIKGGHCHSHENGHIVADEHRHLNEHDHEHSEEKKQQVEGLKDVKASAYLNLVADFVHNVTDGLAIGASFSAGNTLGWITTLTVLLHELPHEVGDFAILVQSGFSKYQAIRLQAVTALGAITGCVFSLLVSNPGSLNNDADTSAIMPFTAGGFIYIATVSVVPELLESGDHNNLSKVAKMAQSLVHVLAICMGVGMMYIVSL 391          
BLAST of slc39a-9 vs. Ensembl Celegans
Match: zipt-7.2 (Zinc transporter zipt-7.2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTQ7])

HSP 1 Score: 56.6102 bits (135), Expect = 1.735e-8
Identity = 67/279 (24.01%), Postives = 108/279 (38.71%), Query Frame = 2
Query:  188 TRYGLFEKRLLSFTMGLLLGDVFLNIMPMV----------------WRNYKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTL--------------KCYDQSDLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIG---GLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGI 925
            +  G   K LL+F  G LLGD FL+++P                            + +  G W +GG+I F   EK + I+     R  D                 K  D  D          +  +  +   + IK   YL L      N   G+ +G +F     +G+ T + VL+HE+P+E+ DF +L+ SG+     +L Q  ++   + G    L     D         W+LP   G  +YIA V + P ++   S  ++  ++  I  GI
Sbjct:  186 SESGPLLKVLLAFGSGGLLGDAFLHLIPHATPAGDGHGHSHSHGHSHGGGGHSHGAHDMSVGGWVLGGIIAFLTVEKLVRIL-----RGEDGHGHSHGHSHGGEKKETKEKDSKD-------KVAKKEEKPEKDEQSIKVTAYLNLAADFTHNFTDGLAIGASFIAGTTVGIVTMITVLVHEVPHEIGDFAILIQSGYSKKKAMLIQLVTALGALSGCVISLFSADADALADAAASSWVLPFTAGGFIYIATVSVIPELLENSSFFQTVKEIFAILTGI 452          
BLAST of slc39a-9 vs. Ensembl Fly
Match: Zip99C (gene:FBgn0039714 transcript:FBtr0089920)

HSP 1 Score: 100.908 bits (250), Expect = 1.768e-23
Identity = 74/274 (27.01%), Postives = 132/274 (48.18%), Query Frame = 2
Query:  215 LLSFTMGLLLGDVFLNIMPMVWR-NYKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLKCYDQSDLXXXXXX--------------------------XXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXX--XPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACISL 949
            LLSF +G LLGDVFL+++P  W  + +  S+   L +GLW + G++ F I EK  +  G       +   KC + ++     +                              Q  K+K+   +  K  GYL L+ + ++N  +G+ +  +F ++ + G+  T  +L+HEIP+E+ DF +L+ SGF  +     Q  ++   ++G L+ +      S +       +P   G  L+IALV + P ++ E+  KES  QLL +  GI++ A +++
Sbjct:   80 LLSFAVGGLLGDVFLHLLPEAWEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFS--GYASADEENPQPKCVEIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKERKEQPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPHEVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEARTSWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALVFGIALMAVMTM 351          
BLAST of slc39a-9 vs. Ensembl Fly
Match: Zip99C (gene:FBgn0039714 transcript:FBtr0303033)

HSP 1 Score: 100.908 bits (250), Expect = 1.768e-23
Identity = 74/274 (27.01%), Postives = 132/274 (48.18%), Query Frame = 2
Query:  215 LLSFTMGLLLGDVFLNIMPMVWR-NYKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLKCYDQSDLXXXXXX--------------------------XXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXX--XPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACISL 949
            LLSF +G LLGDVFL+++P  W  + +  S+   L +GLW + G++ F I EK  +  G       +   KC + ++     +                              Q  K+K+   +  K  GYL L+ + ++N  +G+ +  +F ++ + G+  T  +L+HEIP+E+ DF +L+ SGF  +     Q  ++   ++G L+ +      S +       +P   G  L+IALV + P ++ E+  KES  QLL +  GI++ A +++
Sbjct:   80 LLSFAVGGLLGDVFLHLLPEAWEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFS--GYASADEENPQPKCVEIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKERKEQPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPHEVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEARTSWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALVFGIALMAVMTM 351          
BLAST of slc39a-9 vs. Ensembl Fly
Match: Zip99C (gene:FBgn0039714 transcript:FBtr0089925)

HSP 1 Score: 100.908 bits (250), Expect = 1.768e-23
Identity = 74/274 (27.01%), Postives = 132/274 (48.18%), Query Frame = 2
Query:  215 LLSFTMGLLLGDVFLNIMPMVWR-NYKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLKCYDQSDLXXXXXX--------------------------XXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXX--XPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACISL 949
            LLSF +G LLGDVFL+++P  W  + +  S+   L +GLW + G++ F I EK  +  G       +   KC + ++     +                              Q  K+K+   +  K  GYL L+ + ++N  +G+ +  +F ++ + G+  T  +L+HEIP+E+ DF +L+ SGF  +     Q  ++   ++G L+ +      S +       +P   G  L+IALV + P ++ E+  KES  QLL +  GI++ A +++
Sbjct:   80 LLSFAVGGLLGDVFLHLLPEAWEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFS--GYASADEENPQPKCVEIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKERKEQPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPHEVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEARTSWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALVFGIALMAVMTM 351          
BLAST of slc39a-9 vs. Ensembl Fly
Match: Zip99C (gene:FBgn0039714 transcript:FBtr0303032)

HSP 1 Score: 100.908 bits (250), Expect = 1.768e-23
Identity = 74/274 (27.01%), Postives = 132/274 (48.18%), Query Frame = 2
Query:  215 LLSFTMGLLLGDVFLNIMPMVWR-NYKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLKCYDQSDLXXXXXX--------------------------XXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXX--XPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACISL 949
            LLSF +G LLGDVFL+++P  W  + +  S+   L +GLW + G++ F I EK  +  G       +   KC + ++     +                              Q  K+K+   +  K  GYL L+ + ++N  +G+ +  +F ++ + G+  T  +L+HEIP+E+ DF +L+ SGF  +     Q  ++   ++G L+ +      S +       +P   G  L+IALV + P ++ E+  KES  QLL +  GI++ A +++
Sbjct:   80 LLSFAVGGLLGDVFLHLLPEAWEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFS--GYASADEENPQPKCVEIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKERKEQPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPHEVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEARTSWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALVFGIALMAVMTM 351          
BLAST of slc39a-9 vs. Ensembl Fly
Match: Zip99C (gene:FBgn0039714 transcript:FBtr0089921)

HSP 1 Score: 100.908 bits (250), Expect = 1.768e-23
Identity = 74/274 (27.01%), Postives = 132/274 (48.18%), Query Frame = 2
Query:  215 LLSFTMGLLLGDVFLNIMPMVWR-NYKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLKCYDQSDLXXXXXX--------------------------XXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXX--XPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACISL 949
            LLSF +G LLGDVFL+++P  W  + +  S+   L +GLW + G++ F I EK  +  G       +   KC + ++     +                              Q  K+K+   +  K  GYL L+ + ++N  +G+ +  +F ++ + G+  T  +L+HEIP+E+ DF +L+ SGF  +     Q  ++   ++G L+ +      S +       +P   G  L+IALV + P ++ E+  KES  QLL +  GI++ A +++
Sbjct:   80 LLSFAVGGLLGDVFLHLLPEAWEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFS--GYASADEENPQPKCVEIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKERKEQPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPHEVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEARTSWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALVFGIALMAVMTM 351          
BLAST of slc39a-9 vs. Ensembl Zebrafish
Match: slc39a13 (solute carrier family 39 member 13 [Source:NCBI gene;Acc:368686])

HSP 1 Score: 109.383 bits (272), Expect = 1.895e-26
Identity = 81/266 (30.45%), Postives = 143/266 (53.76%), Query Frame = 2
Query:  209 KRLLSFTMGLLLGDVFLNIMPMVWR--NYKVKSNLNLLVAGLWTIGGLITFFICEKSL-NIIGITVGRSA-----------DMTLKCYDQSD--LXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGG--LLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACISLG 952
            K+LLSF +G LLGDVFL+++P  W   +    S+ +    GLW IGGL++F   EK   + +G    +++                   Q++   ++N++++  +   +     +KIK  GYL L+ +C++N  +G+ +  +F ++ K+G  TT  +L+HEIP+E+ DF +L+ +GFD +     Q  ++   ++G    LC    +  +     W+LP   G  LYIALV + P ++ E +P+ S LQ+L +  GI + A +S+ 
Sbjct:   82 KKLLSFAIGGLLGDVFLHLLPEAWAYTSSPGGSHRHYCTQGLWVIGGLMSFLTLEKMFPDEVGDPETKTSFQRTTSSSSDLSSQFSVSPQTNGICSNNNSDSKPKTDISPYTPPEKIKTSGYLNLLANCIDNFTHGLAVAGSFLVSRKVGFLTTFAILLHEIPHEVGDFAILLRAGFDRWKAARMQLSTALGGVLGACFALC-SQSQHGAENATTWILPFTSGGFLYIALVNVVPDLLEETNPRNSLLQVLLLFSGIGVMALLSIA 346          
BLAST of slc39a-9 vs. Ensembl Zebrafish
Match: slc39a13 (solute carrier family 39 member 13 [Source:NCBI gene;Acc:368686])

HSP 1 Score: 109.768 bits (273), Expect = 3.134e-26
Identity = 81/265 (30.57%), Postives = 143/265 (53.96%), Query Frame = 2
Query:  209 KRLLSFTMGLLLGDVFLNIMPMVWR--NYKVKSNLNLLVAGLWTIGGLITFFICEKSL-NIIGITVGRSA-----------DMTLKCYDQSD--LXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGG--LLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACISL 949
            K+LLSF +G LLGDVFL+++P  W   +    S+ +    GLW IGGL++F   EK   + +G    +++                   Q++   ++N++++  +   +     +KIK  GYL L+ +C++N  +G+ +  +F ++ K+G  TT  +L+HEIP+E+ DF +L+ +GFD +     Q  ++   ++G    LC    +  +     W+LP   G  LYIALV + P ++ E +P+ S LQ+L +  GI + A +S+
Sbjct:  123 KKLLSFAIGGLLGDVFLHLLPEAWAYTSSPGGSHRHYCTQGLWVIGGLMSFLTLEKMFPDEVGDPETKTSFQRTTSSSSDLSSQFSVSPQTNGICSNNNSDSKPKTDISPYTPPEKIKTSGYLNLLANCIDNFTHGLAVAGSFLVSRKVGFLTTFAILLHEIPHEVGDFAILLRAGFDRWKAARMQLSTALGGVLGACFALC-SQSQHGAENATTWILPFTSGGFLYIALVNVVPDLLEETNPRNSLLQVLLLFSGIGVMALLSI 386          
BLAST of slc39a-9 vs. Ensembl Zebrafish
Match: slc39a7 (solute carrier family 39 member 7 [Source:NCBI gene;Acc:30094])

HSP 1 Score: 72.0182 bits (175), Expect = 2.905e-13
Identity = 64/260 (24.62%), Postives = 109/260 (41.92%), Query Frame = 2
Query:  209 KRLLSFTMGLLLGDVFLNIMPMVWRNYKVKSNLN------------------------LLVAGLWTIGGLITFFICEKSLNII------------GITVGRSADMTLKCYDQSDLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQS 880
            K LLSF  G LLGD FL+++P     +   S  +                        ++  GLW +GG++ F + EK + ++                 + +D       Q     +   +  +  K     S  IK  GYL L      N   G+ +G +F +   +G  TT+ +L+HE+P+E+ DF +L+ SG       +C    ++   + G  C +L E + +    W+LP   G  +YIA V + P +++  S
Sbjct:  160 KVLLSFASGGLLGDAFLHLIPHALEPHSHHSQPHSEESHGQSHGEESHGHSHGAAHGHMMSVGLWVLGGIVAFLVVEKFVRLLKGGHSHSHSHSPSAPKSKDSDEEDDKKGQKKGEKDKVVSQQKPTKKTVETSSDIKVSGYLNLAADFTHNFTDGLAIGASFLVGPAVGAVTTITILLHEVPHEIGDFAILVQSGC-TKRKAMCLQLLTAVGALAGTACSLLAEGVGDAATAWILPFTAGGFVYIATVTVLPELLAGHS 418          
BLAST of slc39a-9 vs. Ensembl Zebrafish
Match: slc39a4 (solute carrier family 39 member 4 [Source:ZFIN;Acc:ZDB-GENE-060315-8])

HSP 1 Score: 57.7658 bits (138), Expect = 1.023e-9
Identity = 39/113 (34.51%), Postives = 60/113 (53.10%), Query Frame = 2
Query:  548 LENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPK 886
            + N   G+ +G AF+++ + GL T+L VL HE+P+EL DF +L+H G  +   +L  + SS    IG  L + L     +  E W+  V  G  LY+ L  M P +I   S +
Sbjct:    8 IHNFADGLAIGAAFSISWRSGLATSLAVLCHELPHELGDFAVLLHCGVSVKRALLLNFGSSLTSFIG--LYIALSVSTDSAAEQWISAVTAGLFLYVGLADMLPTLIHVDSRR 118          
BLAST of slc39a-9 vs. Ensembl Xenopus
Match: SLC39A13 (solute carrier family 39 (zinc transporter), member 13 [Source:NCBI gene;Acc:100494023])

HSP 1 Score: 120.553 bits (301), Expect = 2.439e-30
Identity = 95/286 (33.22%), Postives = 152/286 (53.15%), Query Frame = 2
Query:  131 VMPLIMLKIFKNIDFVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWR--------NYKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADM---TLKCYDQSDLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGG--LLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACISL 949
            V PL+++ I    +  S+     L  KRLLSF +G LLGDVFL+++P  W         +Y+      LL  GLW I G ++F + EK+     +   R   +   T K   +S +N    +N  Q    KK  +  IK  GYL L+ + ++N  +G+ +  +F ++ K+G+ TT+ +L+HEIP+E+ DF +L+ +GFD ++    Q  ++   I+G    LC     K +     W+LP   G  LYIALV + P +I E++ + S  Q+L IC GI++   +SL
Sbjct:   56 VFPLLVIPIEAGAELRSEKNSQRL--KRLLSFAIGGLLGDVFLHLLPEAWAYTCSATTGSYQSLQQQRLL--GLWVITGFLSFLLLEKTF----LDEKREEQVDSTTPKAAKESLINGKHKHNGKQGSPIKKPPNDHIKVSGYLNLLANTIDNFTHGMAVAGSFLVSRKVGILTTVAILLHEIPHEVGDFAILLRAGFDRWNAARLQLTTAMGGILGAAFALC-AQSPKGAGEAVAWILPFTSGGFLYIALVTVLPDLIEEKNIRNSFGQVLLICCGIAVMTILSL 332          
BLAST of slc39a-9 vs. Ensembl Xenopus
Match: SLC39A13 (solute carrier family 39 (zinc transporter), member 13 [Source:NCBI gene;Acc:100494023])

HSP 1 Score: 120.168 bits (300), Expect = 4.497e-30
Identity = 94/283 (33.22%), Postives = 151/283 (53.36%), Query Frame = 2
Query:  131 VMPLIMLKIFKNIDFVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWR--------NYKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLKCYDQSDLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGG--LLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACISL 949
            V PL+++ I    +  S+     L  KRLLSF +G LLGDVFL+++P  W         +Y+      LL  GLW I G ++F + EK+  +      +    T K   +S +N    +N  Q    KK  +  IK  GYL L+ + ++N  +G+ +  +F ++ K+G+ TT+ +L+HEIP+E+ DF +L+ +GFD ++    Q  ++   I+G    LC     K +     W+LP   G  LYIALV + P +I E++ + S  Q+L IC GI++   +SL
Sbjct:   82 VFPLLVIPIEAGAELRSEKNSQRL--KRLLSFAIGGLLGDVFLHLLPEAWAYTCSATTGSYQSLQQQRLL--GLWVITGFLSFLLLEKTF-LDEKREEQVDSTTPKAAKESLINGKHKHNGKQGSPIKKPPNDHIKVSGYLNLLANTIDNFTHGMAVAGSFLVSRKVGILTTVAILLHEIPHEVGDFAILLRAGFDRWNAARLQLTTAMGGILGAAFALC-AQSPKGAGEAVAWILPFTSGGFLYIALVTVLPDLIEEKNIRNSFGQVLLICCGIAVMTILSL 358          
BLAST of slc39a-9 vs. Ensembl Xenopus
Match: SLC39A7 (solute carrier family 39 member 7 [Source:NCBI gene;Acc:100038127])

HSP 1 Score: 81.2629 bits (199), Expect = 3.922e-16
Identity = 72/296 (24.32%), Postives = 131/296 (44.26%), Query Frame = 2
Query:  167 IDFVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWRNYKVKSNL------------------NLLVAGLWTIGGLITFFICEK---------SLNIIGITVGRSA--DMTLKCYDQSDL-------XXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACIS 946
            I   S  +++    K LLSF  G LLGD FL+++P     + V   +                   ++  GLW + G+I F + EK                   + +  D   +  ++ DL           ++N  +    KK    ++   GYL L      N   G+ +G +F ++  +G+ TT+ +L+HE+P+E+ DF +L+ SG      ++ Q  S++   + G  C +L E +     LW+LP   G  +YIA V + P ++ +  P +S L+   + +G+++   I+
Sbjct:  161 IPVQSNSSQHQSLLKLLLSFASGGLLGDAFLHLIPHALEPHSVHEAVEEPEESHGHGHSHGHSHSQMMSVGLWVLAGIIAFLVVEKFVRHLKGEHGHGHGHSHAAKESLVDNATEKEEEKDLGKDGVRHRKKGSSNVQKGKNGKKEPQSEMTVSGYLNLAADFTHNFTDGLAIGASFLVSSSVGIVTTITILLHEVPHEIGDFAILVQSGCTKRKAMMLQ-LSTALGALAGTACSLLAEGIGEAATLWILPFTAGGFIYIATVSVIPELLKDSRPSQSILETFGLLLGVAMMVLIA 455          
BLAST of slc39a-9 vs. Ensembl Xenopus
Match: rabl6 (RAB, member RAS oncogene family like 6 [Source:Xenbase;Acc:XB-GENE-1014126])

HSP 1 Score: 55.0694 bits (131), Expect = 1.296e-8
Identity = 37/106 (34.91%), Postives = 56/106 (52.83%), Query Frame = 2
Query:  542 SCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGP 859
              + N   G+ +G AF+ + K GL T+L VL HE+P+EL DF  L+H+G  +   +L  + S+    IG  L + L       ++ W+  V  G  LY+AL  M P
Sbjct:    6 DAIHNFADGLAIGAAFSTSWKTGLATSLAVLCHELPHELGDFAALLHAGLRVRWALLLNFSSALTAFIG--LYISLSISADEAVQQWIFTVATGLFLYVALADMLP 109          
BLAST of slc39a-9 vs. Ensembl Xenopus
Match: fhl1 (four and a half LIM domains 1 [Source:Xenbase;Acc:XB-GENE-964257])

HSP 1 Score: 52.7582 bits (125), Expect = 8.170e-7
Identity = 68/279 (24.37%), Postives = 123/279 (44.09%), Query Frame = 2
Query:  173 FVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWRNYKVKSNLNLLVAG---------LWTI----GGLITFFICEK-----------SLNIIGITVGRSADMTLKCY--DQS---------------DLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPK 886
            F S    Y L  +  +   +G L GD  L+++P V   ++V ++ + +  G         LW I    GG+  FF+  K            L+++   +  S D+ L  +  DQS               D  H+            +  SK I  +  + L+   L N   G+++G+AF+ + + G+ +T+ +L HEIP+E+ DF +L+++G       L  + S+     G  L + L    +  +++W+  V  G  LY++LV M P +I  Q+ +
Sbjct:  399 FSSCEENYKLILQLFVGLAVGTLSGDALLHLIPQVLGVHEVVTHEHHMQQGDYIFEENEYLWKIMGMIGGIYGFFLINKLFFLLVSSPKQGLSLMNGHLTHSHDLPLDAHLGDQSRKAKSSSTIQLRSPDDCEHSEVPETLPVRPKARRKSKGISLLAIMILVGDSLHNFADGMVIGSAFSSSTETGIASTVAILCHEIPHEMGDFAVLLNTGLSAKIAFLMNFISALTAFAG--LYIGLSLSANPDVQIWIFAVTAGMFLYLSLVEMLPEMIHVQTQR 675          
BLAST of slc39a-9 vs. Ensembl Mouse
Match: Slc39a13 (solute carrier family 39 (metal ion transporter), member 13 [Source:MGI Symbol;Acc:MGI:1915677])

HSP 1 Score: 103.219 bits (256), Expect = 4.805e-24
Identity = 86/289 (29.76%), Postives = 141/289 (48.79%), Query Frame = 2
Query:  131 VMPLIMLKIFKNIDFVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVW----------RNYKVKSNLNLLVAGLWTIGGLITFFICEKS-LNIIGITVGRSADMTLKCYDQSDLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCX-----XXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACISL 949
            V PL+++ +       S+   + L  ++LLSF +G LLG+VFL+++P  W              ++    L   GLW I G +TF   EK  LN    +    +    K    + LN         A    +   + +K  GYL L+ + ++N  +G+ +  +F ++ KIGL TT+ +L+HEIP+E+ DF +L+ +GFD +     Q+ ++    +GGLL           K      +W+LP   G  LYIALV + P ++ E  P  S  Q+L +C G+ +   +SL
Sbjct:   83 VFPLLVIPLEMGTLLQSEAGAWRL--RQLLSFALGGLLGNVFLHLLPEAWAYTCNITPGGEGQSLQRQQQL---GLWVIAGFLTFLALEKMFLN----SKEDPSQAPSKDPTAAALNGGHCLAQPAAEPGLRAVVRNLKVSGYLNLLANTIDNFTHGLAVAASFLVSKKIGLLTTMAILLHEIPHEVGDFAILLRAGFDRWTAAKLQFSTA----LGGLLGACFAICTQSPKGVEETVVWILPFTSGGFLYIALVNVLPDLLEEDDPWHSLQQVLLLCSGVLVMVLLSL 358          
BLAST of slc39a-9 vs. Ensembl Mouse
Match: Slc39a13 (solute carrier family 39 (metal ion transporter), member 13 [Source:MGI Symbol;Acc:MGI:1915677])

HSP 1 Score: 101.293 bits (251), Expect = 2.724e-23
Identity = 88/299 (29.43%), Postives = 143/299 (47.83%), Query Frame = 2
Query:  131 VMPLIMLKIFKNIDFVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWR---NYKVKSNLNLLVA-----------------GLWTIGGLITFFICEKS-LNIIGITVGRSADMTLKCYDQSDLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCX-----XXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACISL 949
            V PL+++ +       S+   + L  ++LLSF +G LLG+VFL+++P  W    N    + L   V+                 GLW I G +TF   EK  LN    +    +    K    + LN         A    +   + +K  GYL L+ + ++N  +G+ +  +F ++ KIGL TT+ +L+HEIP+E+ DF +L+ +GFD +     Q+ ++    +GGLL           K      +W+LP   G  LYIALV + P ++ E  P  S  Q+L +C G+ +   +SL
Sbjct:   83 VFPLLVIPLEMGTLLQSEAGAWRL--RQLLSFALGGLLGNVFLHLLPEAWAYTCNITPATGLAWPVSAPPAGGEGQSLQRQQQLGLWVIAGFLTFLALEKMFLN----SKEDPSQAPSKDPTAAALNGGHCLAQPAAEPGLRAVVRNLKVSGYLNLLANTIDNFTHGLAVAASFLVSKKIGLLTTMAILLHEIPHEVGDFAILLRAGFDRWTAAKLQFSTA----LGGLLGACFAICTQSPKGVEETVVWILPFTSGGFLYIALVNVLPDLLEEDDPWHSLQQVLLLCSGVLVMVLLSL 371          
BLAST of slc39a-9 vs. Ensembl Mouse
Match: Slc39a13 (solute carrier family 39 (metal ion transporter), member 13 [Source:MGI Symbol;Acc:MGI:1915677])

HSP 1 Score: 83.5741 bits (205), Expect = 1.022e-18
Identity = 51/148 (34.46%), Postives = 84/148 (56.76%), Query Frame = 2
Query:  521 GYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCX-----XXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACISL 949
            GYL L+ + ++N  +G+ +  +F ++ KIGL TT+ +L+HEIP+E+ DF +L+ +GFD +     Q+ ++    +GGLL           K      +W+LP   G  LYIALV + P ++ E  P  S  Q+L +C G+ +   +SL
Sbjct:   14 GYLNLLANTIDNFTHGLAVAASFLVSKKIGLLTTMAILLHEIPHEVGDFAILLRAGFDRWTAAKLQFSTA----LGGLLGACFAICTQSPKGVEETVVWILPFTSGGFLYIALVNVLPDLLEEDDPWHSLQQVLLLCSGVLVMVLLSL 157          
BLAST of slc39a-9 vs. Ensembl Mouse
Match: Slc39a12 (solute carrier family 39 (zinc transporter), member 12 [Source:MGI Symbol;Acc:MGI:2139274])

HSP 1 Score: 53.5286 bits (127), Expect = 2.853e-7
Identity = 38/118 (32.20%), Postives = 65/118 (55.08%), Query Frame = 2
Query:  533 LIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPK 886
            L+   L N   G+++GTAF+ + + G+ TT+ +L HEIP+E+ DF +L+ SG  +   +L  + S+     G  L + L       ++ W+L V  G  LY++LV M P +   Q+ +
Sbjct:  507 LVGDSLHNFADGLVIGTAFSSSLESGVTTTIAILCHEIPHEMGDFAVLLSSGLSVRTAILMNFLSALTAFAG--LYIGLSVSADPRVQDWILTVTAGMFLYLSLVGMLPEMTHVQTQR 622          
BLAST of slc39a-9 vs. Ensembl Mouse
Match: Slc39a12 (solute carrier family 39 (zinc transporter), member 12 [Source:MGI Symbol;Acc:MGI:2139274])

HSP 1 Score: 53.5286 bits (127), Expect = 2.965e-7
Identity = 38/118 (32.20%), Postives = 65/118 (55.08%), Query Frame = 2
Query:  533 LIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPK 886
            L+   L N   G+++GTAF+ + + G+ TT+ +L HEIP+E+ DF +L+ SG  +   +L  + S+     G  L + L       ++ W+L V  G  LY++LV M P +   Q+ +
Sbjct:  543 LVGDSLHNFADGLVIGTAFSSSLESGVTTTIAILCHEIPHEMGDFAVLLSSGLSVRTAILMNFLSALTAFAG--LYIGLSVSADPRVQDWILTVTAGMFLYLSLVGMLPEMTHVQTQR 658          
BLAST of slc39a-9 vs. UniProt/SwissProt
Match: sp|Q8AW42|S39AD_DANRE (Zinc transporter ZIP13 OS=Danio rerio OX=7955 GN=slc39a13 PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.375e-25
Identity = 81/266 (30.45%), Postives = 143/266 (53.76%), Query Frame = 2
Query:  209 KRLLSFTMGLLLGDVFLNIMPMVWR--NYKVKSNLNLLVAGLWTIGGLITFFICEKSL-NIIGITVGRSA-----------DMTLKCYDQSD--LXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGG--LLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACISLG 952
            K+LLSF +G LLGDVFL+++P  W   +    S+ +    GLW IGGL++F   EK   + +G    +++                   Q++   ++N++++  +   +     +KIK  GYL L+ +C++N  +G+ +  +F ++ K+G  TT  +L+HEIP+E+ DF +L+ +GFD +     Q  ++   ++G    LC    +  +     W+LP   G  LYIALV + P ++ E +P+ S LQ+L +  GI + A +S+ 
Sbjct:   82 KKLLSFAIGGLLGDVFLHLLPEAWAYTSSPGGSHRHYCTQGLWVIGGLMSFLTLEKMFPDEVGDPETKTSFQRTTSSSSDLSSQFSVSPQTNGICSNNNSDSKPKTDISPYTQPEKIKTSGYLNLLANCIDNFTHGLAVAGSFLVSRKVGFLTTFAILLHEIPHEVGDFAILLRAGFDRWKAARMQLSTALGGVLGACFALC-SQSQHGAENATTWILPFTSGGFLYIALVNVVPDLLEETNPRNSLLQVLLLFSGIGVMALLSIA 346          
BLAST of slc39a-9 vs. UniProt/SwissProt
Match: sp|Q8BZH0|S39AD_MOUSE (Zinc transporter ZIP13 OS=Mus musculus OX=10090 GN=Slc39a13 PE=2 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 3.361e-23
Identity = 86/289 (29.76%), Postives = 141/289 (48.79%), Query Frame = 2
Query:  131 VMPLIMLKIFKNIDFVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVW----------RNYKVKSNLNLLVAGLWTIGGLITFFICEKS-LNIIGITVGRSADMTLKCYDQSDLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCX-----XXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACISL 949
            V PL+++ +       S+   + L  ++LLSF +G LLG+VFL+++P  W              ++    L   GLW I G +TF   EK  LN    +    +    K    + LN         A    +   + +K  GYL L+ + ++N  +G+ +  +F ++ KIGL TT+ +L+HEIP+E+ DF +L+ +GFD +     Q+ ++    +GGLL           K      +W+LP   G  LYIALV + P ++ E  P  S  Q+L +C G+ +   +SL
Sbjct:   83 VFPLLVIPLEMGTLLQSEAGAWRL--RQLLSFALGGLLGNVFLHLLPEAWAYTCNITPGGEGQSLQRQQQL---GLWVIAGFLTFLALEKMFLN----SKEDPSQAPSKDPTAAALNGGHCLAQPAAEPGLRAVVRNLKVSGYLNLLANTIDNFTHGLAVAASFLVSKKIGLLTTMAILLHEIPHEVGDFAILLRAGFDRWTAAKLQFSTA----LGGLLGACFAICTQSPKGVEETVVWILPFTSGGFLYIALVNVLPDLLEEDDPWHSLQQVLLLCSGVLVMVLLSL 358          
BLAST of slc39a-9 vs. UniProt/SwissProt
Match: sp|Q96H72|S39AD_HUMAN (Zinc transporter ZIP13 OS=Homo sapiens OX=9606 GN=SLC39A13 PE=1 SV=3)

HSP 1 Score: 101.679 bits (252), Expect = 1.065e-22
Identity = 90/296 (30.41%), Postives = 140/296 (47.30%), Query Frame = 2
Query:  131 VMPLIMLKIFKNIDFVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWRNYKVKSN--------LNLLVAGLWTIGGLITFFICEK---SLNIIGITVGRSADMTLKCYDQSDLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLL------CXXXX------XXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACISL 949
            V PL+++ +       S+   + L  K+LLSF +G LLG+VFL+++P  W  Y   ++              GLW I G++TF   EK        G +   + D T      + LN         A        + IK  GYL L+ + ++N  +G+ +  +F ++ KIGL TT+ +L+HEIP+E+ DF +L+ +GFD +     Q  ++    +GGLL      C             +     W+LP   G  LYIALV + P ++ E+ P  S  QLL +C GI +    SL
Sbjct:   83 VFPLLVIPLEMGTMLRSEAGAWRL--KQLLSFALGGLLGNVFLHLLPEAWA-YTCSASPGGEGQSLQQQQQLGLWVIAGILTFLALEKMFLDSKEEGTSQAPNKDPTAAA---AALNGGHCLAQPAAEPGLGAVVRSIKVSGYLNLLANTIDNFTHGLAVAASFLVSKKIGLLTTMAILLHEIPHEVGDFAILLRAGFDRWSAAKLQLSTA----LGGLLGAGFAICTQSPKGVVGCSPAAEETAAWVLPFTSGGFLYIALVNVLPDLLEEEDPWRSLQQLLLLCAGIVVMVLFSL 368          
BLAST of slc39a-9 vs. UniProt/SwissProt
Match: sp|Q9VAF0|S39AD_DROME (Zinc transporter ZIP13 homolog OS=Drosophila melanogaster OX=7227 GN=Zip99C PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.772e-22
Identity = 74/274 (27.01%), Postives = 132/274 (48.18%), Query Frame = 2
Query:  215 LLSFTMGLLLGDVFLNIMPMVWR-NYKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLKCYDQSDLXXXXXX--------------------------XXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXX--XPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACISL 949
            LLSF +G LLGDVFL+++P  W  + +  S+   L +GLW + G++ F I EK  +  G       +   KC + ++     +                              Q  K+K+   +  K  GYL L+ + ++N  +G+ +  +F ++ + G+  T  +L+HEIP+E+ DF +L+ SGF  +     Q  ++   ++G L+ +      S +       +P   G  L+IALV + P ++ E+  KES  QLL +  GI++ A +++
Sbjct:   80 LLSFAVGGLLGDVFLHLLPEAWEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFS--GYASADEENPQPKCVEIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKERKEQPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPHEVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEARTSWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALVFGIALMAVMTM 351          
BLAST of slc39a-9 vs. UniProt/SwissProt
Match: sp|Q5R6I6|S39AD_PONAB (Zinc transporter ZIP13 OS=Pongo abelii OX=9601 GN=SLC39A13 PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 3.369e-22
Identity = 82/282 (29.08%), Postives = 131/282 (46.45%), Query Frame = 2
Query:  131 VMPLIMLKIFKNIDFVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWRNYKVKSN--------LNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLKCYDQSDLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIG-GLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACISL 949
            V PL+++ +       S+   + L  K+LLSF +G LLG+VFL+++P  W  Y   ++              GLW I G++TF   EK              M L   ++                         +  GYL L+ + ++N  +G+ +  +F ++ KIGL TT+ +L+HEIP+E+ DF +L+ +GFD +     Q  ++   ++G G        K       W+LP   G  LYIALV + P ++ E+ P  S  QLL +C GI +    SL
Sbjct:   83 VFPLLVIPLEMGTMLRSEAGAWHL--KQLLSFALGGLLGNVFLHLLPEAWA-YTCSASPGGEGQSLQQQQQLGLWVIAGILTFLALEK--------------MFLDSKEEG----------------------TSQVSGYLNLLANTIDNFTHGLAVAASFLVSKKIGLLTTMAILLHEIPHEVGDFAILLRAGFDRWSAAKLQLSTALGGLLGAGFAICTQSPKGVEETAAWVLPFTSGGFLYIALVNVLPDLLEEEDPWRSLQQLLLLCAGIVVMVLFSL 325          
BLAST of slc39a-9 vs. TrEMBL
Match: A0A0H3YJK8 (Slc39a-9 OS=Schmidtea mediterranea OX=79327 GN=slc39a-9 PE=2 SV=1)

HSP 1 Score: 481.871 bits (1239), Expect = 3.227e-168
Identity = 287/287 (100.00%), Postives = 287/287 (100.00%), Query Frame = 2
Query:  128 TVMPLIMLKIFKNIDFVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWRNYKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLKCYDQSDLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACISLGSKSIPIFYKFLV 988
            TVMPLIMLKIFKNIDFVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWRNYKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLKCYDQSDLNHNSNNNNNQAIKTKKLFSKKIKEIGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCLILDEKLSNLLELWLLPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACISLGSKSIPIFYKFLV
Sbjct:   16 TVMPLIMLKIFKNIDFVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWRNYKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLKCYDQSDLNHNSNNNNNQAIKTKKLFSKKIKEIGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCLILDEKLSNLLELWLLPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACISLGSKSIPIFYKFLV 302          
BLAST of slc39a-9 vs. TrEMBL
Match: A0A210R1V8 (Zinc transporter ZIP13 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT17043 PE=4 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 2.170e-28
Identity = 80/266 (30.08%), Postives = 136/266 (51.13%), Query Frame = 2
Query:  209 KRLLSFTMGLLLGDVFLNIMPMVWR--NYKVKSNLNLLVAGLWTIGGLITFFICEK------SLNIIGITVGRSADMTLKCYDQSDLXXXXXXXXXQAXXXXXXXXXXXXX----------XGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXX-XXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACISL 949
            K LLSF +G LLGDVFL+++P  W   + +  ++   +  GLW +GG+I+F + EK        + IG      +D +LK    ++   +      +    K   + K              GYL L+ + ++N  +G+ +G +F ++ K+G  TT  +L+HE+P+E+ DF +L+ SGFD +     Q  +SS  ++G L  L  +   +       +LP   G  +YIALV + P ++ E+  +ES  Q++ +C GI   A +SL
Sbjct:  100 KLLLSFAVGGLLGDVFLHLLPEAWEHLDKEGHNHDGHMKVGLWVLGGIISFLVIEKIFAKEGEFDHIGDEDETESDSSLKEPKNTNSTDSLRQRETKDNSKKTETTDKSSNNPPVSQPIKVSGYLNLLANVIDNFTHGLAIGGSFVVSNKVGAITTFAILLHEVPHEVGDFAILLRSGFDRWKAAKAQVLTSSGVLVGTLTALTAESAQAAGERTAWILPFTSGGFIYIALVTVVPDLLEEKHGRESVKQVICLCAGICSMALVSL 365          
BLAST of slc39a-9 vs. TrEMBL
Match: A0A2H8TYI2 (Uncharacterized protein CG7816 OS=Melanaphis sacchari OX=742174 PE=4 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 2.525e-28
Identity = 82/274 (29.93%), Postives = 146/274 (53.28%), Query Frame = 2
Query:  137 PLIMLKIFKNIDFVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWRNYKVKSNLNLLVAGLWTIGGLITFFICEKSLNII-----GITVGRSADMTLKCYDQS--DLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCX--XXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISI 931
            PL++L +  +I   +      L  + LLSF++G +LGDVFL+++P VW   K + +++ +  G W + GL+ F I EK  ++        T+ +     +   + +  DL     +N+  A     +        GYL L+ +C++N  +G+ +G +F ++ ++GLFTTL +L+HEIP+E+ DF +L+ SGF  +     Q +++S  I G L  +              W++P   G  L+I+LV + P +I E++P+ES  Q + I  GI++
Sbjct:   66 PLLILPVNDSISLKTGPGSKHL--RLLLSFSVGGMLGDVFLHVLPEVWIASKDR-HVDWIRDGWWVLAGLLVFIIVEKLFSLSDDIDENETINKKVSTNINSVNNNLKDLGKTKCDNDVMAKGKSHIQIS-----GYLNLLANCIDNFTHGLALGGSFLISPRVGLFTTLAILVHEIPHEVGDFAILLKSGFSRWEAACAQVYTASAGIFGALTAIYCSGVTSDVEAKTSWIMPFTAGGFLHISLVTVLPELILEENPRESIKQFMLIIAGITV 331          
BLAST of slc39a-9 vs. TrEMBL
Match: J9K901 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 GN=100168729 PE=4 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 2.586e-27
Identity = 81/274 (29.56%), Postives = 144/274 (52.55%), Query Frame = 2
Query:  131 VMPLIMLKIFKNIDFVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWRNYKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLK-----CYDQSDLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCX--XXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISI 931
            ++PL++L +  +I   +      L  + LLSF++G +LGDVFL+++P VW +     + + +  G W + GL+ F I EK   +  ++     D T+        +  + NH       + I         I+  GYL L+ +C++N  +G+ +G +F ++ ++G+FTTL +L+HEIP+E+ DF +L+ SGF  +     Q +++S  I G L  +              W++P   G  L+I+LV + P ++ E++PKES  Q   I  GI++
Sbjct:   64 LVPLLILPVNDSISLKTGPGSKHL--RLLLSFSVGGMLGDVFLHVLPEVWSSKD--RHKDWIQDGWWVLAGLLVFIIVEK---LFSLSDNEDTDETIHKKVSTVINSVNNNHKDLGKTTKCIDVVTKGKNHIQISGYLNLLANCIDNFTHGLALGGSFLISPRVGMFTTLAILVHEIPHEVGDFAILLKSGFSRWEAACAQVYTASAGIFGALTAIYCSGVSDDVEAKTSWIMPFTAGGFLHISLVTVIPELLLEENPKESMKQYTLIIAGITV 330          
BLAST of slc39a-9 vs. TrEMBL
Match: A0A1I8G3D3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024869g1 PE=4 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 3.126e-27
Identity = 72/242 (29.75%), Postives = 132/242 (54.55%), Query Frame = 2
Query:  209 KRLLSFTMGLLLGDVFLNIMPMVWRNYKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRS-ADMTLKCYDQSDLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXX-XXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGIS 928
             RLLSF +G +LGDVFL+++P  +   K   +  +   G+WTI G+++F I EK L    +  GR+ +D ++K                 A  ++   +  ++  GYL L  + ++NL +G+ +G+++ ++ K+GL TT C+L+HE+P+E+ DF +L+ +GF  +     Q  ++S  + G L    +      ++    +LP   G  LY+AL  + P +++E   +ES LQ+L + +G +
Sbjct:   52 HRLLSFGIGSMLGDVFLHLLPEAYAQSKSAEHPVVNWVGVWTIVGVLSFLIIEKLLVFADLGGGRTDSDSSIKVNGA------------PASDSEDETATAVQVEGYLNLFANFVDNLTHGLAVGSSYAVSVKVGLVTTFCILVHEVPHEISDFAILLRAGFHKWRAAKAQLLTASGSLFGALFAFTMGQSSSVSVSVSVVLPFTSGGFLYLALASLTPPILAETDSRESLLQVLCLFIGFA 281          
BLAST of slc39a-9 vs. Ensembl Cavefish
Match: slc39a13 (solute carrier family 39 member 13 [Source:NCBI gene;Acc:103032554])

HSP 1 Score: 111.694 bits (278), Expect = 6.855e-27
Identity = 83/290 (28.62%), Postives = 150/290 (51.72%), Query Frame = 2
Query:  131 VMPLIMLKIFKNIDFVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWRN--YKVKSNLNLLVAGLWTIGGLITFFICEK----------SLNIIGITVGRSADMTLKCYDQSD----LXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXX-XXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACISL 949
            + PL+++         ++  R  L  K+LLSF +G LLGDVFL+++P  W +      S  +    GLW + GL+ F + EK          S  +   +   SAD+       +      ++N++++  +A  +    ++KIK  GYL L+ +C++N  +G+ +  +F ++ K+G  TT  +L+HEIP+E+ DF +L+ +GFD +     Q  ++   ++G    L    +         +LP   G  LYIALV + P ++ E++P+ S LQ+L +  G+ + A +S+
Sbjct:  123 IFPLLVIPFEAGAALKTEDGRQKL--KKLLSFAIGGLLGDVFLHLLPEAWAHTCSSDGSQKHYRTQGLWVVIGLLFFLMIEKMFPDDDKASESRTMNRSSNSSSADLRNDYLTSTQTNGIFSNNNSDSKPKAEISALPGTEKIKTSGYLNLLANCIDNFTHGLAVAGSFLVSRKVGFLTTFAILLHEIPHEVGDFAILLRAGFDRWSAARMQLSTALGGVLGACFALSAQSQQGAENATAWILPFSSGGFLYIALVNVVPDLLEEKNPRHSLLQILLLFCGVGVMALLSM 410          
BLAST of slc39a-9 vs. Ensembl Cavefish
Match: slc39a7 (solute carrier family 39 member 7 [Source:NCBI gene;Acc:30094])

HSP 1 Score: 73.559 bits (179), Expect = 6.138e-14
Identity = 62/245 (25.31%), Postives = 105/245 (42.86%), Query Frame = 2
Query:  209 KRLLSFTMGLLLGDVFLNIMPMVWRNYKVKSNLN---------------------LLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLKCYDQSDLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQS 880
            K LLSF  G LLGD FL+++P     +    N +                     ++  GLW +GG++ F + EK + ++      S       Y                       ++ IK  GYL L      N   G+ +G +F +   +G+ TT+ +L+HE+P+E+ DF +L+ SG       +C    ++   + G  C +L E +      W+LP   G  +YIA V + P +++ +S
Sbjct:  157 KVLLSFASGGLLGDAFLHLIPHALEPHSHHGNEDHGHSHASEESHGHSHGAAHGHMMSVGLWVLGGIVAFLVVEKFVRLLKGGHSHSHTHGKTSYQPKR-------------------TEHIKVSGYLNLAADFTHNFTDGLAIGASFLVGPTVGVVTTITILLHEVPHEIGDFAILVQSGCT-KRKAMCLQLLTAIGALAGTACSLLAEGVGAAATAWILPFTAGGFVYIATVTVLPELLAGRS 381          
BLAST of slc39a-9 vs. Ensembl Cavefish
Match: ENSAMXT00000045640.1 (zinc transporter ZIP4 [Source:NCBI gene;Acc:103045007])

HSP 1 Score: 56.6102 bits (135), Expect = 2.524e-8
Identity = 39/121 (32.23%), Postives = 62/121 (51.24%), Query Frame = 2
Query:  524 YLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPK 886
            Y+  I   + N   G+ +G AF+L+ + GL T+L VL HE+P+EL DF +L+H G  +   +L    S+    IG  L + L     +  + W+  V  G  LY+ L  M P +I  +  +
Sbjct:  429 YMITISDGIHNFADGLAIGAAFSLSWRSGLATSLAVLCHELPHELGDFAVLLHCGVSVKKALLLNVGSALTSFIG--LYIALSVSTDSTAKEWIAAVTTGLFLYVGLADMLPSMIHAEHKR 547          
BLAST of slc39a-9 vs. Ensembl Cavefish
Match: ENSAMXT00000045214.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:22768734:22770731:-1 gene:ENSAMXG00000033306.1 transcript:ENSAMXT00000045214.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 3.049e-8
Identity = 36/120 (30.00%), Postives = 64/120 (53.33%), Query Frame = 2
Query:  527 LALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPK 886
            + ++   L N   G+++G AF+ + + G+ TT+ +L HEIP+E+ DF +L+  G  +   +L  + S+    +G  L + L       ++LW+  V  G  LY++LV M P +    SP 
Sbjct:    1 MVIVGDSLHNFADGLVLGAAFSNSAETGIATTVAILCHEIPHEMGDFAVLLSCGLSVRRAMLMNFLSALTAFMG--LYIGLFVSSDPEVQLWIFTVTAGIFLYLSLVEMMPEMSKVHSPH 118          
BLAST of slc39a-9 vs. Ensembl Cavefish
Match: ENSAMXT00000004885.2 (zinc transporter ZIP4 [Source:NCBI gene;Acc:103045007])

HSP 1 Score: 56.225 bits (134), Expect = 3.262e-8
Identity = 39/121 (32.23%), Postives = 62/121 (51.24%), Query Frame = 2
Query:  524 YLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPK 886
            Y+  I   + N   G+ +G AF+L+ + GL T+L VL HE+P+EL DF +L+H G  +   +L    S+    IG  L + L     +  + W+  V  G  LY+ L  M P +I  +  +
Sbjct:  524 YMITISDGIHNFADGLAIGAAFSLSWRSGLATSLAVLCHELPHELGDFAVLLHCGVSVKKALLLNVGSALTSFIG--LYIALSVSTDSTAKEWIAAVTTGLFLYVGLADMLPSMIHAEHKR 642          
BLAST of slc39a-9 vs. Ensembl Sea Lamprey
Match: slc39a13 (solute carrier family 39 member 13 [Source:NCBI gene;Acc:368686])

HSP 1 Score: 70.8626 bits (172), Expect = 1.513e-14
Identity = 56/197 (28.43%), Postives = 97/197 (49.24%), Query Frame = 2
Query:  131 VMPLIMLKIFKNIDFVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWRNYKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIG-----ITVG-RSAD--------------MTL-KCYDQSDLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYEL 658
            V+P+++  I +N     +    G   + LLSF +G LLGDVFL+++P  W++   +       AGLW   GL+TF + EK    +       TV  R+ D              +TL KC            ++++   ++      ++  GYL L  +C++N  +G+ +  +F ++ K+G  TTL +L+HEIP+E+
Sbjct:   19 VLPILL--IPENTGAHLQSPEGGRRLRFLLSFAVGGLLGDVFLHLLPETWQHGCTQG------AGLWVTVGLLTFLVLEKVFPDVDEDEPPATVNVRTTDSDSNRCQWFERVCPLTLHKCSHTKAEEKRMMIDDHRTDLSEFKSLSGLQISGYLNLFANCVDNFTHGLAVAGSFLVSHKVGYLTTLAILLHEIPHEV 207          
BLAST of slc39a-9 vs. Ensembl Sea Lamprey
Match: slc39a14 (solute carrier family 39 member 14 [Source:NCBI gene;Acc:799782])

HSP 1 Score: 48.521 bits (114), Expect = 1.411e-6
Identity = 42/147 (28.57%), Postives = 77/147 (52.38%), Query Frame = 2
Query:  548 LENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFV--ISEQSPKES------GLQLLFICVGISITACISLGSKSI 964
            L N   G+ +G +FT++   G+ T++ +L  E P+EL DFV+L+++G  I   +   + S+    + GL+C I+         ++   + GG  LYI+L  M P +  +S++  +E       G+Q L +  G SI   +++ S +I
Sbjct:  205 LHNFIDGLAIGASFTVSVFQGISTSIAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACSCYL-GLVCGIVAGSHFAHNWIFA--LAGGMFLYISLADMFPEMNEVSKEDGEEKNNLVTFGIQNLGLLTGFSIMLLLTIYSGNI 348          
BLAST of slc39a-9 vs. Ensembl Sea Lamprey
Match: SLC39A12 (solute carrier family 39 member 12 [Source:HGNC Symbol;Acc:HGNC:20860])

HSP 1 Score: 47.7506 bits (112), Expect = 2.259e-6
Identity = 22/69 (31.88%), Postives = 39/69 (56.52%), Query Frame = 2
Query:  533 LIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELR---DFVLLMHSGFDIYHTVLCQYFSS 730
            L+   + N   G+ MG AF+ + + GL T+L +  HE+P+E+    DF  L++SG  +   ++  + SS
Sbjct:  241 LVGDSIHNFADGLAMGAAFSASNRAGLTTSLAIFFHEVPHEIERSGDFAALLNSGMRVCPALVLNFISS 309          
BLAST of slc39a-9 vs. Ensembl Yeast
Match: YKE4 (Zinc transporter; localizes to the ER; null mutant is sensitive to calcofluor white, leads to zinc accumulation in cytosol; ortholog of the mouse KE4 and member of the ZIP (ZRT, IRT-like Protein) family [Source:SGD;Acc:S000001285])

HSP 1 Score: 72.4034 bits (176), Expect = 1.239e-14
Identity = 71/268 (26.49%), Postives = 123/268 (45.90%), Query Frame = 2
Query:  182 KFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWRNYKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLKCYDQSDLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLL---------CXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSP-------KESGLQLLFICVGISITA 937
            K  R  L    L+SF++G LLGD+ L+++P       +    ++ + G     G I+F   +K++ I+    G S D      D S  +H+ ++   Q  + K  F+       YL +I     ++  GI + T+F  + ++G+ T++ V  HEIP+EL DF +L+ SGF     +  Q  ++   ++G  +                 S      +LP   G L+YIA   + P ++   +P       K+  LQL+FI VG ++ A
Sbjct:   92 KNDRASLTLSLLVSFSLGTLLGDILLHVIP-----ESLSGVTDVTMVGGAIFLGFISFLTLDKTMRILS---GTSND------DGSIHSHSHSHTPQQTAEKKAGFNMS----AYLNVISGIAHHITDGIALATSFYSSTQVGIMTSIAVTFHEIPHELGDFAILLSSGFTFPQAIRAQAVTAFGAVVGTSIGCWMNEIGNNSHKATSSSANASELMLPFTAGGLIYIATTSVVPQILHSSAPDSKLREFKKWALQLVFIFVGFAVMA 341          
BLAST of slc39a-9 vs. Ensembl Nematostella
Match: EDO48819 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIJ7])

HSP 1 Score: 79.337 bits (194), Expect = 7.415e-18
Identity = 45/142 (31.69%), Postives = 85/142 (59.86%), Query Frame = 2
Query:  521 GYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACIS 946
            GYL L  + ++N  +G+ +  +F ++ K+G+ TT  +L+HEIP+E+ DF +L+ SGF+     + Q  ++S  I G ++   L  + +     W+LP+  G  +YIA+V + P ++ E+ P ES  Q++ + +G++  A +S
Sbjct:    4 GYLNLFANIIDNFTHGLAIAGSFLVSRKVGMCTTCAILLHEIPHEVGDFAILLRSGFNKKDAAIAQISTASGGIFGAVV--GLIAEHAGDTTAWILPLSSGGFIYIAMVTIIPELLQEKRPMESVKQVIMMILGVASMALVS 143          
BLAST of slc39a-9 vs. Ensembl Nematostella
Match: EDO44270 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW91])

HSP 1 Score: 75.8702 bits (185), Expect = 4.411e-15
Identity = 71/261 (27.20%), Postives = 114/261 (43.68%), Query Frame = 2
Query:  215 LLSFTMGLLLGDVFLNIMPMVWRNYKVKSNLNL------------------LVAGLWTIGGLITFFICEKSLNIIGITVGRS--------------ADMTLKCYDQSDLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISE----QSPKE 889
            LL+F  G LLGD FL+++P     +      +                   +  G W + G+I F + EK +  +    G S              +D  L+   ++D +   +N    A        K IK  GYL L      N   G+ +G +F ++  +G+ TTL +L+HE+P+E+ DF +L+ SG     T +    S++   I G LC +L   +     LW+LP   G  +YIA V + P ++ +    QS KE
Sbjct:  175 LLAFASGGLLGDAFLHLIPHAINPHSHGGEDDHGHSHDHGHSHGSHDHSADMAVGFWVLAGMIAFLVVEKFVRHMKGGDGHSHKPSKPNSDERVKESDSELRNRKKTDSDGKESNGEITAKDLSHAMPKDIKVAGYLNLAADFTHNFTDGLAIGASFLVSRNLGIVTTLTILLHEVPHEIGDFAILVQSGCSKR-TAMYLQLSTATGAIAGTLCGLLAHNIGTSATLWILPFTAGGFIYIATVSVIPELLEDSKLGQSVKE 434          
BLAST of slc39a-9 vs. Ensembl Nematostella
Match: EDO47898 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLA8])

HSP 1 Score: 48.1358 bits (113), Expect = 1.225e-7
Identity = 25/76 (32.89%), Postives = 42/76 (55.26%), Query Frame = 2
Query:  533 LIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLC 760
            +I  C+ N   G+ +G AF+ +   G+ T L +L  E+P+EL DF +L+ SG    H VL       + ++ G++C
Sbjct:    2 VIGDCVHNFIDGVAIGAAFSSSVVEGISTALAILGEEVPHELGDFAVLLSSGMKYRHAVL-------FNLLSGVIC 70          
BLAST of slc39a-9 vs. Ensembl Nematostella
Match: EDO29311 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T403])

HSP 1 Score: 49.2914 bits (116), Expect = 2.873e-7
Identity = 38/124 (30.65%), Postives = 61/124 (49.19%), Query Frame = 2
Query:  533 LIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXX-----XXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKE 889
            +I  C+ N   G+ +G AF+ +   G+ T L ++  E+P+EL DF +L+ SG    H VL       + ++ G++C       L    +     W+  +  G  LYI+LV M P   +E S KE
Sbjct:   10 VIGDCVHNFIDGVAIGAAFSSSVVEGISTALAIIGEEVPHELGDFAVLLSSGMKYRHAVL-------FNLLSGVICYTGLVLGLLLAYATASVQWIYAIAAGMFLYISLVDMLPEA-NEMSCKE 125          
BLAST of slc39a-9 vs. Ensembl Nematostella
Match: EDO47899 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLA9])

HSP 1 Score: 50.447 bits (119), Expect = 4.373e-7
Identity = 39/124 (31.45%), Postives = 61/124 (49.19%), Query Frame = 2
Query:  533 LIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXX-----XXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKE 889
            +I  C+ N   G+ +G AF+ +   G+ T L +L  E+P+EL DF +L+ SG    H VL       + ++ G++C       L    +     W+  +  G  LYI+LV M P   +E S KE
Sbjct:  124 VIGDCVHNFIDGVAIGAAFSSSVVEGISTALAILGEEVPHELGDFAVLLSSGMKYRHAVL-------FNLLSGVICYTGLVLGLLLAYATASVQWIYAIAAGMFLYISLVDMLPEA-NEMSCKE 239          
BLAST of slc39a-9 vs. Ensembl Medaka
Match: slc39a13 (solute carrier family 39 member 13 [Source:NCBI gene;Acc:101167605])

HSP 1 Score: 112.464 bits (280), Expect = 2.500e-27
Identity = 83/261 (31.80%), Postives = 137/261 (52.49%), Query Frame = 2
Query:  209 KRLLSFTMGLLLGDVFLNIMPMVW--RNYKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLKC--YDQSDLX---------XXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGG--LLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACIS 946
            K+LLSF +G LLGDVFL+++P VW   +     + + +  GLW I GL+ F + EK       +   ++D  L    + Q+             N +   +     ++   +KIK  GYL L+ +C++N  +G+ +  +F ++ K+G  TT  +L+HEIP+E+ DF +L+ +GFD +     Q  ++   ++G    LC     K +     W+LP   G  LYIALV + P ++ E S + S LQ+L I  GI++ A +S
Sbjct:  116 KQLLSFAIGGLLGDVFLHLLPEVWALSSSSAGKHNHYMSQGLWVISGLLAFLLLEKMFPDQSSSEDHTSDSDLNSNLHTQTSTTLNGKARGSVTNGHKAESWTASKQQDQPQKIKTSGYLNLLANCIDNFTHGLAVAGSFLVSKKVGFLTTFAILLHEIPHEVGDFAILLRAGFDRWSAARMQMSTALVGVLGACFALC-AQSPKGTENACSWILPFTAGGFLYIALVNVVPDLLKESSLRHSLLQILLIFCGIAVMALLS 375          
BLAST of slc39a-9 vs. Ensembl Medaka
Match: slc39a7 (solute carrier family 39 member 7 [Source:NCBI gene;Acc:101167303])

HSP 1 Score: 62.3882 bits (150), Expect = 3.143e-10
Identity = 65/276 (23.55%), Postives = 119/276 (43.12%), Query Frame = 2
Query:  209 KRLLSFTMGLLLGDVFLNIMPMVWRNYKVK---------------------SNLNLLVAGLWTIGGLITFFICEKSLNIIG-------ITVGRSADMTLKCYDQSDLXXXXXXXXXQAXXXXXXXXXXXX-XXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSP-KESGLQLLFICVGISITACIS 946
            K LLSF  G LLGD FL+++P     +                        ++ +++  GLW + G+I F + EK + ++              A    K  D  +        +  A  +KK           YL L      N   G+ +G +F ++  +G  TT+ +L+HE+P+E+ DF +L+ SG       +C    ++   + G  C ++ E +      W+LP   G  +YIA V + P +++ +S   +S +++L +  G+ +   I+
Sbjct:  199 KVLLSFASGGLLGDAFLHLIPHALEPHSHHEDEHHGHSHSSEDDHGHSHGAAHAHMMSVGLWVLCGIIAFLVVEKFVRLLKGEDGHSHGHSHSHAAGKEKHSDGEEEKEKKKKEDKDAKVSKKEKKSSDIKVSAYLNLAADFTHNFTDGLAIGASFLVSPAVGAITTVTILLHEVPHEIGDFAILVQSGC-TKKKAMCLQLLTALGALAGTACSLMAEGVGATATAWILPFTAGGFIYIATVTVLPELLAGRSSFGQSLMEILALLFGVEMMVLIA 473          
BLAST of slc39a-9 vs. Ensembl Medaka
Match: ENSORLT00000030843.1 (solute carrier family 39 member 4 [Source:NCBI gene;Acc:101165941])

HSP 1 Score: 56.225 bits (134), Expect = 3.672e-8
Identity = 37/121 (30.58%), Postives = 63/121 (52.07%), Query Frame = 2
Query:  524 YLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPK 886
            Y+  I   + N   G+ +G AF+L+ K GL T++ VL HE+P+E+ DF +L++SG  +   +L    S+    +G  L + L          W+  V GG  +Y+ L  M P ++  +S +
Sbjct:  541 YMITIGDGIHNFADGLAVGAAFSLSWKSGLATSVAVLCHELPHEVGDFAILLYSGMSVPRALLLNLASAMISFVG--LYIALSVATDFATTQWITAVAGGLFMYVGLADMLPTLVHARSRR 659          
BLAST of slc39a-9 vs. Ensembl Medaka
Match: SLC39A12 (solute carrier family 39 member 12 [Source:NCBI gene;Acc:101161276])

HSP 1 Score: 50.0618 bits (118), Expect = 3.223e-6
Identity = 34/114 (29.82%), Postives = 58/114 (50.88%), Query Frame = 2
Query:  527 LALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIG---GLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGP 859
            + ++   L N   G+ +G AF+ + + G+  T+ +L HEIP+E+ DF +L+ SG  +   VL  + S+    +G   GLL    +E    +       +  G  LY++LV M P
Sbjct:  387 MVIVGDSLHNFADGLAVGAAFSSSVETGMAITVAILCHEIPHEMGDFAVLLSSGLSVKTAVLMNFLSALTAFMGLFIGLLVSSENEVQQWIFS-----ITAGIFLYLSLVEMLP 495          
BLAST of slc39a-9 vs. Planmine SMEST
Match: SMESG000042210.1 (SMESG000042210.1)

HSP 1 Score: 481.1 bits (1237), Expect = 2.178e-171
Identity = 286/287 (99.65%), Postives = 287/287 (100.00%), Query Frame = 2
Query:  128 TVMPLIMLKIFKNIDFVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWRNYKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLKCYDQSDLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACISLGSKSIPIFYKFLV 988
            TVMPLIMLKIFKNIDFVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWRNYKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLKCYDQSDLNHNSNNNNNQAIKTKKLFSKKIKEIGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCLILDEKLSNLLELWLLPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGI+ITACISLGSKSIPIFYKFLV
Sbjct:   16 TVMPLIMLKIFKNIDFVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWRNYKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLKCYDQSDLNHNSNNNNNQAIKTKKLFSKKIKEIGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCLILDEKLSNLLELWLLPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGIAITACISLGSKSIPIFYKFLV 302          
BLAST of slc39a-9 vs. Planmine SMEST
Match: SMESG000042210.1 (SMESG000042210.1)

HSP 1 Score: 477.248 bits (1227), Expect = 3.694e-170
Identity = 284/285 (99.65%), Postives = 285/285 (100.00%), Query Frame = 2
Query:  134 MPLIMLKIFKNIDFVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWRNYKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLKCYDQSDLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACISLGSKSIPIFYKFLV 988
            MPLIMLKIFKNIDFVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWRNYKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLKCYDQSDLNHNSNNNNNQAIKTKKLFSKKIKEIGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCLILDEKLSNLLELWLLPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGI+ITACISLGSKSIPIFYKFLV
Sbjct:    1 MPLIMLKIFKNIDFVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWRNYKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLKCYDQSDLNHNSNNNNNQAIKTKKLFSKKIKEIGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCLILDEKLSNLLELWLLPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGIAITACISLGSKSIPIFYKFLV 285          
BLAST of slc39a-9 vs. Planmine SMEST
Match: SMESG000042210.1 (SMESG000042210.1)

HSP 1 Score: 469.159 bits (1206), Expect = 4.940e-167
Identity = 280/281 (99.64%), Postives = 281/281 (100.00%), Query Frame = 2
Query:  146 MLKIFKNIDFVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWRNYKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLKCYDQSDLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACISLGSKSIPIFYKFLV 988
            MLKIFKNIDFVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWRNYKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLKCYDQSDLNHNSNNNNNQAIKTKKLFSKKIKEIGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCLILDEKLSNLLELWLLPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGI+ITACISLGSKSIPIFYKFLV
Sbjct:    1 MLKIFKNIDFVSKFTRYGLFEKRLLSFTMGLLLGDVFLNIMPMVWRNYKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLKCYDQSDLNHNSNNNNNQAIKTKKLFSKKIKEIGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCLILDEKLSNLLELWLLPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGIAITACISLGSKSIPIFYKFLV 281          
BLAST of slc39a-9 vs. Planmine SMEST
Match: SMESG000015061.1 (SMESG000015061.1)

HSP 1 Score: 114.005 bits (284), Expect = 2.831e-28
Identity = 78/247 (31.58%), Postives = 136/247 (55.06%), Query Frame = 2
Query:  209 KRLLSFTMGLLLGDVFLNIMPMVWRN-YKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLKCYDQSDLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACIS 946
             R L F  G ++GDVFL+++P  W + ++ +   + ++ GL  I G + FF+ EK      I +  S +       +  L +  ++N N  +    +    IK  GYL L+ +  +N  +G+ +G +F ++ KIG+ TT C+LIHEIP+E+ DFV+L+ +GFD +     Q  ++    +G +  L  D   + L + ++LP   GA +YIA+V + P +++E S +ES +QL+F+  G  I   +S
Sbjct:   97 NRWLGFAFGSIIGDVFLHLLPEAWESIHQHEGGNSHMIMGLSVIVGFLLFFVIEK------IFIANSYEPENCQQKEKKLPNGKSSNTNGVVAHDPIIESGIKAEGYLNLLANFTDNFTHGLAIGGSFLISFKIGVLTTTCILIHEIPHEVSDFVILLRAGFDRWKAAKLQLLTACGSCLGAVFALTADSTTTGLSKTFILPFTSGAFIYIAMVSLLPSILAESSFRESIIQLVFLASGFLIMVTMS 337          
BLAST of slc39a-9 vs. Planmine SMEST
Match: SMESG000015061.1 (SMESG000015061.1)

HSP 1 Score: 114.005 bits (284), Expect = 2.928e-28
Identity = 78/247 (31.58%), Postives = 136/247 (55.06%), Query Frame = 2
Query:  209 KRLLSFTMGLLLGDVFLNIMPMVWRN-YKVKSNLNLLVAGLWTIGGLITFFICEKSLNIIGITVGRSADMTLKCYDQSDLXXXXXXXXXQAXXXXXXXXXXXXXXGYLALIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMHSGFDIYHTVLCQYFSSSWKIIGGLLCXXXXXXXXXXXXXXXXPVIGGALLYIALVIMGPFVISEQSPKESGLQLLFICVGISITACIS 946
             R L F  G ++GDVFL+++P  W + ++ +   + ++ GL  I G + FF+ EK      I +  S +       +  L +  ++N N  +    +    IK  GYL L+ +  +N  +G+ +G +F ++ KIG+ TT C+LIHEIP+E+ DFV+L+ +GFD +     Q  ++    +G +  L  D   + L + ++LP   GA +YIA+V + P +++E S +ES +QL+F+  G  I   +S
Sbjct:   99 NRWLGFAFGSIIGDVFLHLLPEAWESIHQHEGGNSHMIMGLSVIVGFLLFFVIEK------IFIANSYEPENCQQKEKKLPNGKSSNTNGVVAHDPIIESGIKAEGYLNLLANFTDNFTHGLAIGGSFLISFKIGVLTTTCILIHEIPHEVSDFVILLRAGFDRWKAAKLQLLTACGSCLGAVFALTADSTTTGLSKTFILPFTSGAFIYIAMVSLLPSILAESSFRESIIQLVFLASGFLIMVTMS 339          
The following BLAST results are available for this feature:
BLAST of slc39a-9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC39A132.036e-2430.88solute carrier family 39 member 13 [Source:HGNC Sy... [more]
SLC39A132.218e-2330.41solute carrier family 39 member 13 [Source:HGNC Sy... [more]
SLC39A137.587e-1830.45solute carrier family 39 member 13 [Source:HGNC Sy... [more]
SLC39A133.365e-1628.11solute carrier family 39 member 13 [Source:HGNC Sy... [more]
SLC39A121.063e-725.00solute carrier family 39 member 12 [Source:HGNC Sy... [more]
back to top
BLAST of slc39a-9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
zipt-138.566e-1827.00Zrt (ZRT), Irt-(IRT-) like Protein Transporter [S... [more]
zipt-7.13.783e-1625.00Zinc transporter zipt-7.1 [Source:UniProtKB/Swiss... [more]
zipt-7.21.735e-824.01Zinc transporter zipt-7.2 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of slc39a-9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zip99C1.768e-2327.01gene:FBgn0039714 transcript:FBtr0089920[more]
Zip99C1.768e-2327.01gene:FBgn0039714 transcript:FBtr0303033[more]
Zip99C1.768e-2327.01gene:FBgn0039714 transcript:FBtr0089925[more]
Zip99C1.768e-2327.01gene:FBgn0039714 transcript:FBtr0303032[more]
Zip99C1.768e-2327.01gene:FBgn0039714 transcript:FBtr0089921[more]
back to top
BLAST of slc39a-9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc39a131.895e-2630.45solute carrier family 39 member 13 [Source:NCBI ge... [more]
slc39a133.134e-2630.57solute carrier family 39 member 13 [Source:NCBI ge... [more]
slc39a72.905e-1324.62solute carrier family 39 member 7 [Source:NCBI gen... [more]
slc39a41.023e-934.51solute carrier family 39 member 4 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc39a-9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC39A132.439e-3033.22solute carrier family 39 (zinc transporter), membe... [more]
SLC39A134.497e-3033.22solute carrier family 39 (zinc transporter), membe... [more]
SLC39A73.922e-1624.32solute carrier family 39 member 7 [Source:NCBI gen... [more]
rabl61.296e-834.91RAB, member RAS oncogene family like 6 [Source:Xen... [more]
fhl18.170e-724.37four and a half LIM domains 1 [Source:Xenbase;Acc:... [more]
back to top
BLAST of slc39a-9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc39a134.805e-2429.76solute carrier family 39 (metal ion transporter), ... [more]
Slc39a132.724e-2329.43solute carrier family 39 (metal ion transporter), ... [more]
Slc39a131.022e-1834.46solute carrier family 39 (metal ion transporter), ... [more]
Slc39a122.853e-732.20solute carrier family 39 (zinc transporter), membe... [more]
Slc39a122.965e-732.20solute carrier family 39 (zinc transporter), membe... [more]
back to top
BLAST of slc39a-9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8AW42|S39AD_DANRE1.375e-2530.45Zinc transporter ZIP13 OS=Danio rerio OX=7955 GN=s... [more]
sp|Q8BZH0|S39AD_MOUSE3.361e-2329.76Zinc transporter ZIP13 OS=Mus musculus OX=10090 GN... [more]
sp|Q96H72|S39AD_HUMAN1.065e-2230.41Zinc transporter ZIP13 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q9VAF0|S39AD_DROME1.772e-2227.01Zinc transporter ZIP13 homolog OS=Drosophila melan... [more]
sp|Q5R6I6|S39AD_PONAB3.369e-2229.08Zinc transporter ZIP13 OS=Pongo abelii OX=9601 GN=... [more]
back to top
BLAST of slc39a-9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJK83.227e-168100.00Slc39a-9 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A210R1V82.170e-2830.08Zinc transporter ZIP13 OS=Mizuhopecten yessoensis ... [more]
A0A2H8TYI22.525e-2829.93Uncharacterized protein CG7816 OS=Melanaphis sacch... [more]
J9K9012.586e-2729.56Uncharacterized protein OS=Acyrthosiphon pisum OX=... [more]
A0A1I8G3D33.126e-2729.75Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of slc39a-9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc39a136.855e-2728.62solute carrier family 39 member 13 [Source:NCBI ge... [more]
slc39a76.138e-1425.31solute carrier family 39 member 7 [Source:NCBI gen... [more]
ENSAMXT00000045640.12.524e-832.23zinc transporter ZIP4 [Source:NCBI gene;Acc:103045... [more]
ENSAMXT00000045214.13.049e-830.00pep primary_assembly:Astyanax_mexicanus-2.0:16:227... [more]
ENSAMXT00000004885.23.262e-832.23zinc transporter ZIP4 [Source:NCBI gene;Acc:103045... [more]
back to top
BLAST of slc39a-9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
slc39a131.513e-1428.43solute carrier family 39 member 13 [Source:NCBI ge... [more]
slc39a141.411e-628.57solute carrier family 39 member 14 [Source:NCBI ge... [more]
SLC39A122.259e-631.88solute carrier family 39 member 12 [Source:HGNC Sy... [more]
back to top
BLAST of slc39a-9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YKE41.239e-1426.49Zinc transporter; localizes to the ER; null mutant... [more]
back to top
BLAST of slc39a-9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO488197.415e-1831.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO442704.411e-1527.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478981.225e-732.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO293112.873e-730.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478994.373e-731.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc39a-9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc39a132.500e-2731.80solute carrier family 39 member 13 [Source:NCBI ge... [more]
slc39a73.143e-1023.55solute carrier family 39 member 7 [Source:NCBI gen... [more]
ENSORLT00000030843.13.672e-830.58solute carrier family 39 member 4 [Source:NCBI gen... [more]
SLC39A123.223e-629.82solute carrier family 39 member 12 [Source:NCBI ge... [more]
back to top
BLAST of slc39a-9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042210.12.178e-17199.65SMESG000042210.1[more]
SMESG000042210.13.694e-17099.65SMESG000042210.1[more]
SMESG000042210.14.940e-16799.64SMESG000042210.1[more]
SMESG000015061.12.831e-2831.58SMESG000015061.1[more]
SMESG000015061.12.928e-2831.58SMESG000015061.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30020824
GenBankAKN21674.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020824 ID=SMED30020824|Name=slc39a-9|organism=Schmidtea mediterranea sexual|type=transcript|length=1188bp
AATTATTTATAAATTTAACATTTAATTAATAAAATCAATTATTTAAGAAT
CATTTTAAACATAATTAAATTTGCTGTGAAAGATGCTATATTTATTTTTT
ATCTATATTTTTCTTTTGATAATATTGACTGTTATGCCATTGATAATGTT
AAAGATTTTCAAAAATATTGATTTTGTCTCAAAATTCACACGCTATGGGT
TATTCGAAAAACGATTATTAAGTTTTACAATGGGACTTTTGTTAGGAGAT
GTATTTTTAAATATAATGCCAATGGTTTGGAGAAATTACAAAGTGAAAAG
CAATCTAAACTTGCTTGTCGCTGGCCTGTGGACAATTGGTGGATTAATCA
CTTTCTTTATTTGCGAAAAGTCATTAAACATAATTGGGATCACCGTAGGC
CGAAGTGCTGACATGACGTTGAAATGCTATGATCAATCAGATTTGAATCA
CAATTCCAACAACAACAACAACCAAGCAATTAAGACGAAAAAATTGTTTT
CGAAAAAAATAAAGGAAATCGGTTATTTGGCCTTAATTGTCTCTTGCCTT
GAAAATTTATTTTATGGCATACTAATGGGGACAGCTTTCACATTGACAGG
AAAGATCGGATTGTTCACAACTCTATGCGTTCTTATCCATGAAATACCTT
ATGAATTGAGGGATTTTGTCCTTTTAATGCACTCAGGATTCGATATCTAT
CACACAGTTCTGTGCCAATATTTTTCGTCGTCATGGAAAATCATTGGTGG
CCTATTGTGCTTAATTTTAGATGAAAAGCTATCAAATTTATTAGAATTAT
GGCTACTTCCAGTGATTGGTGGGGCTCTACTTTATATTGCTCTAGTTATT
ATGGGGCCTTTTGTCATCAGTGAGCAATCACCAAAAGAATCAGGACTTCA
ACTCCTATTTATATGCGTTGGAATTTCTATTACTGCTTGTATTTCACTGG
GAAGCAAATCTATACCAATTTTTTATAAATTTTTAGTTTAAATTCATTTT
TGTGGTGAAATAGCAGCAATTTTAAATTGTCGTTTTTTTAAAAATAAACT
TCTCATTTGAATTTTAAGTCATACTCAAAGTTTCAATTTCTCCCTGGCAA
CAGCACACCAACGCACAATATGTGTTAGAAGATGGGCGTAAAATAACAAT
TTTAAAATTGAAACATTTTACAACAAGGTACAATAAGT
back to top

protein sequence of SMED30020824-orf-1

>SMED30020824-orf-1 ID=SMED30020824-orf-1|Name=SMED30020824-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=303bp
MLYLFFIYIFLLIILTVMPLIMLKIFKNIDFVSKFTRYGLFEKRLLSFTM
GLLLGDVFLNIMPMVWRNYKVKSNLNLLVAGLWTIGGLITFFICEKSLNI
IGITVGRSADMTLKCYDQSDLNHNSNNNNNQAIKTKKLFSKKIKEIGYLA
LIVSCLENLFYGILMGTAFTLTGKIGLFTTLCVLIHEIPYELRDFVLLMH
SGFDIYHTVLCQYFSSSWKIIGGLLCLILDEKLSNLLELWLLPVIGGALL
YIALVIMGPFVISEQSPKESGLQLLFICVGISITACISLGSKSIPIFYKF
LV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR003689ZIP
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0046873metal ion transmembrane transporter activity
Vocabulary: biological process
TermDefinition
GO:0030001metal ion transport
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003689Zinc/iron permeasePFAMPF02535Zipcoord: 3..287
e-value: 5.5E-25
score: 88.3
NoneNo IPR availablePANTHERPTHR16950:SF16ZINC TRANSPORTER ZIP13coord: 7..289
NoneNo IPR availablePANTHERPTHR16950ZINC TRANSPORTER SLC39A7 HISTIDINE-RICH MEMBRANE PROTEIN KE4coord: 7..289
NoneNo IPR availableTMHMMTMhelixcoord: 81..103
NoneNo IPR availableTMHMMTMhelixcoord: 240..262
NoneNo IPR availableTMHMMTMhelixcoord: 4..23
NoneNo IPR availableTMHMMTMhelixcoord: 146..168
NoneNo IPR availableTMHMMTMhelixcoord: 272..291
NoneNo IPR availableTMHMMTMhelixcoord: 44..66
NoneNo IPR availableTMHMMTMhelixcoord: 205..227