SMED30020811

Overview
NameSMED30020811
Smed IDSMED30020811
Length (bp)3284
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30020811 (SMED30020811) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30020811 (SMED30020811) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30020811 (SMED30020811) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30020811 (SMED30020811) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020811

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 33

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30020811SMESG000005612.1 Contig36452newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020811SMESG000059351.1 Contig597newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020811SMESG000059351.1 Contig597uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020811SMESG000080567.1 Contig595newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020811SMESG000080567.1 Contig595uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30020811SMESG000005612.1 dd_Smed_v6_2483_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30020811SMESG000005612.1 dd_Smed_v4_2483_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30020811SMESG000005612.1 Contig594uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30020811SMESG000005612.1 Contig594uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30020811SMESG000005612.1 Contig594uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30020811SMESG000005612.1 Contig594newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30020811SMESG000005612.1 Contig594newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30020811SMESG000005612.1 Contig594newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30020811SMESG000011575.1 Contig594uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30020811SMESG000011575.1 Contig594uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30020811SMESG000011575.1 Contig594uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30020811SMESG000011575.1 Contig594newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30020811SMESG000011575.1 Contig594newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30020811SMESG000011575.1 Contig594newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30020811SMESG000005612.1 dd_Smed_v4_2483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30020811SMESG000005612.1 dd_Smed_v4_2483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020811SMESG000005612.1 dd_Smed_v4_2483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020811SMESG000005612.1 dd_Smed_v4_2483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30020811SMESG000005612.1 dd_Smed_v4_2483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30020811SMESG000005612.1 dd_Smed_v4_2483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020811SMESG000005612.1 dd_Smed_v4_2483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30020811SMESG000005612.1 dd_Smed_v4_7446_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30020811SMESG000005612.1 dd_Smed_v4_7446_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020811SMESG000005612.1 Contig36452uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020811SMESG000005612.1 Contig595newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020811SMESG000005612.1 Contig595uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020811SMESG000005612.1 Contig597newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020811SMESG000005612.1 Contig597uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30020811 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.005609:30881..39623 +12592
Homology
BLAST of SMED30020811 vs. Ensembl Human
Match: LAMA2 (laminin subunit alpha 2 [Source:HGNC Symbol;Acc:HGNC:6482])

HSP 1 Score: 68.5514 bits (166), Expect = 8.702e-11
Identity = 108/502 (21.51%), Postives = 220/502 (43.82%), Query Frame = 3
Query:  423 EYLKTEIKKFESEKQTLSCELEEAQEKIAKYREDTETLTEENKTIKSKLTKFERTKSKTDEQLKKLEISNSESIAKNEEIERNLTQKNSENAELKQKFEIFSQKLHKSEMDLKSQQEKLNFVQCEKDDAIRNREEITRKYNELVEKSSKETSDHVEMYRKYENEIEKIRSEYKQMKTETVNLNNSLQAKEKEITNLKKDLKNLNVQLTKSKEESHNLTLNLAKVSKDLSSKESQTSQVSKENRRLSEDLENLKTEINCAKTDNEVKLQKMSENLMKKDSMLHDLENDKSLLEKEVKRLRKEFENFRQINEKHLNNLLESKSKEIENLVKINQELLSQIELTKKEFTEQNTELLREIERLKQDYSVKVEVSNEKSGLLEEITLLKTSCSSQEEKLSKLHEISEELKEKNNDLRVLQDQKMDFLKAIDQLKKEINS------------RDFSANEKVIELSQTVKNNEIVIYELLNEKKQLETKLEDLKKSTGE-KEVYFQNSK 1889
            E L T  + FE   + L  E+++  +++ +   +T+    E++ + +            +  LKK++    ES  +NEE+E++L +K    A+ K K +  +  L +   D   +  +L  V  +   A+  ++E        +E + KE +D ++   +  +EI  I    + ++T+   ++  L  K   I +L +++K+  +    S+ ESH   LN +    D    E++   +S       +   N+K  I+ A+     K+ K +++L  + + L      + LL+++ K   ++  +FR +NE          +K++ N VK N++ L+ ++   +    +N +LLR +              N+  G L  I           +  +KL  + ++ ++ N+  + +  Q  +  + +D LKK  N             +D S N  V +   TVKN E     L+++ K ++   ++LKK+  E KE+  Q  K
Sbjct: 1701 ETLGTRDEAFERNLEGLQKEIDQMIKELRRKNLETQKEIAEDELVAA------------EALLKKVKKLFGESRGENEEMEKDLREKL---ADYKNKVDD-AWDLLREATDKIREANRLFAVNQKNMTALEKKKEAVESGKRQIENTLKEGNDILDEANRLADEINSIIDYVEDIQTKLPPMSEELNDK---IDDLSQEIKDRKLAEKVSQAESHAAQLNDSSAVLDGILDEAK--NISFNATAAFKAYSNIKDYIDEAE-----KVAKEAKDLAHEATKL--ATGPRGLLKEDAKGCLQK--SFRILNE----------AKKLANDVKENEDHLNGLKTRIENADARNGDLLRTL--------------NDTLGKLSAIP---------NDTAAKLQAVKDKARQANDTAKDVLAQITELHQNLDGLKKNYNKLADSVAKTNAVVKDPSKNNAVADADATVKNLEQEADRLIDKLKPIKELEDNLKKNISEIKELINQARK 2139          
BLAST of SMED30020811 vs. Ensembl Human
Match: LAMA2 (laminin subunit alpha 2 [Source:HGNC Symbol;Acc:HGNC:6482])

HSP 1 Score: 67.781 bits (164), Expect = 1.532e-10
Identity = 107/502 (21.31%), Postives = 221/502 (44.02%), Query Frame = 3
Query:  423 EYLKTEIKKFESEKQTLSCELEEAQEKIAKYREDTETLTEENKTIKSKLTKFERTKSKTDEQLKKLEISNSESIAKNEEIERNLTQKNSENAELKQKFEIFSQKLHKSEMDLKSQQEKLNFVQCEKDDAIRNREEITRKYNELVEKSSKETSDHVEMYRKYENEIEKIRSEYKQMKTETVNLNNSLQAKEKEITNLKKDLKNLNVQLTKSKEESHNLTLNLAKVSKDLSSKESQTSQVSKENRRLSEDLENLKTEINCAKTDNEVKLQKMSENLMKKDSMLHDLENDKSLLEKEVKRLRKEFENFRQINEKHLNNLLESKSKEIENLVKINQELLSQIELTKKEFTEQNTELLREIERLKQDYSVKVEVSNEKSGLLEEITLLKTSCSSQEEKLSKLHEISEELKEKNNDLRVLQDQKMDFLKAIDQLKKEINS------------RDFSANEKVIELSQTVKNNEIVIYELLNEKKQLETKLEDLKKSTGE-KEVYFQNSK 1889
            E L T  + FE   + L  E+++  +++ +   +T+    E++ + +            +  LKK++    ES  +NEE+E++L +K    A+ K K +  +  L +   D   +  +L  V  +   A+  ++E        +E + KE +D ++   +  +EI  I    + ++T+   ++  L  K   I +L +++K+  +    S+ ESH   LN +    D    E++   +S       +   N+K  I+ A+     K+ K +++L  + + L      + LL+++ K   ++  +FR +NE          +K++ N VK N++ L+ ++   +    +N +LLR +              N+  G L  I           +  +KL  + ++ ++ N+  + +  Q  +  + +D LKK  N             +D S N+ + +   TVKN E     L+++ K ++   ++LKK+  E KE+  Q  K
Sbjct: 1701 ETLGTRDEAFERNLEGLQKEIDQMIKELRRKNLETQKEIAEDELVAA------------EALLKKVKKLFGESRGENEEMEKDLREKL---ADYKNKVDD-AWDLLREATDKIREANRLFAVNQKNMTALEKKKEAVESGKRQIENTLKEGNDILDEANRLADEINSIIDYVEDIQTKLPPMSEELNDK---IDDLSQEIKDRKLAEKVSQAESHAAQLNDSSAVLDGILDEAK--NISFNATAAFKAYSNIKDYIDEAE-----KVAKEAKDLAHEATKL--ATGPRGLLKEDAKGCLQK--SFRILNE----------AKKLANDVKENEDHLNGLKTRIENADARNGDLLRTL--------------NDTLGKLSAIP---------NDTAAKLQAVKDKARQANDTAKDVLAQITELHQNLDGLKKNYNKLADSVAKTNAVVKDPSKNKIIADADATVKNLEQEADRLIDKLKPIKELEDNLKKNISEIKELINQARK 2139          
BLAST of SMED30020811 vs. Ensembl Human
Match: LAMA2 (laminin subunit alpha 2 [Source:HGNC Symbol;Acc:HGNC:6482])

HSP 1 Score: 63.929 bits (154), Expect = 1.957e-9
Identity = 108/502 (21.51%), Postives = 220/502 (43.82%), Query Frame = 3
Query:  423 EYLKTEIKKFESEKQTLSCELEEAQEKIAKYREDTETLTEENKTIKSKLTKFERTKSKTDEQLKKLEISNSESIAKNEEIERNLTQKNSENAELKQKFEIFSQKLHKSEMDLKSQQEKLNFVQCEKDDAIRNREEITRKYNELVEKSSKETSDHVEMYRKYENEIEKIRSEYKQMKTETVNLNNSLQAKEKEITNLKKDLKNLNVQLTKSKEESHNLTLNLAKVSKDLSSKESQTSQVSKENRRLSEDLENLKTEINCAKTDNEVKLQKMSENLMKKDSMLHDLENDKSLLEKEVKRLRKEFENFRQINEKHLNNLLESKSKEIENLVKINQELLSQIELTKKEFTEQNTELLREIERLKQDYSVKVEVSNEKSGLLEEITLLKTSCSSQEEKLSKLHEISEELKEKNNDLRVLQDQKMDFLKAIDQLKKEINS------------RDFSANEKVIELSQTVKNNEIVIYELLNEKKQLETKLEDLKKSTGE-KEVYFQNSK 1889
            E L T  + FE   + L  E+++  +++ +   +T+    E++ + +            +  LKK++    ES  +NEE+E++L +K    A+ K K +  +  L +   D   +  +L  V  +   A+  ++E        +E + KE +D ++   +  +EI  I    + ++T+   ++  L  K   I +L +++K+  +    S+ ESH   LN +    D    E++   +S       +   N+K  I+ A+     K+ K +++L  + + L      + LL+++ K   +  ++FR +NE          +K++ N VK N++ L+ ++   +    +N +LLR +              N+  G L  I           +  +KL  + ++ ++ N+  + +  Q  +  + +D LKK  N             +D S N  V +   TVKN E     L+++ K ++   ++LKK+  E KE+  Q  K
Sbjct: 1701 ETLGTRDEAFERNLEGLQKEIDQMIKELRRKNLETQKEIAEDELVAA------------EALLKKVKKLFGESRGENEEMEKDLREK---LADYKNKVDD-AWDLLREATDKIREANRLFAVNQKNMTALEKKKEAVESGKRQIENTLKEGNDILDEANRLADEINSIIDYVEDIQTKLPPMSEELNDK---IDDLSQEIKDRKLAEKVSQAESHAAQLNDSSAVLDGILDEAK--NISFNATAAFKAYSNIKDYIDEAE-----KVAKEAKDLAHEATKL--ATGPRGLLKEDAKGCLQ--KSFRILNE----------AKKLANDVKENEDHLNGLKTRIENADARNGDLLRTL--------------NDTLGKLSAIP---------NDTAAKLQAVKDKARQANDTAKDVLAQITELHQNLDGLKKNYNKLADSVAKTNAVVKDPSKN-TVADADATVKNLEQEADRLIDKLKPIKELEDNLKKNISEIKELINQARK 2138          
BLAST of SMED30020811 vs. Ensembl Human
Match: KTN1 (kinectin 1 [Source:HGNC Symbol;Acc:HGNC:6467])

HSP 1 Score: 48.521 bits (114), Expect = 8.199e-6
Identity = 30/82 (36.59%), Postives = 45/82 (54.88%), Query Frame = 3
Query: 2805 NNETIGILEEQLKKCQEENFHLKVQLDHYRETLEKTENCLQNIQASVDQEENNWKI--------------CLKSSEQEQERL 3008
             +E + +LE +LK+  E +  L+++ + Y+  L +TE  LQ +Q SV+QEEN WK+                 SSEQE ERL
Sbjct:   72 GSEEVKVLEHKLKEADEMHTLLQLECEKYKSVLAETEGILQKLQRSVEQEENKWKVKVDESHKTIKQMQSSFTSSEQELERL 153          
BLAST of SMED30020811 vs. Ensembl Celegans
Match: lam-3 (LAMinin related. See also lmb; Laminin alpha chain [Source:UniProtKB/TrEMBL;Acc:G5ECE3])

HSP 1 Score: 58.9214 bits (141), Expect = 2.617e-8
Identity = 82/389 (21.08%), Postives = 185/389 (47.56%), Query Frame = 3
Query:  600 DEQLKKLEISNSESIAKNEEIERNLTQKNSENAELKQKFEIFS-QKLHKSEM-DLKSQQEKLNFVQCEKDDAIRNREEITRKYNELVEKSSKETSDHVEMYRKYENEIEKIRSEYKQMKTETVNLNNSLQ-AKEKEITNLKKDLKNLNVQLTKSK---EESHNLTLNLAKVSKDLSSKESQTSQVSKENRRLSEDLENLKTEINCAKTDNEVKLQKMSENLMKKDSMLHDLENDKSLLEKEVKRLRKEFENFRQINEKHLNNLLESKSKEIENLVKINQE-LLSQIELTKKEFTEQNTE------LLREIERLKQDYSVKVEVSNE-KSGLLEEITLLKTSCSSQEEKLSKLHEISEELKEKNNDLRVLQDQKMDFLKAIDQLKKEINS 1724
            D  L + E   + ++ + E +E+ L +   E+ + ++  ++ + QKL+++   DLK+   +++ ++   +D      ++++K     E+ S      +  Y++  NEIEK+R E    + +     NS++ A+ +E+ N+ +D + +N+ L +     E+  N+TL  +++  +   +  QT+       R +E LE    +I     D  V  +  +EN +K     H  EN    L+   + +    E    +++     +L S+  E  +    N+E L SQ+E  K E +  N +      ++ E+++ K+D + ++   NE K+ +++ + ++K   SS ++K  ++H I +      N  +   ++  +  K  + +K E+++
Sbjct: 1828 DGMLMEAEAHLNATVERGEYVEKRLNRAQQEHKKAEELLKMVTAQKLNETIFEDLKN---RIDVLEQWMNDYRETIYDVSKKDTADAERMSLVVGKRINRYKEVSNEIEKLRVE---AEDQIAYSRNSIEKARSEELMNMFEDKEKINMTLAELPDLVEQCQNITLLYSQLIDEYDEEYVQTAG------RHAEKLEVQAQKI----VDRFVDTRTETENPLKAS---HAYENIVEALKNATEAVDSAAEASEAVSK-----MLGSEGSESGD---ANEESLRSQLEKLKNESSLSNVDNSNAVKIVEELKKEKKDLTDRLGHLNELKTSIVKRLGVIKNEASSWDDKHDRMHSILK------NGAKTAHERSANVKKESEGIKTEVSA 2183          
BLAST of SMED30020811 vs. Ensembl Zebrafish
Match: lama5 (laminin, alpha 5 [Source:ZFIN;Acc:ZDB-GENE-030131-9823])

HSP 1 Score: 53.1434 bits (126), Expect = 2.574e-6
Identity = 98/539 (18.18%), Postives = 212/539 (39.33%), Query Frame = 3
Query:  912 EIEKIRSEYKQMKTETVNLNNS------LQAKEKEITNLKKDLKNLNVQLTKSKEESHNLTLNLAKVSKDLSSKESQTSQVSKENRRLSEDLENLKTE-------INCAKTDNEVKLQKMSENLMKKDSMLHDLENDKSLLEKEVKRLRKEFENFRQINEK------HLNNLLESKSKEIENLVKINQELLSQIELTKKEFTEQNTELLREIERLKQDYSVKVEVSNEKSGLLEEITLLKTSCSSQ-EEKLSKLHEISEELKEKNNDLRVLQDQKMDFLKAIDQLK-------KEINSRDFSAN--------EKVIELSQTVKNNEIVIYELLNEKKQLETKLE------DLKKSTGEKEVYFQNSKPMVXXXXXXXXXXXXXXXXXRVQHENREL---KAELNHANVYYKRQTDDLNENL-------ERKINEL-NFQNEFCIEWKDKCEKL---EKTLQESLNSNRQQLEMTVPVESIIQEIRVEPTESFASSY---RTTEEMQSHIVKLESELLALQRKYYDLKNSAITSDDIPES 2354
            ++++I   Y+ +  +  +LN S      L      I ++   + N N  L KS+  +  L   L  +  D+   E + S   K+   L +++ +  T        I     D +  +Q+++     +  ++ + +  + + E E       F  F     K        NNL++    EI N    N+ +   I    K+F EQ  +L   +     + +  VE +N     LE++     S   + +E +S+L    +++ + N+ L +LQD K D+     QL        +++     +AN        EK  E+ + + NN   +    N+   ++  L       ++  S  E E     +           + +    +   +++++ EL     ELN+++   K + D +  +L       E+ + +L + QN+  +   D    +   +  ++++ N+      +  P++  ++E + +  +S A+S    +   +  + +  L   L  L +K   L N+     +I +S
Sbjct: 2156 DLDRISHFYESVANQLTSLNASTFAWTQLNRLNASIADIANAITNYNSTLDKSRNRASVLEGELEIIDSDIKDLEKKASVTQKKKDALEDNINSTHTRAQELFGFIKGIMRDVKDIIQQVNRTAQNETQVMDEKDLARKIAEVESMLRDMRFRGFDYQKNKAKNELDQANNLVDRVINEIANRTWNNEAVAENIRNKLKQFNEQLMDLRDAMNEAVNNTAQTVEANNINQKHLEDLQKKVNSLHEKYKEVVSQLQMAEDDVTQVNDLLSMLQDSKEDYEHLAAQLDGARQPLAEKVQKYAPAANKIPLVEAAEKHAEMLEQLANNLSSLISGSNQDNFIQRALNASRAYTNIINSVLEAETTALKANETASMALENIRDKDLPAQAAALKNQSTELLKSAEELNNSSQSLKPRVDTIKMSLLDAEKKKEKMLQDLKDIQNKLNVSRDDIVNSISAAKSAVEQANNTVANVSGVLAPIQKQLEEWQKQYGDSNATSEDINKALNDANTSVAALSDTLPKLIKKLDRLHNTTFQPSNISDS 2694          
BLAST of SMED30020811 vs. Ensembl Xenopus
Match: wdcp (WD repeat and coiled coil containing [Source:Xenbase;Acc:XB-GENE-5729803])

HSP 1 Score: 57.7658 bits (138), Expect = 1.222e-7
Identity = 97/493 (19.68%), Postives = 210/493 (42.60%), Query Frame = 3
Query:  528 ETLTEENKTIKSKLTKFERTKSKTDEQLKKLEISNSESIAKNEEIERNLTQKNSENAELKQKFEIFSQKLHKSEMDLKSQ-QEKLNFVQCEKDDA---IRNREEITRKYNELVEKSSKETSDHVEMYRKYENEIEKIRSEYKQMKTETVNLNNSLQAKEKEITNLKKDLKNLNVQLTKSKEESHNLTLNLAK--VSKDLSSKESQTSQ----------VSKENRRLS-----------------EDLENLKTEINCAKTDNEVKLQKMSENLMKKDSMLHDLEN--DKSLLEKEVKRLRKEFENFRQINEKHLNNLLESKSKEIENLVKINQELLSQIELTKKEFTEQNTELLREIERLKQDYSVKVEVSNEKSGLLEEITLLKTSCSSQEEKLS----KLHEISEELKEKNNDLRVLQDQKMDFLKAIDQLKKEINSRDFSANEKVIELSQTVKNNEIVIYELLNEKKQLETKLEDLKKSTGEKEVYFQNSK 1889
            ETL   NKT+     + ++       +L++  + N ++ A +E          +  A L +  ++F +  HK   DL ++ +EKL   + + DD    +R      +  ++L   + K  ++  +   K + E E +  +   + TE   +NN  Q   ++++++ K+L  L  QL    E+ +NLT  +A+  + + +   E+Q +Q          +  E + LS                 +D E+   E   AK +  + L +  ++  K    +H  +N       E ++  ++   EN  + N+    N+L++ +     L  I  + L +I+  K +  + N      +ERLK      + +    + L E++     +     E ++    ++ ++ +E     + L+ +++ + +  K I Q+K+ IN     AN   I++S +   + I  Y+   +K +  T + ++K  T +  +++  SK
Sbjct: 1641 ETLGIPNKTLDKSFQELQKDIDSMMAELRRKSLRNQKNTADDE--------LKAAEALLNRVKKLFLEA-HKKNEDLNNEVKEKLGLFEEKLDDVWDLLREARGKIKAADDLSTVNQKNMTELEQGVEKGKKETESVLGDGDSIMTE---VNNLAQIINEDLSDMNKELPPLTEQLN---EKINNLTQEIARRDLPEQILQAENQAAQLIDSSAVLDGILAEAKNLSFNATVAFNAYSNIKDLIDDAEDTAKEAK-AKANEAIDLVRTKKSFTK----IHMQQNFIQARYNENDLAGIKNRLENADEKNQ----NMLQALNDTFGKLALIPNDTLVKIQTAKDKAKQANDTASDVLERLKDLNLNLLGLKQNYTALKEDVAKTNAAVKDPVENITDADGRVKQLEKEADRLLDKLKPIKELQENLGKNISQIKELINQARKQANS--IKVSVSSGGDCIRTYKPDIKKGRFNTIILNVKTDTQDNLLFYLGSK 2107          
BLAST of SMED30020811 vs. Ensembl Xenopus
Match: wdcp (WD repeat and coiled coil containing [Source:Xenbase;Acc:XB-GENE-5729803])

HSP 1 Score: 57.3806 bits (137), Expect = 1.609e-7
Identity = 105/511 (20.55%), Postives = 214/511 (41.88%), Query Frame = 3
Query:  528 ETLTEENKTIKSKLTKFERTKSKTDEQLKKLEISNSESIAKNE------------EIERNLTQKNSE-NAELKQKFEIFSQKLHKSEMDLKSQQEKLNFVQCEKDDAIRNREEITRKYNELVEKSSKETSDHVEMYRKYENEIEKIRSEYKQMKTETVNLNNSLQAKEKEITNLKKDLKNLNVQLTKSKEESHNLTLNLAK--VSKDLSSKESQTSQ----------VSKENRRLSED-------LENLKTEINCAK-TDNEVK----------------LQKMSENLMKKD-SMLHDLE---NDKSLLEKEVKRLRKEFENFRQINEKHLNNLLESKSKEIENLVKINQELLSQIELTKKEFTEQNTELLREIERLKQDYSVKVEVSNEKSGLLEEITLLKTSCSSQEEKLS----KLHEISEELKEKNNDLRVLQDQKMDFLKAIDQLKKEINSRDFSANEKVIELSQTVKNNEIVIYELLNEKKQLETKLEDLKKSTGEKEVYFQNSK 1889
            ETL   NKT+     + ++       +L++  + N ++ A +E            ++     +KN + N E+K+K  +F +KL      L+  + K+           +N  E+ RK  + VEK  KET              E +  +   + TE  NL   +   E +++++ K+L  L  QL    E+ +NLT  +A+  + + +   E+Q +Q          +  E + LS +         N+K  I+ A+ T  E K                L+  ++N ++K   +L D +    D    E ++  ++   EN  + N+    N+L++ +     L  I  + L +I+  K +  + N      +ERLK      + +    + L E++     +     E ++    ++ ++ +E     + L+ +++ + +  K I Q+K+ IN     AN   I++S +   + I  Y+   +K +  T + ++K  T +  +++  SK
Sbjct: 1503 ETLGIPNKTLDKSFQELQKDIDSMMAELRRKSLRNQKNTADDELKAAEALLNRVKKLFLEAHKKNEDLNNEVKEKLGLFEEKLDDVWDLLREARGKIKAADDLSTVNQKNMTELERK-KQGVEKGKKET--------------ESVLGDGDSIMTEVNNLAQIINEAENDLSDMNKELPPLTEQLN---EKINNLTQEIARRDLPEQILQAENQAAQLIDSSAVLDGILAEAKNLSFNATVAFNAYSNIKDLIDDAEDTAKEAKAKANEAIDLVTGPQGSLKDEAKNAIQKSFRVLSDAKRHSGDVKDNENDLAGIKNRLENADEKNQ----NMLQALNDTFGKLALIPNDTLVKIQTAKDKAKQANDTASDVLERLKDLNLNLLGLKQNYTALKEDVAKTNAAVKDPVENITDADGRVKQLEKEADRLLDKLKPIKELQENLGKNISQIKELINQARKQANS--IKVSVSSGGDCIRTYKPDIKKGRFNTIILNVKTDTQDNLLFYLGSK 1989          
BLAST of SMED30020811 vs. Ensembl Xenopus
Match: wdcp (WD repeat and coiled coil containing [Source:Xenbase;Acc:XB-GENE-5729803])

HSP 1 Score: 55.8398 bits (133), Expect = 4.960e-7
Identity = 99/495 (20.00%), Postives = 207/495 (41.82%), Query Frame = 3
Query:  528 ETLTEENKTIKSKLTKFERTKSKTDEQLKKLEISNSESIAKNE------------EIERNLTQKNSE-NAELKQKFEIFSQKLHKSEMDLKSQQEKLNFVQCEKDDAIRNREEITRKYNELVEKSSKETS----DHVEMYRKYENEIEKIRSEYKQMKTETVNLNNSLQAKEKEITNLKKDL--KNLNVQLTKSKEESHNLTLNLAKV------SKDLSSKESQTSQVSKENRRLSEDLENLKTEINCAKTDNEVKLQKMSENLMKKDS---------MLHDLE---NDKSLLEKEVKRLRKEFENFRQINEKHLNNLLESKSKEIENLVKINQELLSQIELTKKEFTEQNTELLREIERLKQDYSVKVEVSNEKSGLLEEITLLKTSCSSQEEKLS----KLHEISEELKEKNNDLRVLQDQKMDFLKAIDQLKKEINSRDFSANEKVIELSQTVKNNEIVIYELLNEKKQLETKLEDLKKSTGEKEVYFQNSK 1889
            ETL   NKT+     + ++       +L++  + N ++ A +E            ++     +KN + N E+K+K  +F +KL      L+  + K+           +N  E+ RK  + VEK  KET     D   +  +  N  + I  +   M  E   L   L  K   I NL +++  ++L  Q+ +++ ++  L  + A +      +K+LS   +         + L +D E+   E   AK +  + L    +  +K ++         +L D +    D    E ++  ++   EN  + N+    N+L++ +     L  I  + L +I+  K +  + N      +ERLK      + +    + L E++     +     E ++    ++ ++ +E     + L+ +++ + +  K I Q+K+ IN     AN   I++S +   + I  Y+   +K +  T + ++K  T +  +++  SK
Sbjct: 1687 ETLGIPNKTLDKSFQELQKDIDSMMAELRRKSLRNQKNTADDELKAAEALLNRVKKLFLEAHKKNEDLNNEVKEKLGLFEEKLDDVWDLLREARGKIKAADDLSTVNQKNMTELERK-KQGVEKGKKETESVLGDGDSIMTEVNNLAQIINEDLSDMNKELPPLTEQLNEK---INNLTQEIARRDLPEQILQAENQAAQLIDSSAVLDGILAEAKNLSFNATVAFNAYSNIKDLIDDAEDTAKEAK-AKANEAIDLVTGPQGSLKDEAKNAIQKSFRVLSDAKRHSGDVKDNENDLAGIKNRLENADEKNQ----NMLQALNDTFGKLALIPNDTLVKIQTAKDKAKQANDTASDVLERLKDLNLNLLGLKQNYTALKEDVAKTNAAVKDPVENITDADGRVKQLEKEADRLLDKLKPIKELQENLGKNISQIKELINQARKQANS--IKVSVSSGGDCIRTYKPDIKKGRFNTIILNVKTDTQDNLLFYLGSK 2170          
BLAST of SMED30020811 vs. Ensembl Xenopus
Match: wdcp (WD repeat and coiled coil containing [Source:Xenbase;Acc:XB-GENE-5729803])

HSP 1 Score: 53.5286 bits (127), Expect = 2.700e-6
Identity = 101/497 (20.32%), Postives = 208/497 (41.85%), Query Frame = 3
Query:  528 ETLTEENKTIKSKLTKFERTKSKTDEQLKKLEISNSESIAKNE------------EIERNLTQKNSE-NAELKQKFEIFSQKLHKSEMDLKSQQEKLNFVQCEKDDAIRNREEITRKYNELVEKSSKETSDHV---EMYRKYENEIEKIRSEYKQMKTE--TVNLNNSLQAKEKEITNLKKDL-------KNLNVQLTKSK-------EESHNLTLNLAKVS-------KDLSSKESQTSQVSKENRRLSEDLENLKTEINCAKTDNEVKLQKMSENLMKKDSMLHDLENDKSLLEKEVKRLRKEFENFRQINEKHLNNLLESKSKEIENLVKINQELLSQIELTKKEFTEQNTELLREIERLKQDYSVKVEVSNEKSGLLEEITLLKTSCSSQEEKLS----KLHEISEELKEKNNDLRVLQDQKMDFLKAIDQLKKEINSRDFSANEKVIELSQTVKNNEIVIYELLNEKKQLETKLEDLKKSTGEKEVYFQNSK 1889
            ETL   NKT+     + ++       +L++  + N ++ A +E            ++     +KN + N E+K+K  +F +KL      L+  + K+           +N  E+  K  + VEK  KET   +   +      N + +I +E + +K    T  LN  +    +EI   ++DL       +N   QL  S         E+ NL+ N A V+       KDL      T++ +K   + +E ++ +       K + +  +QK    L        D++++    E ++  ++   EN  + N+    N+L++ +     L  I  + L +I+  K +  + N      +ERLK      + +    + L E++     +     E ++    ++ ++ +E     + L+ +++ + +  K I Q+K+ IN     AN   I++S +   + I  Y+   +K +  T + ++K  T +  +++  SK
Sbjct: 1672 ETLGIPNKTLDKSFQELQKDIDSMMAELRRKSLRNQKNTADDELKAAEALLNRVKKLFLEAHKKNEDLNNEVKEKLGLFEEKLDDVWDLLREARGKIKAADDLSTVNQKNMTELEVKKKQGVEKGKKETESVLGDGDSIMTEVNNLAQIINEAENVKLPPLTEQLNEKINNLTQEIA--RRDLPEQILQAENQAAQLIDSSAVLDGILAEAKNLSFN-ATVAFNAYSNIKDLIDDAEDTAKEAKA--KANEAIDLVTGPQGSLKDEAKNAIQKSFRVLSDAKRHSGDVKDN----ENDLAGIKNRLENADEKNQ----NMLQALNDTFGKLALIPNDTLVKIQTAKDKAKQANDTASDVLERLKDLNLNLLGLKQNYTALKEDVAKTNAAVKDPVENITDADGRVKQLEKEADRLLDKLKPIKELQENLGKNISQIKELINQARKQANS--IKVSVSSGGDCIRTYKPDIKKGRFNTIILNVKTDTQDNLLFYLGSK 2153          
BLAST of SMED30020811 vs. Ensembl Xenopus
Match: wdcp (WD repeat and coiled coil containing [Source:Xenbase;Acc:XB-GENE-5729803])

HSP 1 Score: 52.7582 bits (125), Expect = 4.858e-6
Identity = 91/467 (19.49%), Postives = 195/467 (41.76%), Query Frame = 3
Query:  528 ETLTEENKTIKSKLTKFERTKSKTDEQLKKLEISNSESIAKNEEIERNLTQKNSENAELKQKFEIFSQKLHKSEMDLKSQ-QEKLNFVQCEKDDAIRNREEITRKYNELVEKSSKETSDHVEMYRKYENEIEKIRSEYKQMKTETVNLNNSLQAKEKEITNLKKDLKNLNVQLTKSKEESHNLTLNLAKV------SKDLSSKESQTSQVSKENRRLSEDLENLKTEINCAKTDNEVKLQKMSENLMKKDSMLHDLEN--DKSLLEKEVKRLRKEFENFRQINEKHLNNLLESKSKEIENLVKINQELLSQIELTKKEFTEQNTELLREIERLKQDYSVKVEVSNEKSGLLEEITLLKTSCSSQEEKLS----KLHEISEELKEKNNDLRVLQDQKMDFLKAIDQLKKEINSRDFSANEKVIELSQTVKNNEIVIYELLNEKKQLETKLEDLKKSTGEKEVYFQNSK 1889
            ETL   NKT+     + ++       +L++  + N ++ A +E          +  A L +  ++F +  HK   DL ++ +EKL   + + DD      E   K         K   D   + +K   E+E +    K++   T  LN  +    +EI       ++L  Q+ +++ ++  L  + A +      +K+LS   +         + L +D E+   E   AK +  + L +  ++  K    +H  +N       E ++  ++   EN  + N+    N+L++ +     L  I  + L +I+  K +  + N      +ERLK      + +    + L E++     +     E ++    ++ ++ +E     + L+ +++ + +  K I Q+K+ IN     AN   I++S +   + I  Y+   +K +  T + ++K  T +  +++  SK
Sbjct: 1597 ETLGIPNKTLDKSFQELQKDIDSMMAELRRKSLRNQKNTADDE--------LKAAEALLNRVKKLFLEA-HKKNEDLNNEVKEKLGLFEEKLDDVWDLLREARGKI--------KAADDLSTVNQKNMTELEDLSDMNKELPPLTEQLNEKINNLTQEIAR-----RDLPEQILQAENQAAQLIDSSAVLDGILAEAKNLSFNATVAFNAYSNIKDLIDDAEDTAKEAK-AKANEAIDLVRTKKSFTK----IHMQQNFIQARYNENDLAGIKNRLENADEKNQ----NMLQALNDTFGKLALIPNDTLVKIQTAKDKAKQANDTASDVLERLKDLNLNLLGLKQNYTALKEDVAKTNAAVKDPVENITDADGRVKQLEKEADRLLDKLKPIKELQENLGKNISQIKELINQARKQANS--IKVSVSSGGDCIRTYKPDIKKGRFNTIILNVKTDTQDNLLFYLGSK 2030          
BLAST of SMED30020811 vs. Ensembl Mouse
Match: Lama2 (laminin, alpha 2 [Source:MGI Symbol;Acc:MGI:99912])

HSP 1 Score: 53.1434 bits (126), Expect = 2.891e-6
Identity = 111/513 (21.64%), Postives = 217/513 (42.30%), Query Frame = 3
Query:  423 EYLKTEIKKFES--EKQTLSCELEEAQEKIAKYREDTETLTEENKTIKSKLTKFERTKSKTDEQ--------LKKLEISNSESIAKNEEIERNLTQKNSENAELKQKFEIFSQKLHKSEMDLKSQQEKLNFVQCEKDDAIRNREEITRKYNELVEKSSKETSDHVEMYRKYENEIEKIRSEYKQMKTETVNLNNSLQAKEKEITNLKKDLKNLNVQLTKSKEESHNLTLNLAKVSKDLSSKESQTSQVSKENRRLSEDLENLKTEINCAKTDNEVKLQKMSENLMKKDSMLHDLENDKSLLEKEVK-RLRKEFENFRQINEKHLNNLLESKSKEIENLVKINQELLSQIELTKKEFTEQNTELLREIERLKQDYSVKVEVSNEKSGLLEEITLLKTSCSSQEEKLSKLHEISEELKEKNNDLRVLQDQKMDFLKAIDQLKKEINS------------RDFSANEKVIELSQTVKNNEIVIYELLNEKKQLETKLEDLKKSTGE-KEVYFQNSK 1889
            E++K  ++  E+  EK     E    Q+K A+ R   E   E ++ +K   +K  +T+ +  E         LK++     E  A+NE++E++L QK    AE K K +  +  L +   D      +L+    +    +  ++E        +E + KE +D ++   +   EI  +      +KT+   ++  L  K   I +L +++K+  +     + ESH   LN +    D    E++   +S           N+K  I+ A+     K+ + ++ L +  + L    + + LL+++ K  L+K   +FR +NE          +K++ N VK N   L+ ++   +    +N+ LL  +              N+    L  IT          +  +KL  + E+ +E N+  + +  Q  D  + +D LK+  N             +D S N+ + +   +V+N E     L+++ K ++   ++LKK+  E KE+  Q  K
Sbjct: 1676 EFIKGLVQDAEAINEKAVQLNETLGNQDKTAE-RNLEELQKEIDRMLKELRSKDLQTQKEVAEDELVAAEGLLKRVNKLFGEPRAQNEDMEKDLQQKL---AEYKNKLDD-AWDLLREATDKTRDANRLSAANQKNMTILETKKEAIEGSKRQIENTLKEGNDILDEANRLLGEINSVIDYVDDIKTKLPPMSEELSDK---IDDLAQEIKDRRLAEKVFQAESHAAQLNDSSAVLDGILDEAK--NISFNATAAFRAYSNIKDYIDEAE-----KVAREAKELAQGATKL--ATSPQGLLKEDAKGSLQK---SFRILNE----------AKKLANDVKGNHNDLNDLKTRLETADLRNSGLLGAL--------------NDTMDKLSAIT---------NDTAAKLQAVKEKAREANDTAKAVLAQVKDLHQNLDGLKQNYNKLADSVAKTNAVVKDPSKNKIIADAGTSVRNLEQEADRLIDKLKPIKELEDNLKKNISEIKELINQARK 2135          
BLAST of SMED30020811 vs. UniProt/SwissProt
Match: sp|P24043|LAMA2_HUMAN (Laminin subunit alpha-2 OS=Homo sapiens OX=9606 GN=LAMA2 PE=1 SV=4)

HSP 1 Score: 67.781 bits (164), Expect = 7.355e-10
Identity = 107/502 (21.31%), Postives = 221/502 (44.02%), Query Frame = 3
Query:  423 EYLKTEIKKFESEKQTLSCELEEAQEKIAKYREDTETLTEENKTIKSKLTKFERTKSKTDEQLKKLEISNSESIAKNEEIERNLTQKNSENAELKQKFEIFSQKLHKSEMDLKSQQEKLNFVQCEKDDAIRNREEITRKYNELVEKSSKETSDHVEMYRKYENEIEKIRSEYKQMKTETVNLNNSLQAKEKEITNLKKDLKNLNVQLTKSKEESHNLTLNLAKVSKDLSSKESQTSQVSKENRRLSEDLENLKTEINCAKTDNEVKLQKMSENLMKKDSMLHDLENDKSLLEKEVKRLRKEFENFRQINEKHLNNLLESKSKEIENLVKINQELLSQIELTKKEFTEQNTELLREIERLKQDYSVKVEVSNEKSGLLEEITLLKTSCSSQEEKLSKLHEISEELKEKNNDLRVLQDQKMDFLKAIDQLKKEINS------------RDFSANEKVIELSQTVKNNEIVIYELLNEKKQLETKLEDLKKSTGE-KEVYFQNSK 1889
            E L T  + FE   + L  E+++  +++ +   +T+    E++ + +            +  LKK++    ES  +NEE+E++L +K    A+ K K +  +  L +   D   +  +L  V  +   A+  ++E        +E + KE +D ++   +  +EI  I    + ++T+   ++  L  K   I +L +++K+  +    S+ ESH   LN +    D    E++   +S       +   N+K  I+ A+     K+ K +++L  + + L      + LL+++ K   ++  +FR +NE          +K++ N VK N++ L+ ++   +    +N +LLR +              N+  G L  I           +  +KL  + ++ ++ N+  + +  Q  +  + +D LKK  N             +D S N+ + +   TVKN E     L+++ K ++   ++LKK+  E KE+  Q  K
Sbjct: 1701 ETLGTRDEAFERNLEGLQKEIDQMIKELRRKNLETQKEIAEDELVAA------------EALLKKVKKLFGESRGENEEMEKDLREKL---ADYKNKVDD-AWDLLREATDKIREANRLFAVNQKNMTALEKKKEAVESGKRQIENTLKEGNDILDEANRLADEINSIIDYVEDIQTKLPPMSEELNDK---IDDLSQEIKDRKLAEKVSQAESHAAQLNDSSAVLDGILDEAK--NISFNATAAFKAYSNIKDYIDEAE-----KVAKEAKDLAHEATKL--ATGPRGLLKEDAKGCLQK--SFRILNE----------AKKLANDVKENEDHLNGLKTRIENADARNGDLLRTL--------------NDTLGKLSAIP---------NDTAAKLQAVKDKARQANDTAKDVLAQITELHQNLDGLKKNYNKLADSVAKTNAVVKDPSKNKIIADADATVKNLEQEADRLIDKLKPIKELEDNLKKNISEIKELINQARK 2139          
BLAST of SMED30020811 vs. UniProt/SwissProt
Match: sp|Q90631|KTN1_CHICK (Kinectin OS=Gallus gallus OX=9031 GN=KTN1 PE=1 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 8.156e-6
Identity = 31/109 (28.44%), Postives = 68/109 (62.39%), Query Frame = 3
Query: 2727 HESVKAKYDSLAEEFYVLRNSTEIQDNNETIGILEEQLKKCQEENFHLKVQLDHYRETLEKTENCLQNIQASVDQEENNWKICLKSSEQEQERLEEKIKELLNQIEELR 3053
            H      ++ +A+E+  LR ++     +E I ++E++LK+ +E +  L+++ + Y+  L +TE  LQ +Q SV++EE+ WKI ++ S++E +++   +  L +++E L+
Sbjct: 1097 HSEWICGFEKMAKEY--LRGAS----GSEDIKVMEQKLKEAEELHILLQLECEKYKSVLAETEGILQRLQRSVEEEESKWKIKVEESQKELKQMRSSVASLEHEVERLK 1199          
BLAST of SMED30020811 vs. Ensembl Cavefish
Match: lama5 (laminin, alpha 5 [Source:ZFIN;Acc:ZDB-GENE-030131-9823])

HSP 1 Score: 58.5362 bits (140), Expect = 4.905e-8
Identity = 95/491 (19.35%), Postives = 201/491 (40.94%), Query Frame = 3
Query:  381 TIPDDILNKNLSEIEYLKTEIKKFESEKQTLSCELEEAQEKIAKYREDTETLTEENKTIKSKLTKFERTKSKTD---EQLKKLEIS-NSESIAKNEEIERNLTQKNSENAELKQKFEIFSQKLHKSEMDLKSQQEKLNFVQCEKDDAIRNREEITRKYNELVEKSSKETSDHVEMYRKYENEI----EKIRSEYKQMKTETVNLNNSLQAKEKEITNL----KKDLKNLN---VQLTKSKEESHNLTLNLAKVSKDLSSK------ESQTSQVSKENRRLSEDLENLKTEINCAKTD-NEVKLQKMSENLMKKDSMLHDLENDKSLLEKEVKRLRKE-FENFRQINEKHLNNLLESKSKEIENLVKINQELLSQIELTKKEFTEQNTELLREIERLKQDYSVKVEVSNEKSGLLEEITLLKTSCSSQEEKLSKLH----EISEELKEKNNDLRVLQDQKMDFLKAIDQLKKEINSRDFSANEKVIELSQTV 1772
            +I +  +N   S ++  + +    E E QT+  +L E QEK +       TL  EN TI +K    ER ++  D     +K +E + N       EE++R L +  +   ++  +F   + +  +++ +L    + L+ V+ E  D     E    +    + K  +E +   +   +  N      EK  +  KQ+      +N+ L+ K+KE+T+     + D+  +N     L  SKEE   L   L    + L+ K          S + +E  + +E L+ L   ++   +D N+    + + N  +  + + +  N+   L KE  +   E  E    +N   L   L+     ++N      +L+  ++  +            EI+  K   S   + ++  + +L+ +  +K      +E+    +    EI++ L E N  +  + D+    +  +++L   + + + S  E ++ + + +
Sbjct: 2198 SIENKSINNYNSSLDGSRDKANTLEKELQTIDSDLFELQEKASLSSRKGATL--ENNTIATK----ERAQNLLDTVKNYMKDIEAAQNGSQTMDEEELKRKLAEVAAMLRDM--RFRSTTPQGKQADYELSQANQLLDRVKSEMADRTAANEATVEEIKNKLNKFHQELTSLRDALNEAANNTALASEKNNANQKQLDENQQKVND-LKKKQKEVTDTMQMAEDDVAQVNDMLAMLQDSKEEYERLAAQLDGARQPLAEKVQNFSTSGAKSPLVEEAEKHAELLDQLAKNLSSVISDTNQDGFIQRALNASRAYNNIINSVNEADNLAKEANKSATEALEPKCVLNWTELKPQLQDIKNRLQNATTKKSDLMMDLQKVQNYLNTSQGNTSGEIQAAK---SAAEKANSTAADVLDTLDPIKKKLDEWQEQYGSSNMTNDEINKALSEANKSVGAIDDKIRTLMVKLNKLSTSVPTNNIS--ESILRIRELI 2674          
BLAST of SMED30020811 vs. Ensembl Cavefish
Match: rrbp1b (ribosome-binding protein 1 [Source:NCBI gene;Acc:103030923])

HSP 1 Score: 53.9138 bits (128), Expect = 1.209e-6
Identity = 32/90 (35.56%), Postives = 52/90 (57.78%), Query Frame = 3
Query: 2799 QDNNETIGILEEQLKKCQEENFHLKVQLDHYRETLEKTENCLQNIQASVDQEENNWKICLKSSEQEQERLEEKIKELLNQIEELRSKQHS 3068
            Q N E    L+ +L+K +E    L+ Q D YR TL +TE  L+++Q SV++ E  WK  +  +E++ +    K+KEL   +E LR++  S
Sbjct:  977 QQNTELTDSLQ-KLRKAEESQNTLQAQCDQYRATLSQTEGVLKDLQCSVEEGERAWKAKISEAEEQHQTAVSKLKELEVTVETLRAENQS 1065          
BLAST of SMED30020811 vs. Ensembl Cavefish
Match: rrbp1b (ribosome-binding protein 1 [Source:NCBI gene;Acc:103030923])

HSP 1 Score: 53.9138 bits (128), Expect = 1.217e-6
Identity = 32/90 (35.56%), Postives = 52/90 (57.78%), Query Frame = 3
Query: 2799 QDNNETIGILEEQLKKCQEENFHLKVQLDHYRETLEKTENCLQNIQASVDQEENNWKICLKSSEQEQERLEEKIKELLNQIEELRSKQHS 3068
            Q N E    L+ +L+K +E    L+ Q D YR TL +TE  L+++Q SV++ E  WK  +  +E++ +    K+KEL   +E LR++  S
Sbjct:  946 QQNTELTDSLQ-KLRKAEESQNTLQAQCDQYRATLSQTEGVLKDLQCSVEEGERAWKAKISEAEEQHQTAVSKLKELEVTVETLRAENQS 1034          
BLAST of SMED30020811 vs. Ensembl Cavefish
Match: rrbp1b (ribosome-binding protein 1 [Source:NCBI gene;Acc:103030923])

HSP 1 Score: 53.5286 bits (127), Expect = 1.287e-6
Identity = 32/90 (35.56%), Postives = 52/90 (57.78%), Query Frame = 3
Query: 2799 QDNNETIGILEEQLKKCQEENFHLKVQLDHYRETLEKTENCLQNIQASVDQEENNWKICLKSSEQEQERLEEKIKELLNQIEELRSKQHS 3068
            Q N E    L+ +L+K +E    L+ Q D YR TL +TE  L+++Q SV++ E  WK  +  +E++ +    K+KEL   +E LR++  S
Sbjct:  977 QQNTELTDSLQ-KLRKAEESQNTLQAQCDQYRATLSQTEGVLKDLQCSVEEGERAWKAKISEAEEQHQTAVSKLKELEVTVETLRAENQS 1065          
BLAST of SMED30020811 vs. Planmine SMEST
Match: SMESG000005612.1 (SMESG000005612.1)

HSP 1 Score: 1833.92 bits (4749), Expect = 0.000e+0
Identity = 1002/1039 (96.44%), Postives = 1008/1039 (97.02%), Query Frame = 3
Query:   78 MLFILSIILTFIVILLSAYFIYFYLKPKKEPVTSSKHPVTKPQGEASVSQPXXXXXXXXXXXGEIKATHDEVSESVNEVQADENLNPETFITPVISVSQENTIPDDILNKNLSEIEYLKTEIKKFESEKQTLSCELEEAQEKIAKYREDTETLTEENKTIKSKLTKFERTKSKTDEQLKKLEISNSESIAKNEEIERNLTQKNSENAELKQKFEIFSQKLHKSEMDLKSQQEKLNFVQCEKDDAIRNREEITRKYNELVEKSSKETSDHVEMYRKYENEIEKIRSEYKQMKTETVNLNNSLQAKEKEITNLKKDLKNLNVQLTKSKEESHNLTLNLAKVSKDLSSKESQTSQVSKENRRLSEDLENLKTEINCAKTDNEVKLQKMSENLMKKDSMLHDLENDKSLLEKEVKRLRKEFENFRQINEKHLNNLLESKSKEIENLVKINQELLSQIELTKKEFTEQNTELLREIERLKQDYSVKVEVSNEKSGLLEEITLLKTSCSSQEEKLSKLHEISEELKEKNNDLRVLQDQKMDFLKAIDQLKKEINSRDFSANEKVIELSQTVKNNEIVIYELLNEKKQLETKLEDLKKSTGEKEVYFQNSKPMVXXXXXXXXXXXXXXXXXRVQHENRELKAELNHANVYYKRQTDDLNENLERKINELNFQNEFCIEWKDKCEKLEKTLQESLNSNRQQLEMTVPVESIIQEIRVEPTESFASSYRTTEEMQSHIVKLESELLALQRKYYDLKNSAITSDDIPESHSKSPANVNIYQSDIISIPPTDMTIDVETISDNKADQSHSASNFLNSIEKLNIEIFEQRLKNQTLGKQLIDKNIEVNALKQCLYGLDGDLLSIEHLALDLQXXXXXXXXXXNKLKADYNQLIKEHESVKAKYDSLAEEFYVLRNSTEIQDNNETIGILEEQLKKCQEENFHLKVQLDHYRETLEKTENCLQNIQASVDQEENNWKICLKSSEQEQERLEEKIKELLNQIEELRSKQHSDSPTMISMETPPIANGSLSSETXXXXXXXXXXXXXXXXVTQQ 3194
            MLFILSIILTFIVILLSAYFIYFYLKPKKEPVTSSKHPVTKPQGE SVSQPKKSKKQKKLHKGE K THDEVSESVNEVQADENLNPETFITPVISVS ENTIPDDILNKNLSEIEYLKTEIKKFESEKQTLSCELEEAQEKIAKYREDTETLTEENKTIKSKLTKFERTKSKTDEQLKKLEISNSESIAKNEEIERNLTQKNSENAELKQKFEIFSQKLHKSEMDLKSQQEKLNFVQCEKDDAIRNREEITRKYNELVEKSSKETSDHVEMYRKY+NEIEKIRSEYKQMKTETVNLNNSLQAKEKEITNLKKDLKNLNVQLTKSKEESHNLTLNL KVSKDLSSKESQ   VS ENRRLSE +ENLKTEINCAKTDNEVKLQKMSENLMKKDSMLHDLENDKSLLEKEVKRLRKEFENFR+INEKHLNNLLESKSKEIENLVKINQELLSQIELTKKEFTEQNTELLREIERLKQDYSVKVEVSNEKSGLLEEITLLKTSCSSQEEKLSKLHEISEELKEKNNDLRVLQDQKMDFLKAIDQLKKEINSRDFSANEKVIELSQT               KQLETKLEDLKKS GEKEVYFQNSKPMVEFEELFKKLEKKNEEL+RVQHENRELKAELNHANVYYKRQTDDLNENLERKINELNFQNEFCIEWKDKCE LEKTLQESLNSNRQ LEMTVP+ESIIQEIRVEPTESFASSYRTTEEMQSHIVKLESELLALQRKYYDLKNSAITSDDIPESHSKSPANVNIYQSDIISIPPTDMTI+ ETISDNKADQSHSASN LNSIEKLNIEI EQRLKNQTLGKQLIDKNIEVNALKQCLYGLDGDLLSIEHLALDLQKSFSESSSEKNKLKADYNQLIKEHESVKAKYDSLAEEFYVLRNSTEIQDNNETIGILEEQLKKCQEENFHLKVQLDHYRETLEKTENCLQNIQASVDQEENNWKICLKSSEQEQERLEEKIKELLNQIEELRSKQHSDSPTMISMETPPIANGSLSSETKKKRKRKNKKKKNKNRVTQQ
Sbjct:    1 MLFILSIILTFIVILLSAYFIYFYLKPKKEPVTSSKHPVTKPQGEPSVSQPKKSKKQKKLHKGESKVTHDEVSESVNEVQADENLNPETFITPVISVSHENTIPDDILNKNLSEIEYLKTEIKKFESEKQTLSCELEEAQEKIAKYREDTETLTEENKTIKSKLTKFERTKSKTDEQLKKLEISNSESIAKNEEIERNLTQKNSENAELKQKFEIFSQKLHKSEMDLKSQQEKLNFVQCEKDDAIRNREEITRKYNELVEKSSKETSDHVEMYRKYDNEIEKIRSEYKQMKTETVNLNNSLQAKEKEITNLKKDLKNLNVQLTKSKEESHNLTLNLEKVSKDLSSKESQ---VSNENRRLSEYIENLKTEINCAKTDNEVKLQKMSENLMKKDSMLHDLENDKSLLEKEVKRLRKEFENFREINEKHLNNLLESKSKEIENLVKINQELLSQIELTKKEFTEQNTELLREIERLKQDYSVKVEVSNEKSGLLEEITLLKTSCSSQEEKLSKLHEISEELKEKNNDLRVLQDQKMDFLKAIDQLKKEINSRDFSANEKVIELSQT---------------KQLETKLEDLKKSNGEKEVYFQNSKPMVEFEELFKKLEKKNEELVRVQHENRELKAELNHANVYYKRQTDDLNENLERKINELNFQNEFCIEWKDKCENLEKTLQESLNSNRQHLEMTVPIESIIQEIRVEPTESFASSYRTTEEMQSHIVKLESELLALQRKYYDLKNSAITSDDIPESHSKSPANVNIYQSDIISIPPTDMTIEAETISDNKADQSHSASNLLNSIEKLNIEISEQRLKNQTLGKQLIDKNIEVNALKQCLYGLDGDLLSIEHLALDLQKSFSESSSEKNKLKADYNQLIKEHESVKAKYDSLAEEFYVLRNSTEIQDNNETIGILEEQLKKCQEENFHLKVQLDHYRETLEKTENCLQNIQASVDQEENNWKICLKSSEQEQERLEEKIKELLNQIEELRSKQHSDSPTMISMETPPIANGSLSSETKKKRKRKNKKKKNKNRVTQQ 1021          
BLAST of SMED30020811 vs. Planmine SMEST
Match: SMESG000005612.1 (SMESG000005612.1)

HSP 1 Score: 1771.52 bits (4587), Expect = 0.000e+0
Identity = 979/1039 (94.23%), Postives = 985/1039 (94.80%), Query Frame = 3
Query:   78 MLFILSIILTFIVILLSAYFIYFYLKPKKEPVTSSKHPVTKPQGEASVSQPXXXXXXXXXXXGEIKATHDEVSESVNEVQADENLNPETFITPVISVSQENTIPDDILNKNLSEIEYLKTEIKKFESEKQTLSCELEEAQEKIAKYREDTETLTEENKTIKSKLTKFERTKSKTDEQLKKLEISNSESIAKNEEIERNLTQKNSENAELKQKFEIFSQKLHKSEMDLKSQQEKLNFVQCEKDDAIRNREEITRKYNELVEKSSKETSDHVEMYRKYENEIEKIRSEYKQMKTETVNLNNSLQAKEKEITNLKKDLKNLNVQLTKSKEESHNLTLNLAKVSKDLSSKESQTSQVSKENRRLSEDLENLKTEINCAKTDNEVKLQKMSENLMKKDSMLHDLENDKSLLEKEVKRLRKEFENFRQINEKHLNNLLESKSKEIENLVKINQELLSQIELTKKEFTEQNTELLREIERLKQDYSVKVEVSNEKSGLLEEITLLKTSCSSQEEKLSKLHEISEELKEKNNDLRVLQDQKMDFLKAIDQLKKEINSRDFSANEKVIELSQTVKNNEIVIYELLNEKKQLETKLEDLKKSTGEKEVYFQNSKPMVXXXXXXXXXXXXXXXXXRVQHENRELKAELNHANVYYKRQTDDLNENLERKINELNFQNEFCIEWKDKCEKLEKTLQESLNSNRQQLEMTVPVESIIQEIRVEPTESFASSYRTTEEMQSHIVKLESELLALQRKYYDLKNSAITSDDIPESHSKSPANVNIYQSDIISIPPTDMTIDVETISDNKADQSHSASNFLNSIEKLNIEIFEQRLKNQTLGKQLIDKNIEVNALKQCLYGLDGDLLSIEHLALDLQXXXXXXXXXXNKLKADYNQLIKEHESVKAKYDSLAEEFYVLRNSTEIQDNNETIGILEEQLKKCQEENFHLKVQLDHYRETLEKTENCLQNIQASVDQEENNWKICLKSSEQEQERLEEKIKELLNQIEELRSKQHSDSPTMISMETPPIANGSLSSETXXXXXXXXXXXXXXXXVTQQ 3194
            MLFILSIILTFIVILLSAYFIYFYLKPKKEPVTSSKHPVTKPQGE SVSQPKKSKKQKKLHKGE K THDEVSESVNEVQADENLNPETFITPVISVS ENTIPDDILNKNLSEIEYLKTEIKKFESEKQTLSCELEEAQEKIAKYREDTETLTEENKTIKSKLTKFERTKSKTDEQLKKLEISNSESIAKNEEIERNLTQKNSENAELKQKFEIFSQKLHKSEMDLKSQQEKLNFVQCEKDDAIRNREEITRKYNELVEKSSKETSDHVEMYRKY+NEIEKIRSEYKQMKTETVNLNNSLQAKEKEITNLKKDLKNLNVQLTKSKEESHNLTLNL KVSKDLSSKE   SQVS ENRRLSE +ENLKTEINCAKTDNEVKLQKMSENLMKKDSMLHDLENDKSLLEKEVKRLRKEFENFR+INEKHLNNLLESKSKEIENLVKINQELLSQIELTKKEFTEQNTELLREIERLKQDYSVKVEVSNEKSGLLEEITLLKTSCSSQEEKLSKLHEISEELKEKNNDLRVLQDQKMDFLKAIDQLKKEINSRDFSANEKVIELSQT               KQLETKLEDLKKS GEKEVYFQNSKPMVEFEELFKKLEKKNEEL+RVQHENRELKAELNHANVYYKRQTDDLNENLERKINELNFQNEFCIEWKDKCE LEKTLQESLNSNRQ LEMTVP+ESIIQEIRVEPTESFASSYRTTEEMQSHIVKLESELLALQRKYYDLKNSAITSDDIPESHSKSPANVNIYQSDIISIPPTDMTI+ ETISDNKADQSHSASN LNSIEKLNIEI EQRLKNQTLGKQLIDKNIE                       DLQKSFSESSSEKNKLKADYNQLIKEHESVKAKYDSLAEEFYVLRNSTEIQDNNETIGILEEQLKKCQEENFHLKVQLDHYRETLEKTENCLQNIQASVDQEENNWKICLKSSEQEQERLEEKIKELLNQIEELRSKQHSDSPTMISMETPPIANGSLSSETKKKRKRKNKKKKNKNRVTQQ
Sbjct:    1 MLFILSIILTFIVILLSAYFIYFYLKPKKEPVTSSKHPVTKPQGEPSVSQPKKSKKQKKLHKGESKVTHDEVSESVNEVQADENLNPETFITPVISVSHENTIPDDILNKNLSEIEYLKTEIKKFESEKQTLSCELEEAQEKIAKYREDTETLTEENKTIKSKLTKFERTKSKTDEQLKKLEISNSESIAKNEEIERNLTQKNSENAELKQKFEIFSQKLHKSEMDLKSQQEKLNFVQCEKDDAIRNREEITRKYNELVEKSSKETSDHVEMYRKYDNEIEKIRSEYKQMKTETVNLNNSLQAKEKEITNLKKDLKNLNVQLTKSKEESHNLTLNLEKVSKDLSSKE---SQVSNENRRLSEYIENLKTEINCAKTDNEVKLQKMSENLMKKDSMLHDLENDKSLLEKEVKRLRKEFENFREINEKHLNNLLESKSKEIENLVKINQELLSQIELTKKEFTEQNTELLREIERLKQDYSVKVEVSNEKSGLLEEITLLKTSCSSQEEKLSKLHEISEELKEKNNDLRVLQDQKMDFLKAIDQLKKEINSRDFSANEKVIELSQT---------------KQLETKLEDLKKSNGEKEVYFQNSKPMVEFEELFKKLEKKNEELVRVQHENRELKAELNHANVYYKRQTDDLNENLERKINELNFQNEFCIEWKDKCENLEKTLQESLNSNRQHLEMTVPIESIIQEIRVEPTESFASSYRTTEEMQSHIVKLESELLALQRKYYDLKNSAITSDDIPESHSKSPANVNIYQSDIISIPPTDMTIEAETISDNKADQSHSASNLLNSIEKLNIEISEQRLKNQTLGKQLIDKNIE-----------------------DLQKSFSESSSEKNKLKADYNQLIKEHESVKAKYDSLAEEFYVLRNSTEIQDNNETIGILEEQLKKCQEENFHLKVQLDHYRETLEKTENCLQNIQASVDQEENNWKICLKSSEQEQERLEEKIKELLNQIEELRSKQHSDSPTMISMETPPIANGSLSSETKKKRKRKNKKKKNKNRVTQQ 998          
BLAST of SMED30020811 vs. Planmine SMEST
Match: SMESG000005612.1 (SMESG000005612.1)

HSP 1 Score: 1743.4 bits (4514), Expect = 0.000e+0
Identity = 967/1039 (93.07%), Postives = 973/1039 (93.65%), Query Frame = 3
Query:   78 MLFILSIILTFIVILLSAYFIYFYLKPKKEPVTSSKHPVTKPQGEASVSQPXXXXXXXXXXXGEIKATHDEVSESVNEVQADENLNPETFITPVISVSQENTIPDDILNKNLSEIEYLKTEIKKFESEKQTLSCELEEAQEKIAKYREDTETLTEENKTIKSKLTKFERTKSKTDEQLKKLEISNSESIAKNEEIERNLTQKNSENAELKQKFEIFSQKLHKSEMDLKSQQEKLNFVQCEKDDAIRNREEITRKYNELVEKSSKETSDHVEMYRKYENEIEKIRSEYKQMKTETVNLNNSLQAKEKEITNLKKDLKNLNVQLTKSKEESHNLTLNLAKVSKDLSSKESQTSQVSKENRRLSEDLENLKTEINCAKTDNEVKLQKMSENLMKKDSMLHDLENDKSLLEKEVKRLRKEFENFRQINEKHLNNLLESKSKEIENLVKINQELLSQIELTKKEFTEQNTELLREIERLKQDYSVKVEVSNEKSGLLEEITLLKTSCSSQEEKLSKLHEISEELKEKNNDLRVLQDQKMDFLKAIDQLKKEINSRDFSANEKVIELSQTVKNNEIVIYELLNEKKQLETKLEDLKKSTGEKEVYFQNSKPMVXXXXXXXXXXXXXXXXXRVQHENRELKAELNHANVYYKRQTDDLNENLERKINELNFQNEFCIEWKDKCEKLEKTLQESLNSNRQQLEMTVPVESIIQEIRVEPTESFASSYRTTEEMQSHIVKLESELLALQRKYYDLKNSAITSDDIPESHSKSPANVNIYQSDIISIPPTDMTIDVETISDNKADQSHSASNFLNSIEKLNIEIFEQRLKNQTLGKQLIDKNIEVNALKQCLYGLDGDLLSIEHLALDLQXXXXXXXXXXNKLKADYNQLIKEHESVKAKYDSLAEEFYVLRNSTEIQDNNETIGILEEQLKKCQEENFHLKVQLDHYRETLEKTENCLQNIQASVDQEENNWKICLKSSEQEQERLEEKIKELLNQIEELRSKQHSDSPTMISMETPPIANGSLSSETXXXXXXXXXXXXXXXXVTQQ 3194
            MLFILSIILTFIVILLSAYFIYFYLKPKKEPVTSSKHPVTKPQGE SVSQPKKSKKQKKLHKGE K THDEVSESVNEVQADENLNPETFITPVISVS ENTIPDDILNKNLSEIEYLKTEIKKFESEKQTLSCELEEAQEKIAKYREDTETLTEENKTIKSKLTKFERTKSKTDEQLKKLEISNSESIAKNEEIERNLTQKNSENAELKQKFEIFSQKLHKSEMDLKSQQEKLNFVQCEKDDAIRNREEITRKYNELVEKSSKETSDHVEMYRKY+NEIEKIRSEYKQMKTETVNLNNSLQAKEKEITNLKKDLKNLNVQLTKSKEESHNLTLNL KVSKDLSSKE   SQVS ENRRLSE +ENLKTEINCAKTDNEVKLQKMSENLMKKDSMLHDLENDKSLLEKEVKRLRKEFENFR+INEKHLNNLLESKSKEIENLVKINQELLSQIELTKKEFTEQNTELLREIERLKQDYSVKVEVSNEKSGLLEEITLLKTSCSSQEEKLSKLHEISEELKEKNNDLRVLQDQKMDFLKAIDQLKKEINSRDFSANEKVIELSQT               KQLETKLEDLKKS GEKEVYFQNSKPMVEFEELFKKLEKKNEEL+RVQHENRELKAELNHANVYYKRQTDDLNENLERKINELNFQNEFCIEWKDKCE LEKTLQESLNSNRQ LEMTVP+ESIIQEIRVEPTESFASSYRTTEEMQSHIVKLESELLALQRKYYDLKNSAITSDDIPESHSKSPANVNIYQSDIISIPPTDMTI+ ETISDNKADQSHSASN LNSIEKLNIEI EQRLKNQ                                   DLQKSFSESSSEKNKLKADYNQLIKEHESVKAKYDSLAEEFYVLRNSTEIQDNNETIGILEEQLKKCQEENFHLKVQLDHYRETLEKTENCLQNIQASVDQEENNWKICLKSSEQEQERLEEKIKELLNQIEELRSKQHSDSPTMISMETPPIANGSLSSETKKKRKRKNKKKKNKNRVTQQ
Sbjct:    1 MLFILSIILTFIVILLSAYFIYFYLKPKKEPVTSSKHPVTKPQGEPSVSQPKKSKKQKKLHKGESKVTHDEVSESVNEVQADENLNPETFITPVISVSHENTIPDDILNKNLSEIEYLKTEIKKFESEKQTLSCELEEAQEKIAKYREDTETLTEENKTIKSKLTKFERTKSKTDEQLKKLEISNSESIAKNEEIERNLTQKNSENAELKQKFEIFSQKLHKSEMDLKSQQEKLNFVQCEKDDAIRNREEITRKYNELVEKSSKETSDHVEMYRKYDNEIEKIRSEYKQMKTETVNLNNSLQAKEKEITNLKKDLKNLNVQLTKSKEESHNLTLNLEKVSKDLSSKE---SQVSNENRRLSEYIENLKTEINCAKTDNEVKLQKMSENLMKKDSMLHDLENDKSLLEKEVKRLRKEFENFREINEKHLNNLLESKSKEIENLVKINQELLSQIELTKKEFTEQNTELLREIERLKQDYSVKVEVSNEKSGLLEEITLLKTSCSSQEEKLSKLHEISEELKEKNNDLRVLQDQKMDFLKAIDQLKKEINSRDFSANEKVIELSQT---------------KQLETKLEDLKKSNGEKEVYFQNSKPMVEFEELFKKLEKKNEELVRVQHENRELKAELNHANVYYKRQTDDLNENLERKINELNFQNEFCIEWKDKCENLEKTLQESLNSNRQHLEMTVPIESIIQEIRVEPTESFASSYRTTEEMQSHIVKLESELLALQRKYYDLKNSAITSDDIPESHSKSPANVNIYQSDIISIPPTDMTIEAETISDNKADQSHSASNLLNSIEKLNIEISEQRLKNQ-----------------------------------DLQKSFSESSSEKNKLKADYNQLIKEHESVKAKYDSLAEEFYVLRNSTEIQDNNETIGILEEQLKKCQEENFHLKVQLDHYRETLEKTENCLQNIQASVDQEENNWKICLKSSEQEQERLEEKIKELLNQIEELRSKQHSDSPTMISMETPPIANGSLSSETKKKRKRKNKKKKNKNRVTQQ 986          
BLAST of SMED30020811 vs. Planmine SMEST
Match: SMESG000005612.1 (SMESG000005612.1)

HSP 1 Score: 1702.95 bits (4409), Expect = 0.000e+0
Identity = 930/1002 (92.81%), Postives = 936/1002 (93.41%), Query Frame = 3
Query:   78 MLFILSIILTFIVILLSAYFIYFYLKPKKEPVTSSKHPVTKPQGEASVSQPXXXXXXXXXXXGEIKATHDEVSESVNEVQADENLNPETFITPVISVSQENTIPDDILNKNLSEIEYLKTEIKKFESEKQTLSCELEEAQEKIAKYREDTETLTEENKTIKSKLTKFERTKSKTDEQLKKLEISNSESIAKNEEIERNLTQKNSENAELKQKFEIFSQKLHKSEMDLKSQQEKLNFVQCEKDDAIRNREEITRKYNELVEKSSKETSDHVEMYRKYENEIEKIRSEYKQMKTETVNLNNSLQAKEKEITNLKKDLKNLNVQLTKSKEESHNLTLNLAKVSKDLSSKESQTSQVSKENRRLSEDLENLKTEINCAKTDNEVKLQKMSENLMKKDSMLHDLENDKSLLEKEVKRLRKEFENFRQINEKHLNNLLESKSKEIENLVKINQELLSQIELTKKEFTEQNTELLREIERLKQDYSVKVEVSNEKSGLLEEITLLKTSCSSQEEKLSKLHEISEELKEKNNDLRVLQDQKMDFLKAIDQLKKEINSRDFSANEKVIELSQTVKNNEIVIYELLNEKKQLETKLEDLKKSTGEKEVYFQNSKPMVXXXXXXXXXXXXXXXXXRVQHENRELKAELNHANVYYKRQTDDLNENLERKINELNFQNEFCIEWKDKCEKLEKTLQESLNSNRQQLEMTVPVESIIQEIRVEPTESFASSYRTTEEMQSHIVKLESELLALQRKYYDLKNSAITSDDIPESHSKSPANVNIYQSDIISIPPTDMTIDVETISDNKADQSHSASNFLNSIEKLNIEIFEQRLKNQTLGKQLIDKNIEVNALKQCLYGLDGDLLSIEHLALDLQXXXXXXXXXXNKLKADYNQLIKEHESVKAKYDSLAEEFYVLRNSTEIQDNNETIGILEEQLKKCQEENFHLKVQLDHYRETLEKTENCLQNIQASVDQEENNWKICLKSSEQEQERLEEKIKELLNQIEELRSKQHSDSPTM 3083
            MLFILSIILTFIVILLSAYFIYFYLKPKKEPVTSSKHPVTKPQGE SVSQPKKSKKQKKLHKGE K THDEVSESVNEVQADENLNPETFITPVISVS ENTIPDDILNKNLSEIEYLKTEIKKFESEKQTLSCELEEAQEKIAKYREDTETLTEENKTIKSKLTKFERTKSKTDEQLKKLEISNSESIAKNEEIERNLTQKNSENAELKQKFEIFSQKLHKSEMDLKSQQEKLNFVQCEKDDAIRNREEITRKYNELVEKSSKETSDHVEMYRKY+NEIEKIRSEYKQMKTETVNLNNSLQAKEKEITNLKKDLKNLNVQLTKSKEESHNLTLNL KVSKDLSSKE   SQVS ENRRLSE +ENLKTEINCAKTDNEVKLQKMSENLMKKDSMLHDLENDKSLLEKEVKRLRKEFENFR+INEKHLNNLLESKSKEIENLVKINQELLSQIELTKKEFTEQNTELLREIERLKQDYSVKVEVSNEKSGLLEEITLLKTSCSSQEEKLSKLHEISEELKEKNNDLRVLQDQKMDFLKAIDQLKKEINSRDFSANEKVIELSQT               KQLETKLEDLKKS GEKEVYFQNSKPMVEFEELFKKLEKKNEEL+RVQHENRELKAELNHANVYYKRQTDDLNENLERKINELNFQNEFCIEWKDKCE LEKTLQESLNSNRQ LEMTVP+ESIIQEIRVEPTESFASSYRTTEEMQSHIVKLESELLALQRKYYDLKNSAITSDDIPESHSKSPANVNIYQSDIISIPPTDMTI+ ETISDNKADQSHSASN LNSIEKLNIEI EQRLKNQ                                   DLQKSFSESSSEKNKLKADYNQLIKEHESVKAKYDSLAEEFYVLRNSTEIQDNNETIGILEEQLKKCQEENFHLKVQLDHYRETLEKTENCLQNIQASVDQEENNWKICLKSSEQEQERLEEKIKELLNQIEELRSKQHSDSPTM
Sbjct:    1 MLFILSIILTFIVILLSAYFIYFYLKPKKEPVTSSKHPVTKPQGEPSVSQPKKSKKQKKLHKGESKVTHDEVSESVNEVQADENLNPETFITPVISVSHENTIPDDILNKNLSEIEYLKTEIKKFESEKQTLSCELEEAQEKIAKYREDTETLTEENKTIKSKLTKFERTKSKTDEQLKKLEISNSESIAKNEEIERNLTQKNSENAELKQKFEIFSQKLHKSEMDLKSQQEKLNFVQCEKDDAIRNREEITRKYNELVEKSSKETSDHVEMYRKYDNEIEKIRSEYKQMKTETVNLNNSLQAKEKEITNLKKDLKNLNVQLTKSKEESHNLTLNLEKVSKDLSSKE---SQVSNENRRLSEYIENLKTEINCAKTDNEVKLQKMSENLMKKDSMLHDLENDKSLLEKEVKRLRKEFENFREINEKHLNNLLESKSKEIENLVKINQELLSQIELTKKEFTEQNTELLREIERLKQDYSVKVEVSNEKSGLLEEITLLKTSCSSQEEKLSKLHEISEELKEKNNDLRVLQDQKMDFLKAIDQLKKEINSRDFSANEKVIELSQT---------------KQLETKLEDLKKSNGEKEVYFQNSKPMVEFEELFKKLEKKNEELVRVQHENRELKAELNHANVYYKRQTDDLNENLERKINELNFQNEFCIEWKDKCENLEKTLQESLNSNRQHLEMTVPIESIIQEIRVEPTESFASSYRTTEEMQSHIVKLESELLALQRKYYDLKNSAITSDDIPESHSKSPANVNIYQSDIISIPPTDMTIEAETISDNKADQSHSASNLLNSIEKLNIEISEQRLKNQ-----------------------------------DLQKSFSESSSEKNKLKADYNQLIKEHESVKAKYDSLAEEFYVLRNSTEIQDNNETIGILEEQLKKCQEENFHLKVQLDHYRETLEKTENCLQNIQASVDQEENNWKICLKSSEQEQERLEEKIKELLNQIEELRSKQHSDSPTM 949          
BLAST of SMED30020811 vs. Planmine SMEST
Match: SMESG000005613.1 (SMESG000005613.1)

HSP 1 Score: 83.5741 bits (205), Expect = 5.785e-16
Identity = 157/574 (27.35%), Postives = 271/574 (47.21%), Query Frame = 3
Query: 1473 ELLREIERLKQD-YSVKVEVSNEKSGLLEEITLLKTSCSSQEEKLS-----KLHEISEELKEKNNDLRVLQDQKMDFLKAIDQLKKEINSRDFSANEKVIELSQTVKNNEIVIYELLNEKKQLETKLEDLKKSTGEKEVYFQNSKPMVXXXXXXXXXXXXXXXXXRVQHENRELK--------AELNHANVYYKRQTDDLN----ENLERKINELNFQNEFCIEWKDKCEKLEKTLQESLNSNRQQLEMTVPVESIIQEIRVEPTESFASSYR-----------TTE---EMQSHIVKLE---------SELLALQRKYYDLKNSA--ITSDDIPESHSKSPANVNIYQSDIISIPPTDMTIDVETISDNKADQSHSASNFLNSIEKLNIEIFEQRLKNQTLGKQLIDKNIEVNALKQCLYGLDGDLLSIEHLALDLQXXXXXXXXXXNKLKADYNQLIKEHESVKAKYDSLAEEFYVLRNSTEIQDNNETIGILEEQLKKCQEENFHLKVQLDHYRETLEKTENCLQNIQASVDQEENNWKICLKSSEQEQERLEEKIKELLNQIEEL-RSKQ 3062
            ELL+EI++L+ +    +V  +++   LL+E    K + +   EK +      L+EI +EL+ KN ++ VLQD K   +  IDQLK+E+ ++D     K+ E     KN+EI+  EL  +K +L   +E L K   E  +Y ++     +   L + ++K   E+ R ++E   LK        +EL+   V  +   D +     E  E    E +F N+  +E   + +   KTL + +    ++L +   +E +  E+R E  E +  S+            TTE   E++  I+K E          ELL LQ KY++LK S      D++  SH  +P++V  + S + S             S+  + +  S S FL+SIEKLN+EI EQR KNQ L            +++Q L                           K+ L+  ++QL+++ + + +KY+ + E      +   I +++     L E+L K +EEN  L  +L+  +E L++++   +NI+    +E  +W   LK  +++    E+KIKELLNQ+  L R++Q
Sbjct:  325 ELLKEIQQLRNEKLESEVTTTDQTEILLKEFMPPKQTSTVVHEKATDVSDGTLNEIFQELEGKNREISVLQDHKSSLIHEIDQLKRELLNKDSEVEMKLKE-----KNSEII--ELERQKIELGLNVEYLTKEMSECVIYRKDGDANEKLVTLLENIDKLRREMHR-KYEKFTLKLKEKETIISELHSIQVSLESNIDQMTRRVKETTEISDQESDFGNKL-VELHKEIDT--KTL-DIITLRNEKLALLTDIERLQDELR-ESRELYVDSFEQMTRTVVLKDFTTEDEIEIKEQIIKPEIAPQSMAFSRELLELQSKYFNLKISLQEKIDDNVLVSHELTPSSVETFASHLKSFCD----------SNEISSKLSSTSKFLDSIEKLNVEIAEQRNKNQELR----------TSIQQSLLS-------------------------KSPLQGTFHQLLQDQDIINSKYEEIWE-----ASKCTISEHDYENSRLREELTKFKEENEKLSNRLNISQEVLKQSDIHFENIKECYLKENESWDRRLKILQEQGIINEDKIKELLNQLSVLERNRQ 835          
The following BLAST results are available for this feature:
BLAST of SMED30020811 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
LAMA28.702e-1121.51laminin subunit alpha 2 [Source:HGNC Symbol;Acc:HG... [more]
LAMA21.532e-1021.31laminin subunit alpha 2 [Source:HGNC Symbol;Acc:HG... [more]
LAMA21.957e-921.51laminin subunit alpha 2 [Source:HGNC Symbol;Acc:HG... [more]
KTN18.199e-636.59kinectin 1 [Source:HGNC Symbol;Acc:HGNC:6467][more]
back to top
BLAST of SMED30020811 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lam-32.617e-821.08LAMinin related. See also lmb; Laminin alpha chain... [more]
back to top
BLAST of SMED30020811 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020811 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lama52.574e-618.18laminin, alpha 5 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
back to top
BLAST of SMED30020811 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdcp1.222e-719.68WD repeat and coiled coil containing [Source:Xenba... [more]
wdcp1.609e-720.55WD repeat and coiled coil containing [Source:Xenba... [more]
wdcp4.960e-720.00WD repeat and coiled coil containing [Source:Xenba... [more]
wdcp2.700e-620.32WD repeat and coiled coil containing [Source:Xenba... [more]
wdcp4.858e-619.49WD repeat and coiled coil containing [Source:Xenba... [more]
back to top
BLAST of SMED30020811 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Lama22.891e-621.64laminin, alpha 2 [Source:MGI Symbol;Acc:MGI:99912][more]
back to top
BLAST of SMED30020811 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|P24043|LAMA2_HUMAN7.355e-1021.31Laminin subunit alpha-2 OS=Homo sapiens OX=9606 GN... [more]
sp|Q90631|KTN1_CHICK8.156e-628.44Kinectin OS=Gallus gallus OX=9031 GN=KTN1 PE=1 SV=... [more]
back to top
BLAST of SMED30020811 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020811 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
lama54.905e-819.35laminin, alpha 5 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
rrbp1b1.209e-635.56ribosome-binding protein 1 [Source:NCBI gene;Acc:1... [more]
rrbp1b1.217e-635.56ribosome-binding protein 1 [Source:NCBI gene;Acc:1... [more]
rrbp1b1.287e-635.56ribosome-binding protein 1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of SMED30020811 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020811 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020811 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020811 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020811 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005612.10.000e+096.44SMESG000005612.1[more]
SMESG000005612.10.000e+094.23SMESG000005612.1[more]
SMESG000005612.10.000e+093.07SMESG000005612.1[more]
SMESG000005612.10.000e+092.81SMESG000005612.1[more]
SMESG000005613.15.785e-1627.35SMESG000005613.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020811 ID=SMED30020811|Name=SMED30020811|organism=Schmidtea mediterranea sexual|type=transcript|length=3284bp
TTTAAATAAATAAGAACGTCATATTTTAATTTTGTCAATCCTGAATTCAG
TTATCAAATTAATTTGAAATTTATTTAATGTTATTTATCCTTTCAATAAT
TTTAACATTCATTGTTATACTTCTATCCGCATATTTCATTTATTTTTATT
TGAAACCTAAAAAAGAACCAGTAACCTCAAGTAAACACCCAGTCACCAAG
CCTCAAGGAGAAGCAAGTGTTTCTCAACCTAAAAAGAGCAAGAAGCAAAA
GAAACTACATAAAGGTGAAATTAAAGCAACACACGATGAAGTTTCTGAGT
CTGTTAATGAAGTACAAGCCGATGAAAATTTAAATCCTGAAACATTCATT
ACCCCTGTTATTTCTGTTTCACAAGAAAATACAATTCCAGATGATATTTT
GAATAAAAATTTGTCAGAAATTGAATACCTTAAAACAGAAATTAAAAAAT
TTGAAAGCGAAAAGCAAACGCTAAGTTGTGAGCTAGAAGAAGCTCAAGAA
AAAATCGCCAAATATAGAGAGGATACTGAAACACTTACTGAAGAAAATAA
AACTATAAAATCTAAATTAACAAAATTCGAACGTACAAAGAGCAAGACTG
ATGAGCAGTTAAAAAAGTTAGAAATTTCTAACTCAGAGTCAATAGCTAAA
AATGAAGAAATAGAAAGAAATTTAACTCAAAAAAATTCCGAAAATGCAGA
ATTGAAACAAAAGTTTGAAATATTTTCACAAAAACTCCATAAATCAGAAA
TGGATTTGAAATCACAACAAGAAAAATTGAATTTTGTTCAATGCGAAAAG
GACGATGCTATTAGAAACCGCGAAGAAATTACTAGAAAATACAATGAATT
AGTTGAAAAAAGCAGTAAAGAAACTTCAGATCACGTTGAAATGTATAGAA
AATATGAAAATGAAATTGAGAAAATCCGTAGTGAATATAAACAGATGAAA
ACCGAAACAGTAAATTTGAATAATTCATTGCAAGCGAAAGAAAAAGAAAT
CACTAATTTAAAAAAAGATCTGAAAAATTTAAATGTTCAATTAACCAAAA
GTAAGGAAGAAAGTCACAATCTCACTTTGAATTTAGCAAAAGTTTCAAAA
GATTTGAGCTCAAAAGAATCTCAAACATCTCAAGTCTCTAAAGAAAACAG
GCGTTTATCAGAAGATCTCGAGAATTTGAAAACCGAAATAAATTGTGCGA
AAACGGACAATGAAGTGAAATTACAAAAGATGTCGGAAAATTTAATGAAA
AAGGATTCCATGCTTCATGATCTTGAAAACGATAAGAGTTTATTGGAAAA
AGAAGTCAAAAGATTAAGAAAAGAATTCGAAAATTTCAGACAAATCAATG
AAAAACATTTGAATAATCTATTAGAATCGAAAAGCAAGGAGATAGAAAAT
TTAGTAAAAATTAATCAAGAATTACTCAGTCAAATAGAACTTACAAAGAA
AGAATTTACAGAACAGAATACCGAATTACTGAGAGAAATCGAACGTTTGA
AACAAGATTATAGTGTTAAAGTTGAAGTTTCCAATGAAAAATCTGGCCTC
CTGGAAGAGATCACTCTTTTGAAAACATCTTGTTCAAGCCAAGAAGAAAA
GTTAAGTAAACTTCATGAAATATCCGAAGAATTGAAAGAGAAAAATAATG
ATTTACGAGTTTTACAAGATCAAAAAATGGATTTTTTGAAAGCAATTGAT
CAATTAAAAAAAGAAATCAATTCTAGAGATTTCTCAGCCAATGAAAAAGT
TATAGAGTTATCCCAAACTGTAAAAAACAACGAAATCGTTATTTATGAAC
TGTTAAATGAAAAGAAACAATTGGAAACAAAATTAGAAGATTTGAAAAAG
TCAACTGGTGAAAAGGAAGTTTATTTCCAGAATTCCAAACCAATGGTCGA
GTTTGAAGAACTTTTCAAAAAGCTGGAAAAGAAAAATGAAGAGCTTTTGA
GAGTTCAACACGAAAATCGGGAATTGAAAGCCGAGTTAAACCATGCCAAT
GTATATTATAAACGCCAAACTGATGATTTAAATGAAAATCTTGAGAGGAA
AATCAACGAATTGAATTTTCAAAATGAGTTTTGTATAGAGTGGAAAGATA
AATGTGAAAAGCTGGAAAAAACGTTACAAGAATCACTCAATTCAAATCGT
CAGCAATTGGAAATGACTGTCCCAGTTGAGAGCATTATTCAAGAAATCCG
TGTTGAACCAACCGAATCTTTTGCCAGTTCTTATCGCACTACTGAAGAAA
TGCAATCACACATTGTCAAACTTGAGTCGGAATTGTTAGCTCTTCAACGC
AAGTATTACGATTTGAAAAATTCTGCCATTACAAGTGATGATATTCCTGA
ATCCCATTCTAAAAGCCCAGCAAATGTTAATATTTACCAATCAGATATCA
TCAGTATTCCACCGACGGACATGACAATTGATGTGGAAACTATTTCCGAT
AATAAGGCTGATCAATCTCATTCTGCCAGCAACTTCCTTAATTCCATTGA
AAAGTTGAATATTGAAATTTTTGAGCAGCGATTGAAAAATCAAACCTTAG
GCAAACAGTTGATTGACAAAAATATTGAAGTAAATGCCTTAAAGCAATGC
TTATATGGATTAGACGGTGATCTGCTTTCTATTGAACATTTGGCGCTTGA
TCTACAGAAATCATTTTCTGAATCGTCATCAGAGAAAAATAAACTAAAAG
CCGACTATAATCAATTGATAAAAGAACATGAATCGGTCAAGGCAAAATAT
GACTCGTTGGCTGAGGAATTTTATGTGTTGAGAAATTCGACAGAAATTCA
GGACAATAATGAAACGATCGGAATATTGGAAGAGCAATTAAAAAAATGCC
AAGAAGAAAATTTTCATTTGAAAGTTCAATTGGATCACTATAGAGAAACT
CTCGAAAAAACAGAAAACTGCCTACAAAATATTCAGGCATCTGTTGATCA
AGAAGAAAATAACTGGAAGATTTGTTTAAAATCATCCGAGCAGGAACAAG
AACGACTCGAAGAAAAAATCAAAGAACTTCTTAATCAAATCGAGGAATTG
AGAAGCAAACAGCATTCAGACTCACCAACAATGATCTCTATGGAAACCCC
ACCCATTGCAAACGGGTCACTATCTTCTGAAACGAAAAAGAAAAGAAAGC
GTAAAAACAAAAAGAAGAAGAATAAAAATCGAGTAACACAGCAGTAGACA
GAACTAGTTTTTTATTAAAAAAAATTAATATTATTCCAATTTATGTGTTA
TTATTATTATTTATTATTAATAGCCATGACTAGA
back to top

protein sequence of SMED30020811-orf-1

>SMED30020811-orf-1 ID=SMED30020811-orf-1|Name=SMED30020811-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1040bp
MLFILSIILTFIVILLSAYFIYFYLKPKKEPVTSSKHPVTKPQGEASVSQ
PKKSKKQKKLHKGEIKATHDEVSESVNEVQADENLNPETFITPVISVSQE
NTIPDDILNKNLSEIEYLKTEIKKFESEKQTLSCELEEAQEKIAKYREDT
ETLTEENKTIKSKLTKFERTKSKTDEQLKKLEISNSESIAKNEEIERNLT
QKNSENAELKQKFEIFSQKLHKSEMDLKSQQEKLNFVQCEKDDAIRNREE
ITRKYNELVEKSSKETSDHVEMYRKYENEIEKIRSEYKQMKTETVNLNNS
LQAKEKEITNLKKDLKNLNVQLTKSKEESHNLTLNLAKVSKDLSSKESQT
SQVSKENRRLSEDLENLKTEINCAKTDNEVKLQKMSENLMKKDSMLHDLE
NDKSLLEKEVKRLRKEFENFRQINEKHLNNLLESKSKEIENLVKINQELL
SQIELTKKEFTEQNTELLREIERLKQDYSVKVEVSNEKSGLLEEITLLKT
SCSSQEEKLSKLHEISEELKEKNNDLRVLQDQKMDFLKAIDQLKKEINSR
DFSANEKVIELSQTVKNNEIVIYELLNEKKQLETKLEDLKKSTGEKEVYF
QNSKPMVEFEELFKKLEKKNEELLRVQHENRELKAELNHANVYYKRQTDD
LNENLERKINELNFQNEFCIEWKDKCEKLEKTLQESLNSNRQQLEMTVPV
ESIIQEIRVEPTESFASSYRTTEEMQSHIVKLESELLALQRKYYDLKNSA
ITSDDIPESHSKSPANVNIYQSDIISIPPTDMTIDVETISDNKADQSHSA
SNFLNSIEKLNIEIFEQRLKNQTLGKQLIDKNIEVNALKQCLYGLDGDLL
SIEHLALDLQKSFSESSSEKNKLKADYNQLIKEHESVKAKYDSLAEEFYV
LRNSTEIQDNNETIGILEEQLKKCQEENFHLKVQLDHYRETLEKTENCLQ
NIQASVDQEENNWKICLKSSEQEQERLEEKIKELLNQIEELRSKQHSDSP
TMISMETPPIANGSLSSETKKKRKRKNKKKKNKNRVTQQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0002032epidermal cell
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated