TUBE1

Overview
NameTUBE1 (AFB74725.1)
Smed IDSMED30020804
Length (bp)1526
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TUBE1 (SMED30020804) t-SNE clustered cells

Violin plots show distribution of expression levels for TUBE1 (SMED30020804) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TUBE1 (SMED30020804) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TUBE1 (SMED30020804) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020804

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30020804SMESG000038050.1 SMESG000015155.1 dd_Smed_v4_11274_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30020804SMESG000038050.1 SMESG000015155.1 dd_Smed_v6_11274_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TUBE1 vs. Ensembl Human
Match: TUBE1 (tubulin epsilon 1 [Source:HGNC Symbol;Acc:HGNC:20775])

HSP 1 Score: 468.774 bits (1205), Expect = 8.268e-162
Identity = 242/424 (57.08%), Postives = 314/424 (74.06%), Query Frame = 2
Query:   53 ITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFF----VXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRM----------------VKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKVN 1264
            + +Q+GQCGNQIG  FWDLAL+EH+ V + G YD ++S+FF            SI KG+I  LKARAVLIDMEEGVV+EI++  ++++FD KQLITD+SGSGNNWA G+  +G  Y +QI E  RKSAE CDCLQCFFI+HSMGGGTGSGLGT + ++L DE+PEVYRFV +++PS +DDVITSPYNS+L + +L E ADCV+PI+N SL  +                VK  +  + S  +   + +KPFDAMN+IVANLLLNLTSS+RFEG+LN+DLNEISMNLVPFP+LHYL+++  PLY+L     P   PRR+DQ+F+D+F+KD Q++  +PK   YLACAL+VRGNV+ISD+RRNIER + +L+FV WN+EGWK   CSV P G  +SLL L+NNT +  TF EL  +F +LYK+K +
Sbjct:    5 VVVQVGQCGNQIGCCFWDLALREHAAVNQKGIYDEAISSFFRNVDTRVVGDGGSISKGKICSLKARAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFRKSAEHCDCLQCFFIIHSMGGGTGSGLGTFLLKVLEDEFPEVYRFVTSIYPSGEDDVITSPYNSILAMKELNEHADCVLPIDNQSLFDIISKIDLMVNSGKLGTTVKPKSLVTSSSGALKKQHKKPFDAMNNIVANLLLNLTSSARFEGSLNMDLNEISMNLVPFPQLHYLVSSLTPLYTLTDVNIP---PRRLDQMFSDAFSKDHQLLRADPKHSLYLACALMVRGNVQISDLRRNIERLKPSLQFVSWNQEGWKTSLCSVPPVGHSHSLLALANNTCVKPTFMELKERFMRLYKKKAH 425          
BLAST of TUBE1 vs. Ensembl Human
Match: TUBE1 (tubulin epsilon 1 [Source:HGNC Symbol;Acc:HGNC:20775])

HSP 1 Score: 242.276 bits (617), Expect = 6.398e-77
Identity = 128/211 (60.66%), Postives = 165/211 (78.20%), Query Frame = 2
Query:   53 ITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFF----VXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLI 673
            + +Q+GQCGNQIG  FWDLAL+EH+ V + G YD ++S+FF            SI KG+I  LKARAVLIDMEEGVV+EI++  ++++FD KQLITD+SGSGNNWA G+  +G  Y +QI E  RKSAE CDCLQCFFI+HSMGGGTGSGLGT + ++L DE+PEVYRFV +++PS +DDVITSPYNS+L + +L E ADCV+PI+N ++I
Sbjct:    5 VVVQVGQCGNQIGCCFWDLALREHAAVNQKGIYDEAISSFFRNVDTRVVGDGGSISKGKICSLKARAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFRKSAEHCDCLQCFFIIHSMGGGTGSGLGTFLLKVLEDEFPEVYRFVTSIYPSGEDDVITSPYNSILAMKELNEHADCVLPIDNQNII 215          
BLAST of TUBE1 vs. Ensembl Human
Match: TUBB1 (tubulin beta 1 class VI [Source:HGNC Symbol;Acc:HGNC:16257])

HSP 1 Score: 192.971 bits (489), Expect = 3.009e-55
Identity = 138/418 (33.01%), Postives = 219/418 (52.39%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVN--AVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSL----IRMVK-TFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNI--ERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+++ +Q+GQCGNQIG++FW++  +EH  +   G  D   S           S+Y  +  G K   RAVL+D+E G +  I  S +  LF     +   SG+GNNWA G+   G +  E + E +R  +E CDCLQ F I+HS+GGGTGSG+GT +   + +EYP+  R +N  +V PS    D +  PYN+VL +++L E AD    I+N +L     R +K T   Y D               +N +V+  +  +T+S RF G LN DL ++++N+VPFP+LH+ +   APL +  S+    ++   + ++    F     M   + +   YL  A + RG +   ++ + +   + RN+  FV W     KV  C + PRG   +   + NNT+I   F+ +   F+ ++KRK 
Sbjct:    2 REIVHIQIGQCGNQIGAKFWEMIGEEHG-IDLAGS-DRGASAL----QLERISVYYNEAYGRKYVPRAVLVDLEPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVLEVVRHESESCDCLQGFQIVHSLGGGTGSGMGTLLMNKIREEYPD--RIMNSFSVMPSPKVSDTVVEPYNAVLSIHQLIENADACFCIDNEALYDICFRTLKLTTPTYGD---------------LNHLVSLTMSGITTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAQGSQQ---YRALSVAELTQQMFDARNTMAACDLRRGRYLTVACIFRGKMSTKEVDQQLLSVQTRNSSCFVEWIPNNVKVAVCDIPPRGLSMAATFIGNNTAIQEIFNRVSEHFSAMFKRKA 393          
BLAST of TUBE1 vs. Ensembl Human
Match: TUBB8 (tubulin beta 8 class VIII [Source:HGNC Symbol;Acc:HGNC:20773])

HSP 1 Score: 189.119 bits (479), Expect = 8.243e-54
Identity = 127/414 (30.68%), Postives = 210/414 (50.72%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVN--AVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRR---NIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+++  Q+GQCGNQIG++FW++   EH+ +   G Y                ++Y  + SG +   RAVL+D+E G +  +       +F     I    G+GNNWA G+   G +  E + + +RK AE CDCLQ F + HS+GGGTGSG+GT +   + +EYP+  R +N  ++ PS    D +  PYN+ L +++L E AD    I+N +L  +     K               +  +N +V+  +  +T+  RF G LN DL ++++N+VPFP+LH+ +   APL S  S+    ++   + ++    F     M   +P+   YL  A + RG + + ++     NI+  +N+  F  W     K   C + PRG + S   + NNT+I   F  +  +F  +++RK 
Sbjct:    2 REIVLTQIGQCGNQIGAKFWEVISDEHA-IDSAGTYHGDSH-----LQLERINVYYNEASGGRYVPRAVLVDLEPGTMDSVRSGPFGQVFRPDNFIFGQCGAGNNWAKGHYTEGAELMESVMDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLLSKIREEYPD--RIINTFSILPSPKVSDTVVEPYNATLSVHQLIENADETFCIDNEALYDICSKTLKLPTPT----------YGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ---YRALTVAELTQQMFDAKNMMAACDPRHGRYLTAAAIFRGRMPMREVDEQMFNIQD-KNSSYFADWLPNNVKTAVCDIPPRGLKMSATFIGNNTAIQELFKRVSEQFTAMFRRKA 393          
BLAST of TUBE1 vs. Ensembl Human
Match: TUBB4B (tubulin beta 4B class IVb [Source:HGNC Symbol;Acc:HGNC:20771])

HSP 1 Score: 187.963 bits (476), Expect = 2.328e-53
Identity = 127/416 (30.53%), Postives = 209/416 (50.24%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSL----IRMVK-TFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNI--ERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+++ LQ GQCGNQIG++FW++   EH  +   G Y                ++Y  + +G K   RAVL+D+E G +  +       +F     +   SG+GNNWA G+   G +  + + + +RK AE CDCLQ F + HS+GGGTGSG+GT +   + +EYP+      +V PS    D +  PYN+ L +++L E  D    I+N +L     R +K T   Y D               +N +V+  +  +T+  RF G LN DL ++++N+VPFP+LH+ +   APL S  S+    ++   + ++    F     M   +P+   YL  A + RG + + ++   +   + +N+  FV W     K   C + PRG + S   + N+T+I   F  +  +F  +++RK 
Sbjct:    2 REIVHLQAGQCGNQIGAKFWEVISDEHG-IDPTGTYHGDSD-----LQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGD---------------LNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ---YRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKA 393          
BLAST of TUBE1 vs. Ensembl Celegans
Match: ben-1 (Tubulin beta chain [Source:UniProtKB/TrEMBL;Acc:Q18817])

HSP 1 Score: 188.734 bits (478), Expect = 4.160e-54
Identity = 126/412 (30.58%), Postives = 210/412 (50.97%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNV---EISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+++ +Q GQCGNQIG++FW++   EH  ++ +G Y                ++Y  + +G K   RAVL+D+E G +  +       LF     +   SG+GNNWA G+   G +  + + + +RK AE CDCLQ F + HS+GGGTGSG+GT +   + +EYP+      +V PS    D +  PYN+ L +++L E  D    I+N +L  +     K S+            +  +N +V+  +  +T+  RF G LN DL ++++N+VPFP+LH+ +   AP   L +K    ++   + ++    F     M   +P+   YL  A + RG +   E+ D   N++  +N+  FV W     K   C + PRG + S   + N+T+I   F  +  +F  +++RK 
Sbjct:    2 REIVHVQAGQCGNQIGAKFWEVISDEHG-IQPDGTYKGESD-----LQLERINVYYNEANGGKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDNVLDVVRKEAEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMSSFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLSNPT----------YGDLNHLVSVTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAP---LSAKGAQAYRALTVAELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMREVDDQMMNVQN-KNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKA 393          
BLAST of TUBE1 vs. Ensembl Celegans
Match: tbb-4 (Tubulin beta-4 chain [Source:UniProtKB/Swiss-Prot;Acc:P41937])

HSP 1 Score: 187.963 bits (476), Expect = 8.248e-54
Identity = 126/416 (30.29%), Postives = 209/416 (50.24%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSL----IRMVK-TFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNI--ERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+++ +Q GQCGNQIG++FW++   EH  +   G Y+               ++Y  + SG K   RA L+D+E G +  +       LF     +   SG+GNNWA G+   G +  + + + +RK AE CDCLQ F + HS+GGGTGSG+GT +   + +EYP+      +V PS    D +  PYN+ L +++L E  D    I+N +L     R +K T   Y D               +N +V+  +  +T+  RF G LN DL ++++N+VPFP+LH+ +   APL S  S+    ++   + ++    F     M   +P+   YL  A + RG + + ++   +   + +N+  FV W     K   C + PRG + +   + N+T+I   F  +  +F  +++RK 
Sbjct:    2 REIVHIQAGQCGNQIGAKFWEVISDEHG-IDPTGAYNGDSD-----LQLERINVYYNEASGGKYVPRACLVDLEPGTMDSVRAGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDNVLDVVRKEAESCDCLQGFQMTHSLGGGTGSGMGTLLISKIREEYPDRIMMTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLTTPTYGD---------------LNHLVSMTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ---YRSLTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGVKMAATFVGNSTAIQELFKRISEQFTAMFRRKA 393          
BLAST of TUBE1 vs. Ensembl Celegans
Match: mec-7 (Tubulin beta-1 chain [Source:UniProtKB/Swiss-Prot;Acc:P12456])

HSP 1 Score: 184.111 bits (466), Expect = 1.835e-52
Identity = 129/419 (30.79%), Postives = 212/419 (50.60%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEY--DNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSL----IRMVK-TFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRR---NIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+++ +Q GQCGNQIGS+FW++   EH  +  +G+Y  D+ +            ++Y  +    K   RAVL+D+E G +  +       LF     +   SG+GNNWA G+   G +  + + + +RK AE  DCLQ F + HS+GGGTGSG+GT +   + +EYP+      +V PS    D +  PYN+ L +++L E  D    I+N +L     R +K T   Y D               +N +V+  +  +T+  RF G LN DL ++++N+VPFP+LH+ +   AP   L S+ N  ++   + ++    F     M   +P+   YL  A + RG + + ++     NI+  +N+  FV W     K   C + PRG + S   + N+T+I   F  +  +F  +++RK 
Sbjct:    2 REIVHIQAGQCGNQIGSKFWEVISDEHG-IDPSGQYVGDSDLQ-------LERINVYYNEAGSNKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNYVFGQSGAGNNWAKGHYTEGAELVDNVLDVVRKEAESTDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDSTFCIDNEALYDICFRTLKLTTPTYGD---------------LNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAP---LTSRSNQQYRAITVPELTQQCFDAKNMMAACDPRHGRYLTAAAIFRGRMSMKEVDEQMLNIQN-KNSSYFVDWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKA 393          
BLAST of TUBE1 vs. Ensembl Celegans
Match: tbb-2 (Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P52275])

HSP 1 Score: 182.185 bits (461), Expect = 1.202e-51
Identity = 121/411 (29.44%), Postives = 208/411 (50.61%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNI--ERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+++ +Q GQCGNQIGS+FW++   EH  ++ +G +         +       +Y  + +  K   RAVL+D+E G +  +       LF     +   SG+GNNWA G+   G +  + + + IRK AE CDCLQ F + HS+GGGTGSG+GT +   + +EYP+      +V PS    D +  PYN+ L +++L E  D    I+N +L  +     K ++            +  +N +V+  +  +T+  RF G LN DL ++++N+VPFP+LH+ +   AP   L +K    ++   + ++    F     M   +P+   YL  A + RG + + ++   +   + +N+  FV W     K   C + PRG + +   + N+T+I   F  +  +F  +++RK 
Sbjct:    2 REIVHVQAGQCGNQIGSKFWEVISDEHG-IQPDGTFKGE-----TDLQLERIDVYYNEANNGKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDNVLDVIRKEAEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMSSFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICYRTLKLTNPT----------YGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAP---LSAKGTQAYRALTVAELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMREVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFVGNSTAIQELFKRISEQFTAMFRRKA 393          
BLAST of TUBE1 vs. Ensembl Celegans
Match: tbb-2 (Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P52275])

HSP 1 Score: 182.185 bits (461), Expect = 1.202e-51
Identity = 121/411 (29.44%), Postives = 208/411 (50.61%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNI--ERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+++ +Q GQCGNQIGS+FW++   EH  ++ +G +         +       +Y  + +  K   RAVL+D+E G +  +       LF     +   SG+GNNWA G+   G +  + + + IRK AE CDCLQ F + HS+GGGTGSG+GT +   + +EYP+      +V PS    D +  PYN+ L +++L E  D    I+N +L  +     K ++            +  +N +V+  +  +T+  RF G LN DL ++++N+VPFP+LH+ +   AP   L +K    ++   + ++    F     M   +P+   YL  A + RG + + ++   +   + +N+  FV W     K   C + PRG + +   + N+T+I   F  +  +F  +++RK 
Sbjct:    2 REIVHVQAGQCGNQIGSKFWEVISDEHG-IQPDGTFKGE-----TDLQLERIDVYYNEANNGKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDNVLDVIRKEAEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMSSFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICYRTLKLTNPT----------YGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAP---LSAKGTQAYRALTVAELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMREVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFVGNSTAIQELFKRISEQFTAMFRRKA 393          
BLAST of TUBE1 vs. Ensembl Fly
Match: betaTub97EF (gene:FBgn0003890 transcript:FBtr0300611)

HSP 1 Score: 193.741 bits (491), Expect = 8.658e-56
Identity = 133/413 (32.20%), Postives = 216/413 (52.30%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVN--AVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIE--RYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+++ LQ GQCGNQIGS+FW++   EH  +  NG Y    +       +    +Y  + S  K   RAVLID+E G +  + +S +  LF     +   SG+GNNWA G+   G +  + + E +RK +E CDCLQ F + HS+GGGTGSGLGT +   + +EYP+  R +N  +V PS    D +  PYN+ L +++L E  D    I+N +L  +   F     S  +  D        +N +V+  +  +T+  RF G LN DL ++++N+VPFP+LH+ +   APL +  S+    ++   + ++    F     M   +P+   YL  A + RG + + ++   +   + +N+  FV W     KV  C + PRG + S   + N+T+I   F  +  +F  +++RK 
Sbjct:    2 REIVHLQAGQCGNQIGSKFWEIISDEHG-IDPNGYYHGESA-----LQHERIDVYYNEASSGKYVPRAVLIDLEPGTMDSVRQSPVGQLFRPDNFVYGQSGAGNNWAKGHYTEGAELIDSVLEVLRKESEGCDCLQGFQLAHSLGGGTGSGLGTLLISKIREEYPD--RIMNSFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETFCIDNEALYDIC--FRTLKLSSPTYGD--------LNHLVSVTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAKGSQQ---YRALTVAELTQQMFDAKNMMTACDPRHGRYLTVACIFRGPMSMKEVDTQMYNVQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSATFIGNSTAIQEIFKRISEQFTAMFRRKA 393          
BLAST of TUBE1 vs. Ensembl Fly
Match: betaTub97EF (gene:FBgn0003890 transcript:FBtr0334906)

HSP 1 Score: 189.889 bits (481), Expect = 2.496e-54
Identity = 132/413 (31.96%), Postives = 216/413 (52.30%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVN--AVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIE--RYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+++ LQ GQCGNQIGS+FW++   EH  +  NG Y    +       +    +Y  + S  K   RAVLID+E G +  + +S +  LF     +   SG+GNNWA G+   G +  + + E +RK +E CDCLQ F + HS+GGGTGSGLGT +   + +EYP+  R +N  +V PS    +V+  PYN+ L L++L    D    I+N +L  +      Y   +  S       +  +N +V+  +  +T+  RF G LN DL ++++N+VPFP+LH+ +   APL +  S+    ++   + ++    F     M   +P+   YL  A + RG + + ++   +   + +N+  FV W     KV  C + PRG + S   + N+T+I   F  +  +F  +++RK 
Sbjct:    2 REIVHLQAGQCGNQIGSKFWEIISDEHG-IDPNGYYHGESA-----LQHERIDVYYNEASSGKYVPRAVLIDLEPGTMDSVRQSPVGQLFRPDNFVYGQSGAGNNWAKGHYTEGAELIDSVLEVLRKESEGCDCLQGFQLAHSLGGGTGSGLGTLLISKIREEYPD--RIMNSFSVVPSPKVSEVVVEPYNATLSLHQLIVDTDETFCIDNEALYDIC-----YQSLRICS-----PTYQDLNHLVSVTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAKGSQQ---YRALTVAELTQQMFDAKNMMTACDPRHGRYLTVACIFRGPMSMKEVDTQMYNVQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSATFIGNSTAIQEIFKRISEQFTAMFRRKA 393          
BLAST of TUBE1 vs. Ensembl Fly
Match: betaTub56D (gene:FBgn0284243 transcript:FBtr0086536)

HSP 1 Score: 188.348 bits (477), Expect = 6.732e-54
Identity = 129/417 (30.94%), Postives = 210/417 (50.36%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSL----IRMVK-TFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRR---NIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+++ +Q GQCGNQIG++FW++   EH  +   G Y                ++Y  + SG K   RAVL+D+E G +  +       +F     +   SG+GNNWA G+   G +  + + + +RK AE CDCLQ F + HS+GGGTGSG+GT +   + +EYP+      +V PS    D +  PYN+ L +++L E  D    I+N +L     R +K T   Y D               +N +V+  +  +T+  RF G LN DL ++++N+VPFP+LH+ +   APL S  S+    ++   + ++    F     M   +P+   YL  A + RG + + ++     NI+  +N+  FV W     K   C + PRG + S   + N+T+I   F  +  +F  +++RK 
Sbjct:    2 REIVHIQAGQCGNQIGAKFWEIISDEHG-IDATGAYHGDSD-----LQLERINVYYNEASGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGD---------------LNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ---YRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNIQN-KNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKA 393          
BLAST of TUBE1 vs. Ensembl Fly
Match: betaTub60D (gene:FBgn0003888 transcript:FBtr0343443)

HSP 1 Score: 187.193 bits (474), Expect = 2.187e-53
Identity = 125/411 (30.41%), Postives = 211/411 (51.34%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEY--DNSMSTFFVXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNI--ERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+++ LQ GQCGNQIG++FW++  +EH  +  NG Y  D+ +    V+   +  S+ +        RA+L+D+E G +  +       LF     +   SG+GNNWA G+   G +  + + + +RK  E CDCLQ F + HS+GGGTGSG+GT +   + +EYP+      +V PS    D +  PYN+ L +++L E  D    I+N +L  +   F     S  S  D        +N +V+  +  +T+  RF G LN DL ++++N+VPFP+LH+ +   APL S  S+    ++   + ++    F     M   +P+   YL  A + RG + + ++   +   + +N+  FV W     K   C + P+G + S   + N T+I   F  +  +F+ +++RK 
Sbjct:    2 REIVNLQAGQCGNQIGAKFWEIISEEHG-IDSNGIYVGDSDLQLERVSVYYNEASVTRSSGGKYVPRAILLDLEPGTMESVRSGPYGQLFRPDNFVYGQSGAGNNWAKGHYTEGAELVDNVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDIC--FRTLKVSNPSYGD--------LNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ---YRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLAVQNKNSSYFVEWIPNNVKTAVCDIPPKGLKMSSTFIGNTTAIQELFKRISEQFSAMFRRKA 398          
BLAST of TUBE1 vs. Ensembl Fly
Match: betaTub85D (gene:FBgn0003889 transcript:FBtr0082046)

HSP 1 Score: 186.422 bits (472), Expect = 4.250e-53
Identity = 126/417 (30.22%), Postives = 211/417 (50.60%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSL----IRMVK-TFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRR---NIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+++ +Q GQCGNQIG +FW++   EH        Y +S      +      ++Y  + +G K   RA+L+D+E G +  +   +   +F     +   SG+GNNWA G+   G +  + + + +RK +E CDCLQ F + HS+GGGTGSG+GT +   + +EYP+      +V PS    D +  PYN+ L +++L E  D    I+N +L     R +K T   Y D               +N +V+  +  +T+  RF G LN DL ++++N+VPFP+LH+ +   APL S  S+    ++   + ++    F     M   +P+   YL  A + RG + + ++     NI+  +N+  FV W     K   C + PRG + S   + N+T+I   F  +  +F  +++RK 
Sbjct:    2 REIVHIQAGQCGNQIGGKFWEVISDEHCIDATGTYYGDS------DLQLERINVYYNEATGAKYVPRAILVDLEPGTMDSVRSGAFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGD---------------LNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ---YRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNIQN-KNSSFFVEWIPNNCKTAVCDIPPRGLKMSATFIGNSTAIQELFKRVSEQFTAMFRRKA 393          
BLAST of TUBE1 vs. Ensembl Zebrafish
Match: tube1 (tubulin, epsilon 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1174])

HSP 1 Score: 474.552 bits (1220), Expect = 2.359e-164
Identity = 236/422 (55.92%), Postives = 314/422 (74.41%), Query Frame = 2
Query:   53 ITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFV---XXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSD---------------SKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKVN 1264
            + +Q+GQCGNQ+G RFWDLAL+EH++V + G YD+++S+FF               G+I+GLKARAVL+DMEEGV+  I++  +++LF   QLI+DVSGSGNNWA G+  YGL Y EQI + +RK+AE CDCLQCFF++HSMGGGTGSGLGT V ++L +E+PEVYR V +V+P+ +DDVITSPYNSVL + +LTE ADCV+P++N SL+ +V      S+               S +    K  KPFDAMN+IVANLLLN+TSS+RFEG+LN+DLNEI+MNLVPFP+LHYL+++  PLY+L     P   PRR+DQ+F+D+F+K+ Q+I  +PK + YLACAL++RGNV++SD+RRNIER R  L FVPWN+EGWK   CSV P G  +SLL L+NNT + +TF EL  +F KLY+RK +
Sbjct:    5 VVVQVGQCGNQVGCRFWDLALREHAHVNQMGVYDDALSSFFRNVDQRRGYGAEATGGKITGLKARAVLVDMEEGVLGGILQGPLRSLFSSAQLISDVSGSGNNWAVGHHTYGLAYREQIVDQVRKAAEHCDCLQCFFLIHSMGGGTGSGLGTFVLKLLEEEFPEVYRIVTSVYPTAEDDVITSPYNSVLAMKELTEHADCVLPVDNQSLVDIVGKIKHMSNTGKPGCAIKKDSTIISGQGGVVKVEKPFDAMNNIVANLLLNITSSARFEGSLNMDLNEIAMNLVPFPRLHYLVSSLTPLYTLADVSVP---PRRLDQMFSDAFSKEHQLIRADPKHNLYLACALMLRGNVQLSDLRRNIERLRPTLPFVPWNQEGWKTSLCSVLPVGHSHSLLALANNTCVKSTFSELRERFMKLYRRKAH 423          
BLAST of TUBE1 vs. Ensembl Zebrafish
Match: tube1 (tubulin, epsilon 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1174])

HSP 1 Score: 474.552 bits (1220), Expect = 2.359e-164
Identity = 236/422 (55.92%), Postives = 314/422 (74.41%), Query Frame = 2
Query:   53 ITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFV---XXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSD---------------SKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKVN 1264
            + +Q+GQCGNQ+G RFWDLAL+EH++V + G YD+++S+FF               G+I+GLKARAVL+DMEEGV+  I++  +++LF   QLI+DVSGSGNNWA G+  YGL Y EQI + +RK+AE CDCLQCFF++HSMGGGTGSGLGT V ++L +E+PEVYR V +V+P+ +DDVITSPYNSVL + +LTE ADCV+P++N SL+ +V      S+               S +    K  KPFDAMN+IVANLLLN+TSS+RFEG+LN+DLNEI+MNLVPFP+LHYL+++  PLY+L     P   PRR+DQ+F+D+F+K+ Q+I  +PK + YLACAL++RGNV++SD+RRNIER R  L FVPWN+EGWK   CSV P G  +SLL L+NNT + +TF EL  +F KLY+RK +
Sbjct:    5 VVVQVGQCGNQVGCRFWDLALREHAHVNQMGVYDDALSSFFRNVDQRRGYGAEATGGKITGLKARAVLVDMEEGVLGGILQGPLRSLFSSAQLISDVSGSGNNWAVGHHTYGLAYREQIVDQVRKAAEHCDCLQCFFLIHSMGGGTGSGLGTFVLKLLEEEFPEVYRIVTSVYPTAEDDVITSPYNSVLAMKELTEHADCVLPVDNQSLVDIVGKIKHMSNTGKPGCAIKKDSTIISGQGGVVKVEKPFDAMNNIVANLLLNITSSARFEGSLNMDLNEIAMNLVPFPRLHYLVSSLTPLYTLADVSVP---PRRLDQMFSDAFSKEHQLIRADPKHNLYLACALMLRGNVQLSDLRRNIERLRPTLPFVPWNQEGWKTSLCSVLPVGHSHSLLALANNTCVKSTFSELRERFMKLYRRKAH 423          
BLAST of TUBE1 vs. Ensembl Zebrafish
Match: tube1 (tubulin, epsilon 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1174])

HSP 1 Score: 274.248 bits (700), Expect = 9.888e-89
Identity = 144/266 (54.14%), Postives = 192/266 (72.18%), Query Frame = 2
Query:   53 ITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFV---XXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSD---------------SKESSNDKSRKPFDAMNDIVANLLLNLTSS 796
            + +Q+GQCGNQ+G RFWDLAL+EH++V + G YD+++S+FF               G+I+GLKARAVL+DMEEGV+  I++  +++LF   QLI+DVSGSGNNWA G+  YGL Y EQI + +RK+AE CDCLQCFF++HSMGGGTGSGLGT V ++L +E+PEVYR V +V+P+ +DDVITSPYNSVL + +LTE ADCV+P++N SL+ +V      S+               S +    K  KPFDAMN+IVANLLLN+TS+
Sbjct:    5 VVVQVGQCGNQVGCRFWDLALREHAHVNQMGVYDDALSSFFRNVDQRRGYGAEATGGKITGLKARAVLVDMEEGVLGGILQGPLRSLFSSAQLISDVSGSGNNWAVGHHTYGLAYREQIVDQVRKAAEHCDCLQCFFLIHSMGGGTGSGLGTFVLKLLEEEFPEVYRIVTSVYPTAEDDVITSPYNSVLAMKELTEHADCVLPVDNQSLVDIVGKIKHMSNTGKPGCAIKKDSTIISGQGGVVKVEKPFDAMNNIVANLLLNITSA 270          
BLAST of TUBE1 vs. Ensembl Zebrafish
Match: tubb1 (tubulin, beta 1 class VI [Source:ZFIN;Acc:ZDB-GENE-110408-5])

HSP 1 Score: 196.052 bits (497), Expect = 1.951e-56
Identity = 135/418 (32.30%), Postives = 218/418 (52.15%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVN--AVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSL----IRMVK-TFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIE--RYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+++ LQ+GQCGNQIGS+FW++   EH  + + G Y+  M            ++Y  +  G K   RA+L+D+E G +  +  S I  LF     I   SG+GNNWA G+   G +  EQ+ + +R  AE CDC+Q F  +HS+GGGTGSG+GT +   + +EYP+  R +N  +V PS    D +  PYN+ L +++L E  D    I+N +L     R +K T   Y D               +N +V+  +  +T+S RF G LN DL ++++N+VPFP+LH+ +   APL +  S+    ++   + ++    F     M   +P+   YL  A + RG +   ++   +   + +N+  FV W     KV  C + PRG + +   + NNT+I   F  +  +F  +++RK 
Sbjct:    2 REIVHLQIGQCGNQIGSKFWEVISDEHG-INRVGAYEGDMD-----LQLERVNVYFNEAHGGKYVPRALLVDLEPGTMDSVRGSQIGQLFRPDNFIHGNSGAGNNWAKGHYTEGAELVEQVVDRVRNEAESCDCMQGFQFVHSLGGGTGSGMGTLIINKIREEYPD--RIMNSFSVMPSPKVSDTVVEPYNATLSIHQLIENTDETYCIDNEALYDICFRTLKLTTPTYGD---------------LNHLVSLTMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQ---YRALTVPELTQQMFDPRNMMTACDPRRGRYLTVAGIFRGRMSTKEVDEQMLAIQQKNSNYFVDWIPHNVKVAVCDIPPRGLKMASTFIGNNTAIQEVFKRIGEQFALMFRRKA 393          
BLAST of TUBE1 vs. Ensembl Zebrafish
Match: tubb2b (tubulin, beta 2b [Source:ZFIN;Acc:ZDB-GENE-030131-722])

HSP 1 Score: 188.734 bits (478), Expect = 8.375e-54
Identity = 125/411 (30.41%), Postives = 208/411 (50.61%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNI--ERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+++ LQ GQCGNQIG++FW++   EH  +   G Y                ++Y  + SG K   RAVL+D+E G +  +       +F     +   SG+GNNWA G+   G +  + + + +RK AE CDCLQ F + HS+GGGTGSG+GT +   + +EYP+      +V PS    D +  PYN+ L +++L E  D    I+N +L  +   F     +  S  D        +N +V+  +  +T+  RF G LN DL ++++N+VPFP+LH+ +   APL S  S+    ++   + ++    F     M   +P+   YL  A + RG + + ++   +   + +N+  FV W     K   C + PRG + +   + N+T+I   F  +  +F  +++RK 
Sbjct:    2 REIVHLQAGQCGNQIGAKFWEVISDEHG-IDPTGTYHGDSD-----LQLDRINVYYNEASGGKYVPRAVLVDLEPGTMDSVRSGPFGQVFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDIC--FRTLKLTTPSYGD--------LNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ---YRSLTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKA 393          
BLAST of TUBE1 vs. Ensembl Xenopus
Match: tube1 (tubulin epsilon 1 [Source:NCBI gene;Acc:100488997])

HSP 1 Score: 483.797 bits (1244), Expect = 1.064e-167
Identity = 247/422 (58.53%), Postives = 317/422 (75.12%), Query Frame = 2
Query:   53 ITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFF----VXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKS--------------RKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKVN 1264
            I +Q+GQCGNQIG RFWDLAL+EH+ V K G +D ++ +FF               +G+I  LKARAVLIDMEEGVV+EI++  +++LFD KQLITDVSGSGNNWA G+  YG +Y E I EN+R++AE CDCLQCFF++HSMGGGTGSGLGT V  +L +E+PEVYRFV +V+PS +DDVITSPYNSVL + +LTE ADCV+PIEN +L+ +V   N+ +++ +  N KS               KPFDAMN+IVANLLLNLTSS+RFEG+LN+DLNEISMNLVPFP+LHYL ++  PLY+L     P    RR+DQ+F+D+F+KD Q+I  +PK   YLACAL+VRGNV+ISD+RRNIER + +L+FV WN+EGWK G CSV P G  +SLL L+NNT +  TF EL  +F+KLY++K +
Sbjct:    5 IVVQVGQCGNQIGCRFWDLALREHASVNKKGIFDEALCSFFRNVDTRAEAGGADAQRGKICSLKARAVLIDMEEGVVNEILQGPLRDLFDSKQLITDVSGSGNNWAVGHKLYGGQYREHIVENLRRTAEQCDCLQCFFVIHSMGGGTGSGLGTFVLNVLEEEFPEVYRFVTSVYPSAEDDVITSPYNSVLAMKELTEHADCVLPIENQALVDIVNKINQMANTGKLGNVKSNSLLTSNKGGIKENEKPFDAMNNIVANLLLNLTSSARFEGSLNMDLNEISMNLVPFPQLHYLTSSLTPLYTLADVNVP---TRRLDQMFSDAFSKDHQLIRADPKHSLYLACALMVRGNVQISDLRRNIERLKPSLQFVSWNQEGWKTGLCSVPPVGHSHSLLALANNTCVKPTFIELRDRFSKLYRKKAH 423          
BLAST of TUBE1 vs. Ensembl Xenopus
Match: tube1 (tubulin epsilon 1 [Source:NCBI gene;Acc:100488997])

HSP 1 Score: 482.641 bits (1241), Expect = 2.967e-167
Identity = 247/422 (58.53%), Postives = 317/422 (75.12%), Query Frame = 2
Query:   53 ITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFF----VXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKS--------------RKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKVN 1264
            I +Q+GQCGNQIG RFWDLAL+EH+ V K G +D ++ +FF               +G+I  LKARAVLIDMEEGVV+EI++  +++LFD KQLITDVSGSGNNWA G+  YG +Y E I EN+R++AE CDCLQCFF++HSMGGGTGSGLGT V  +L +E+PEVYRFV +V+PS +DDVITSPYNSVL + +LTE ADCV+PIEN +L+ +V   N+ +++ +  N KS               KPFDAMN+IVANLLLNLTSS+RFEG+LN+DLNEISMNLVPFP+LHYL ++  PLY+L     P    RR+DQ+F+D+F+KD Q+I  +PK   YLACAL+VRGNV+ISD+RRNIER + +L+FV WN+EGWK G CSV P G  +SLL L+NNT +  TF EL  +F+KLY++K +
Sbjct:    5 IVVQVGQCGNQIGCRFWDLALREHASVNKKGIFDEALCSFFRNVDTRAEAGGADAQRGKICSLKARAVLIDMEEGVVNEILQGPLRDLFDSKQLITDVSGSGNNWAVGHKLYGGQYREHIVENLRRTAEQCDCLQCFFVIHSMGGGTGSGLGTFVLNVLEEEFPEVYRFVTSVYPSAEDDVITSPYNSVLAMKELTEHADCVLPIENQALVDIVNKINQMANTGKLGNVKSNSLLTSNKGGIKENEKPFDAMNNIVANLLLNLTSSARFEGSLNMDLNEISMNLVPFPQLHYLTSSLTPLYTLADVNVP---TRRLDQMFSDAFSKDHQLIRADPKHSLYLACALMVRGNVQISDLRRNIERLKPSLQFVSWNQEGWKTGLCSVPPVGHSHSLLALANNTCVKPTFIELRDRFSKLYRKKAH 423          
BLAST of TUBE1 vs. Ensembl Xenopus
Match: tube1 (tubulin epsilon 1 [Source:NCBI gene;Acc:100488997])

HSP 1 Score: 466.077 bits (1198), Expect = 4.037e-161
Identity = 241/418 (57.66%), Postives = 309/418 (73.92%), Query Frame = 2
Query:   53 ITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKS--------------RKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKVN 1264
            I +Q+GQCGNQIG RFWDLAL+EH+ V K G +D ++ +FF                     AVLIDMEEGVV+EI++  +++LFD KQLITDVSGSGNNWA G+  YG +Y E I EN+R++AE CDCLQCFF++HSMGGGTGSGLGT V  +L +E+PEVYRFV +V+PS +DDVITSPYNSVL + +LTE ADCV+PIEN +L+ +V   N+ +++ +  N KS               KPFDAMN+IVANLLLNLTSS+RFEG+LN+DLNEISMNLVPFP+LHYL ++  PLY+L     P    RR+DQ+F+D+F+KD Q+I  +PK   YLACAL+VRGNV+ISD+RRNIER + +L+FV WN+EGWK G CSV P G  +SLL L+NNT +  TF EL  +F+KLY++K +
Sbjct:    5 IVVQVGQCGNQIGCRFWDLALREHASVNKKGIFDEALCSFF-------------------RNAVLIDMEEGVVNEILQGPLRDLFDSKQLITDVSGSGNNWAVGHKLYGGQYREHIVENLRRTAEQCDCLQCFFVIHSMGGGTGSGLGTFVLNVLEEEFPEVYRFVTSVYPSAEDDVITSPYNSVLAMKELTEHADCVLPIENQALVDIVNKINQMANTGKLGNVKSNSLLTSNKGGIKENEKPFDAMNNIVANLLLNLTSSARFEGSLNMDLNEISMNLVPFPQLHYLTSSLTPLYTLADVNVP---TRRLDQMFSDAFSKDHQLIRADPKHSLYLACALMVRGNVQISDLRRNIERLKPSLQFVSWNQEGWKTGLCSVPPVGHSHSLLALANNTCVKPTFIELRDRFSKLYRKKAH 400          
BLAST of TUBE1 vs. Ensembl Xenopus
Match: tube1 (tubulin epsilon 1 [Source:NCBI gene;Acc:100488997])

HSP 1 Score: 420.239 bits (1079), Expect = 2.743e-144
Identity = 219/370 (59.19%), Postives = 279/370 (75.41%), Query Frame = 2
Query:   53 ITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFF----VXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKS--------------RKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFV 1108
            I +Q+GQCGNQIG RFWDLAL+EH+ V K G +D ++ +FF               +G+I  LKARAVLIDMEEGVV+EI++  +++LFD KQLITDVSGSGNNWA G+  YG +Y E I EN+R++AE CDCLQCFF++HSMGGGTGSGLGT V  +L +E+PEVYRFV +V+PS +DDVITSPYNSVL + +LTE ADCV+PIEN +L+ +V   N+ +++ +  N KS               KPFDAMN+IVANLLLNLTSS+RFEG+LN+DLNEISMNLVPFP+LHYL ++  PLY+L     P    RR+DQ+F+D+F+KD Q+I  +PK   YLACAL+VRGNV+ISD+RRNIER+   L+FV
Sbjct:    5 IVVQVGQCGNQIGCRFWDLALREHASVNKKGIFDEALCSFFRNVDTRAEAGGADAQRGKICSLKARAVLIDMEEGVVNEILQGPLRDLFDSKQLITDVSGSGNNWAVGHKLYGGQYREHIVENLRRTAEQCDCLQCFFVIHSMGGGTGSGLGTFVLNVLEEEFPEVYRFVTSVYPSAEDDVITSPYNSVLAMKELTEHADCVLPIENQALVDIVNKINQMANTGKLGNVKSNSLLTSNKGGIKENEKPFDAMNNIVANLLLNLTSSARFEGSLNMDLNEISMNLVPFPQLHYLTSSLTPLYTLADVNVP---TRRLDQMFSDAFSKDHQLIRADPKHSLYLACALMVRGNVQISDLRRNIERFFLALQFV 371          
BLAST of TUBE1 vs. Ensembl Xenopus
Match: reps2 (RALBP1 associated Eps domain containing 2 [Source:Xenbase;Acc:XB-GENE-985000])

HSP 1 Score: 188.348 bits (477), Expect = 1.547e-53
Identity = 127/416 (30.53%), Postives = 209/416 (50.24%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSL----IRMVK-TFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNI--ERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+++ LQ GQCGNQIG++FW++   EH  +   G Y                ++Y  + +G K   RAVL+D+E G +  +       +F     +   SG+GNNWA G+   G +  + + + +RK AE CDCLQ F + HS+GGGTGSG+GT +   + +EYP+      +V PS    D +  PYN+ L +++L E  D    I+N +L     R +K T   Y D               +N +V+  +  +T+  RF G LN DL ++++N+VPFP+LH+ +   APL S  S+    ++   + ++    F     M   +P+   YL  A + RG + + ++   +   + +N+  FV W     K   C + PRG + S   + N+T+I   F  +  +F  +++RK 
Sbjct:    2 REIVHLQAGQCGNQIGAKFWEVISDEHG-IDPTGTYHGDSD-----LQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGD---------------LNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ---YRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKA 393          
BLAST of TUBE1 vs. Ensembl Mouse
Match: Tube1 (tubulin, epsilon 1 [Source:MGI Symbol;Acc:MGI:1919174])

HSP 1 Score: 474.937 bits (1221), Expect = 2.250e-164
Identity = 246/424 (58.02%), Postives = 317/424 (74.76%), Query Frame = 2
Query:   53 ITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFF----VXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKE-----------SSN-----DKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKVN 1264
            + +Q+GQCGNQIG  FWDLAL+EH+ V + G YD+++S+FF            SI KG+IS LKARAVLIDMEEGVV+EI++  ++++FD KQLITD+SGSGNNWA G+  +G  Y EQI E +RKSAE CDCLQCFFI+HSMGGGTGSGLGT + ++L DE+PEVYRFV AV+PS +DDVITSPYNS+L + +L E ADCV+PI+N SL  ++   +   +S +           +SN        +KPFDAMN+IVANLLL+LTSS+RFEG+LN+DLNEISMNLVPFPKLHYL+++  PLY+L     P   PRR+DQ+F+D+F+KD Q+I  +P+   YLACAL+VRGNV+ISD+RRNIER +  L+FV WN+EGWK   CSV P G  +SLL L+NNT +  TF EL  +F +LYK+K +
Sbjct:    5 VVVQVGQCGNQIGCCFWDLALREHAAVNQKGIYDDAISSFFRNVDTRAVGDGGSISKGRISSLKARAVLIDMEEGVVNEILQGPLRDVFDSKQLITDISGSGNNWAVGHKVFGCLYREQILEKLRKSAEQCDCLQCFFIIHSMGGGTGSGLGTFLLKVLEDEFPEVYRFVTAVYPSSEDDVITSPYNSMLAMKELNEHADCVLPIDNQSLFDIISKIDLVVNSGKLGSAVKPKSLITSNMGAVKKHHKKPFDAMNNIVANLLLSLTSSARFEGSLNMDLNEISMNLVPFPKLHYLVSSLTPLYTLADVNIP---PRRLDQMFSDAFSKDHQLIQADPRHSLYLACALIVRGNVQISDLRRNIERLKPALQFVSWNQEGWKTSLCSVPPVGHSHSLLALANNTCVKPTFMELRERFTRLYKKKAH 425          
BLAST of TUBE1 vs. Ensembl Mouse
Match: Tube1 (tubulin, epsilon 1 [Source:MGI Symbol;Acc:MGI:1919174])

HSP 1 Score: 247.669 bits (631), Expect = 2.861e-79
Identity = 131/208 (62.98%), Postives = 165/208 (79.33%), Query Frame = 2
Query:   53 ITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFF----VXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENN 664
            + +Q+GQCGNQIG  FWDLAL+EH+ V + G YD+++S+FF            SI KG+IS LKARAVLIDMEEGVV+EI++  ++++FD KQLITD+SGSGNNWA G+  +G  Y EQI E +RKSAE CDCLQCFFI+HSMGGGTGSGLGT + ++L DE+PEVYRFV AV+PS +DDVITSPYNS+L + +L E ADCV+PI+N 
Sbjct:    5 VVVQVGQCGNQIGCCFWDLALREHAAVNQKGIYDDAISSFFRNVDTRAVGDGGSISKGRISSLKARAVLIDMEEGVVNEILQGPLRDVFDSKQLITDISGSGNNWAVGHKVFGCLYREQILEKLRKSAEQCDCLQCFFIIHSMGGGTGSGLGTFLLKVLEDEFPEVYRFVTAVYPSSEDDVITSPYNSMLAMKELNEHADCVLPIDNQ 212          
BLAST of TUBE1 vs. Ensembl Mouse
Match: Tubb1 (tubulin, beta 1 class VI [Source:MGI Symbol;Acc:MGI:107814])

HSP 1 Score: 192.586 bits (488), Expect = 2.941e-55
Identity = 132/413 (31.96%), Postives = 219/413 (53.03%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVN--AVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIE--RYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+++ +Q+GQCGNQIG++FW++  +EH  +   G Y  + +           S+Y  +  G K   RAVL+D+E G +  I  S +  LF     +   SG+GNNWA G+   G +  E + + +R+ +E CDCLQ F I+HS+GGGTGSG+GT +   + +EYP+  R +N  +V PS    D +  PYN+VL +++L E  D    I+N +L  +   F     +  +  D        +N +V+  +  +T+S RF G LN DL ++++N+VPFP+LH+ +   APL +  S+    ++   + ++    F     M   +P+   YL  A + RG +   ++ + +   + RN+  FV W     KV  C + PRG   +   L NNT+I   F  +   F+ +++R+ 
Sbjct:    2 REIVHIQIGQCGNQIGAKFWEVIGEEHG-IDCAGSYCGTSA-----LQLERISVYYNEAYGKKYVPRAVLVDLEPGTMDSIRSSRLGVLFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVMDVVRRESESCDCLQGFQIVHSLGGGTGSGMGTLLMNKIREEYPD--RILNSFSVMPSPKVSDTVVEPYNAVLSIHQLIENTDACFCIDNEALYDIC--FRTLRLTTPTYGD--------LNHLVSLTMSGITTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAQGSQQ---YRALSVAELTQQMFDARNIMAACDPRRGRYLTVACIFRGKMSTKEVDQQLLSIQTRNSNCFVEWIPNNVKVAVCDIPPRGLNMAATFLGNNTAIQELFTRVSEHFSAMFRRRA 393          
BLAST of TUBE1 vs. Ensembl Mouse
Match: Tubb4b (tubulin, beta 4B class IVB [Source:MGI Symbol;Acc:MGI:1915472])

HSP 1 Score: 187.963 bits (476), Expect = 1.598e-53
Identity = 127/416 (30.53%), Postives = 209/416 (50.24%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSL----IRMVK-TFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNI--ERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+++ LQ GQCGNQIG++FW++   EH  +   G Y                ++Y  + +G K   RAVL+D+E G +  +       +F     +   SG+GNNWA G+   G +  + + + +RK AE CDCLQ F + HS+GGGTGSG+GT +   + +EYP+      +V PS    D +  PYN+ L +++L E  D    I+N +L     R +K T   Y D               +N +V+  +  +T+  RF G LN DL ++++N+VPFP+LH+ +   APL S  S+    ++   + ++    F     M   +P+   YL  A + RG + + ++   +   + +N+  FV W     K   C + PRG + S   + N+T+I   F  +  +F  +++RK 
Sbjct:    2 REIVHLQAGQCGNQIGAKFWEVISDEHG-IDPTGTYHGDSD-----LQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGD---------------LNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ---YRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKA 393          
BLAST of TUBE1 vs. Ensembl Mouse
Match: Tubb5 (tubulin, beta 5 class I [Source:MGI Symbol;Acc:MGI:107812])

HSP 1 Score: 186.808 bits (473), Expect = 4.545e-53
Identity = 125/416 (30.05%), Postives = 210/416 (50.48%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSL----IRMVK-TFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNI--ERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+++ +Q GQCGNQIG++FW++   EH  +   G Y                S+Y  + +G K   RA+L+D+E G +  +       +F     +   SG+GNNWA G+   G +  + + + +RK AE CDCLQ F + HS+GGGTGSG+GT +   + +EYP+      +V PS    D +  PYN+ L +++L E  D    I+N +L     R +K T   Y D               +N +V+  +  +T+  RF G LN DL ++++N+VPFP+LH+ +   APL S  S+    ++   + ++    F     M   +P+   YL  A + RG + + ++   +   + +N+  FV W     K   C + PRG + ++  + N+T+I   F  +  +F  +++RK 
Sbjct:    2 REIVHIQAGQCGNQIGAKFWEVISDEHG-IDPTGTYHGDSD-----LQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGD---------------LNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ---YRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKA 393          
BLAST of TUBE1 vs. UniProt/SwissProt
Match: sp|Q9D6T1|TBE_MOUSE (Tubulin epsilon chain OS=Mus musculus OX=10090 GN=Tube1 PE=1 SV=1)

HSP 1 Score: 474.937 bits (1221), Expect = 1.574e-163
Identity = 246/424 (58.02%), Postives = 317/424 (74.76%), Query Frame = 2
Query:   53 ITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFF----VXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKE-----------SSN-----DKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKVN 1264
            + +Q+GQCGNQIG  FWDLAL+EH+ V + G YD+++S+FF            SI KG+IS LKARAVLIDMEEGVV+EI++  ++++FD KQLITD+SGSGNNWA G+  +G  Y EQI E +RKSAE CDCLQCFFI+HSMGGGTGSGLGT + ++L DE+PEVYRFV AV+PS +DDVITSPYNS+L + +L E ADCV+PI+N SL  ++   +   +S +           +SN        +KPFDAMN+IVANLLL+LTSS+RFEG+LN+DLNEISMNLVPFPKLHYL+++  PLY+L     P   PRR+DQ+F+D+F+KD Q+I  +P+   YLACAL+VRGNV+ISD+RRNIER +  L+FV WN+EGWK   CSV P G  +SLL L+NNT +  TF EL  +F +LYK+K +
Sbjct:    5 VVVQVGQCGNQIGCCFWDLALREHAAVNQKGIYDDAISSFFRNVDTRAVGDGGSISKGRISSLKARAVLIDMEEGVVNEILQGPLRDVFDSKQLITDISGSGNNWAVGHKVFGCLYREQILEKLRKSAEQCDCLQCFFIIHSMGGGTGSGLGTFLLKVLEDEFPEVYRFVTAVYPSSEDDVITSPYNSMLAMKELNEHADCVLPIDNQSLFDIISKIDLVVNSGKLGSAVKPKSLITSNMGAVKKHHKKPFDAMNNIVANLLLSLTSSARFEGSLNMDLNEISMNLVPFPKLHYLVSSLTPLYTLADVNIP---PRRLDQMFSDAFSKDHQLIQADPRHSLYLACALIVRGNVQISDLRRNIERLKPALQFVSWNQEGWKTSLCSVPPVGHSHSLLALANNTCVKPTFMELRERFTRLYKKKAH 425          
BLAST of TUBE1 vs. UniProt/SwissProt
Match: sp|Q9UJT0|TBE_HUMAN (Tubulin epsilon chain OS=Homo sapiens OX=9606 GN=TUBE1 PE=2 SV=1)

HSP 1 Score: 468.774 bits (1205), Expect = 3.970e-161
Identity = 242/424 (57.08%), Postives = 314/424 (74.06%), Query Frame = 2
Query:   53 ITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFF----VXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRM----------------VKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKVN 1264
            + +Q+GQCGNQIG  FWDLAL+EH+ V + G YD ++S+FF            SI KG+I  LKARAVLIDMEEGVV+EI++  ++++FD KQLITD+SGSGNNWA G+  +G  Y +QI E  RKSAE CDCLQCFFI+HSMGGGTGSGLGT + ++L DE+PEVYRFV +++PS +DDVITSPYNS+L + +L E ADCV+PI+N SL  +                VK  +  + S  +   + +KPFDAMN+IVANLLLNLTSS+RFEG+LN+DLNEISMNLVPFP+LHYL+++  PLY+L     P   PRR+DQ+F+D+F+KD Q++  +PK   YLACAL+VRGNV+ISD+RRNIER + +L+FV WN+EGWK   CSV P G  +SLL L+NNT +  TF EL  +F +LYK+K +
Sbjct:    5 VVVQVGQCGNQIGCCFWDLALREHAAVNQKGIYDEAISSFFRNVDTRVVGDGGSISKGKICSLKARAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFRKSAEHCDCLQCFFIIHSMGGGTGSGLGTFLLKVLEDEFPEVYRFVTSIYPSGEDDVITSPYNSILAMKELNEHADCVLPIDNQSLFDIISKIDLMVNSGKLGTTVKPKSLVTSSSGALKKQHKKPFDAMNNIVANLLLNLTSSARFEGSLNMDLNEISMNLVPFPQLHYLVSSLTPLYTLTDVNIP---PRRLDQMFSDAFSKDHQLLRADPKHSLYLACALMVRGNVQISDLRRNIERLKPSLQFVSWNQEGWKTSLCSVPPVGHSHSLLALANNTCVKPTFMELKERFMRLYKKKAH 425          
BLAST of TUBE1 vs. UniProt/SwissProt
Match: sp|P50259|TBB_PORPU (Tubulin beta chain OS=Porphyra purpurea OX=2787 GN=TUBB1 PE=3 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 8.246e-59
Identity = 128/411 (31.14%), Postives = 215/411 (52.31%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIE--RYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+++ +Q GQCGNQIG++FW++  +EH  +  +G Y+ +              +Y  + SG +   RAVL+D+E GV+  I       L+     +   SG+GNNWA G+   G +  + + + +R+ AE CDCLQ F + HS+GGGTGSG+GT +   + +E+P+      +V PS    D +  PYN  L +++L E AD V  I+N +L  +     K          K    +  +N +V+ ++  +TSS RF G LN DL ++++NLVPFP+LH+ +   AP   L +     ++ + +  +    F     M D +P+   YL  +   RG+V   ++   ++  + +N+ +F+ W     K   C VAP G+  S   + N+T+I + F  +   F+ ++KRK 
Sbjct:    2 REIVHIQAGQCGNQIGAKFWEVISEEHG-IDSSGAYNGTSD-----LQLDRAEVYYNEGSGGRYVPRAVLVDLEPGVLDTIKAGPHGGLYRPDNFVAGQSGAGNNWAKGHYTEGAELVDSVLDVVRREAEGCDCLQGFQVTHSLGGGTGSGMGTLLVSKIREEFPDRMMCTYSVMPSPKVSDTVVEPYNCTLSVHQLVENADAVFCIDNEALYNICYNTLK----------KPEPAYPDLNKLVSGVMSGITSSLRFPGQLNSDLRKLAVNLVPFPRLHFFMIGYAP---LSADGVTAYRAKTVADLTKQMFDPKNMMADCDPRNGRYLTASAYFRGHVSTKEVEEQMDAIQTKNSGQFIDWIPNAIKASVCDVAPTGETMSAAFIGNSTAIQDIFKRVGSHFSAMFKRKA 393          
BLAST of TUBE1 vs. UniProt/SwissProt
Match: sp|Q9HFQ3|TBB_MELLI (Tubulin beta chain OS=Melampsora lini OX=5261 GN=TUB1 PE=3 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 2.000e-58
Identity = 128/411 (31.14%), Postives = 219/411 (53.28%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNI--ERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+++ LQ GQCGNQIG++FW++   EH  +  +G+Y  +             S+Y  +++G K   RAVLID+E G +  +      +LF     +   SG+GNNWA G+   G +  + + + +RK AE CDCLQ F I HS+GGGTG+G+GT +   + +E+P+      +V PS    D +  PYN+ L +++L E +D    I+N +L  +   F        +  D        +N +V+ ++  +T+  RF G LN DL ++++N+VPFP+LH+ +   APL +  S+    ++   + ++ +  F     M   +P+   YL  A   RG V + ++  N+   + +N+  FV W     +  HC +APRG + S+  + N+T+I + F  +  +F  +++RK 
Sbjct:    2 REIVHLQTGQCGNQIGAKFWEVVSDEHG-IATDGQYKGTSD-----LQLERISVYYNEVAGNKYVPRAVLIDLEPGTMDSVRSGPFGSLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCLQGFQITHSLGGGTGAGMGTLLISKIREEFPDRMMATFSVVPSPKVSDTVVEPYNATLSVHQLVENSDETFCIDNEALYDIC--FRTLKLQTPTYGD--------LNHLVSIVMSGITTCLRFPGQLNSDLRKLAVNMVPFPRLHFFMVGFAPLTARGSQQ---YRAVTVPELTSQMFDAKNMMAASDPRHGRYLTVAAYFRGKVSMKEVEENMLSVQSKNSNYFVEWIPNNVQTAHCDIAPRGLKMSVTFIGNSTAIQDLFKRIADQFTAMFRRKA 393          
BLAST of TUBE1 vs. UniProt/SwissProt
Match: sp|P12458|TBB2_PHYPO (Tubulin beta-2 chain OS=Physarum polycephalum OX=5791 GN=BETC PE=2 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 4.782e-58
Identity = 135/416 (32.45%), Postives = 220/416 (52.88%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSL----IRMVK-TFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIE--RYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+++ +Q+GQCGNQ+G++FW++  +EH  +   G Y         +      ++Y  +++G K   RAVL+D+E GV+  I  SSI ++F         SG+GNNWA G+   G +  E + + +RK AE CDCLQ F I HS+GGGTGSGLGT +   + +E+P+      +V PS    D +  PYN+ L +++L E AD VM I+N +L     R +K T   Y D               +N +V+ ++  +T+  RF G LN DL ++++NL+PFP+LH+ +   APL +  S M   F+   + ++    F     M   +P+   YL  +   RG +   ++   +   + +N+  FV W     K   C + P+G + S   + NNT I   F  + ++F+ +++RK 
Sbjct:    2 REIVHVQVGQCGNQVGAKFWEVVSEEHG-IDSAGTYKGD-----TDLQLERINVYYNEVAGSKYVPRAVLVDLEPGVLDSIRASSIGSMFRPDNFTHAQSGAGNNWAKGHYTEGAELVESVVDVVRKEAENCDCLQGFQICHSLGGGTGSGLGTLLISKIREEFPDRMMCTFSVMPSPKVSDTVVEPYNATLSIHQLVENADEVMCIDNEALYDICFRTLKLTTPTYGD---------------LNHLVSGVMSGITACLRFPGQLNSDLRKLAVNLIPFPRLHFFLIGYAPL-TARSAMG--FRALTVPELTQQIFDSRNMMAASDPRHGRYLTASATFRGKMSTKEVDEQMHAVQTKNSSFFVEWIPNNIKSSVCDIPPKGMKMSATFIGNNTCIQELFKRIGLQFSAMFRRKA 393          
BLAST of TUBE1 vs. TrEMBL
Match: H6WA43 (TUBE1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 300/303 (99.01%), Postives = 302/303 (99.67%), Query Frame = 2
Query:  356 ATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKVN 1264
            ATGNLEYGLKYHEQISENIRKSAELCDCLQCFFILHSMGGGTGSGLGTHVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQ+PLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRK +
Sbjct:    1 ATGNLEYGLKYHEQISENIRKSAELCDCLQCFFILHSMGGGTGSGLGTHVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQSPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKAH 303          
BLAST of TUBE1 vs. TrEMBL
Match: A0A4E0QWZ2 (Tubulin epsilon chain OS=Fasciola hepatica OX=6192 GN=D915_009675 PE=3 SV=1)

HSP 1 Score: 499.204 bits (1284), Expect = 2.507e-170
Identity = 258/423 (60.99%), Postives = 323/423 (76.36%), Query Frame = 2
Query:   56 TLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRM---VKTFNKYSDSKE---SSNDKS--------------RKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKVN 1264
            T  +GQCGNQIG+RFW+LAL+EHS V + G YD+++STFF+N        Y   +SGLKARAVL+DMEEGVV E+ +SS++NL+DH+ LITDVSGSGNNWA GN  YG +YHE++ E IRKSAELCDCLQCFFI+HS+GGGTGSG+GTH+ ++LADEYP VYR V AVFPS DDDVITSPYN+VLGLN LT+ ADCV+P++N++L  +   +KT +K  + K    S N KS               KPFD MN+IVA +LLNLTSS RFEGT+NVD+NEISMNLVPFP+LHYL +AQ+PL + +  +     PRRIDQ F+D+FT+DFQ++ V+P  HT+LA ALLVRG V  SD+RRNI+R +N L+FV WN+EGWKVGHC V P  Q YSLL LSNNT++ + F  +L +F KLYKRK +
Sbjct:   18 TRTVGQCGNQIGNRFWNLALREHSVVNEKGVYDSALSTFFLNGAGDDG-CYLPMVSGLKARAVLVDMEEGVVGELFRSSMRNLYDHRFLITDVSGSGNNWAVGNYLYGNRYHEELVEVIRKSAELCDCLQCFFIIHSLGGGTGSGIGTHILRILADEYPSVYRIVTAVFPSVDDDVITSPYNTVLGLNSLTQLADCVLPVDNSALAGIATRIKTVSKLDEPKTRNVSQNSKSTWSGTGLPVNPTKKSKPFDEMNNIVATMLLNLTSSCRFEGTMNVDINEISMNLVPFPRLHYLTSAQSPLTTFDKTL----APRRIDQAFSDAFTRDFQLVSVDPCRHTFLAAALLVRGAVTASDLRRNIDRLQNRLRFVTWNREGWKVGHCLVPPVDQPYSLLALSNNTAVRHCFSSVLDRFQKLYKRKAH 435          
BLAST of TUBE1 vs. TrEMBL
Match: A7RQD7 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g89613 PE=3 SV=1)

HSP 1 Score: 494.582 bits (1272), Expect = 1.344e-168
Identity = 258/434 (59.45%), Postives = 325/434 (74.88%), Query Frame = 2
Query:   53 ITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXI----YKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLI-----------------RMVKTFNKYSDSKESS---------NDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKVN 1264
            I +Q+GQCGNQIG RFWDLAL+EH+   K G +D S+S+FF N +     I     KG+I  LKARAVLIDMEEGVV+ I+K  + ++FD +QLITDVSG GNNWATG++ YG +Y EQISE IR +AELCDCLQCFF++HSMGGGTGSG+GT+V  +L D+YP+VYRF  AV+PS DDDVITSPYNSVL +++LTE ADCV+PIEN +L+                 R++ T + +S  K +S            + KPFDAMN+IVANL+LN+TSS+RFEG+LNVDLNEI+MNLVPFPKLHYL+++Q PLY+L     P   PRR+DQ+F D+F+KD Q+I  +PK + YLACAL++RGNVE+SDIRRNIER + +LKF+ WN+EGWK G CSV P GQ YSLL L+NN+ I NTF EL  +F KLYKRK +
Sbjct:    5 IVVQVGQCGNQIGCRFWDLALREHASTNKTGVFDESLSSFFRNVDTRLKDIPVGNSKGKIKSLKARAVLIDMEEGVVNNILKGPLHDVFDCQQLITDVSGCGNNWATGHMLYGHQYKEQISETIRHAAELCDCLQCFFLIHSMGGGTGSGVGTYVLNLLHDDYPDVYRFTTAVYPSADDDVITSPYNSVLAMHQLTEHADCVLPIENQALVDICNKVSSSLPPSRPGKRVMATDSSHSHVKSNSAITSGEGGITKGADKPFDAMNNIVANLILNMTSSARFEGSLNVDLNEITMNLVPFPKLHYLVSSQTPLYALTDVKLP---PRRLDQMFTDAFSKDHQLIKADPKHNLYLACALILRGNVEVSDIRRNIERLKPSLKFIHWNQEGWKTGLCSVPPVGQPYSLLTLANNSCIKNTFVELKDRFMKLYKRKAH 435          
BLAST of TUBE1 vs. TrEMBL
Match: K1QYQ3 (Tubulin epsilon chain (Fragment) OS=Crassostrea gigas OX=29159 GN=CGI_10025274 PE=3 SV=1)

HSP 1 Score: 488.034 bits (1255), Expect = 3.772e-166
Identity = 256/434 (58.99%), Postives = 322/434 (74.19%), Query Frame = 2
Query:   65 LGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIY-------KGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNW-ATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSR--------------------------KPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKVN 1264
            +GQCGNQIG RFWDLAL+EH+ V KNG YD S+ +FF N ++   +         +G+I  LKARAVL+DMEEGVVSE+ K  ++ +FD +QLITDVSGSGNNW A G+  YG +Y E++SE IR++AE CDCLQCFF+LHSMGGGTGSG+GT +  +LADEYP+VYRFV AV+PS +DDV+TSPYNSVL +++LTE ADCV+PIEN +L+ +V   NK   S  S+    R                          KPFD+MN+IVANLLLN+TSS+RFEG+LNVDLNEI+MNLVPFPKLHYL+++Q PL+SL     P   PRR+DQ+F+D+F++D Q+I  +PK   YLACAL+VRGNVEISD+RRNIER + NLKF+ WN EGWK G CSV P GQ YSLL L+NNT +HNTF +L  +FN+LYKRK +
Sbjct:    1 VGQCGNQIGYRFWDLALREHAAVNKNGIYDESVGSFFRNVDSRYENASDIPFGQGQGKIKSLKARAVLVDMEEGVVSEMTKGPLREVFDFQQLITDVSGSGNNWQAVGHKMYGTQYREKLSETIRRAAEFCDCLQCFFVLHSMGGGTGSGVGTSILNLLADEYPDVYRFVTAVYPSSEDDVVTSPYNSVLAMHELTEKADCVLPIENQALVDIV---NKIGQSVPSAKLGKRVYNASGVKAGSAIIDGEGGLSKASDEKPFDSMNNIVANLLLNMTSSARFEGSLNVDLNEITMNLVPFPKLHYLVSSQTPLFSLSDVHLP---PRRLDQMFSDAFSRDHQLIKADPKHSLYLACALMVRGNVEISDVRRNIERLKPNLKFIHWNNEGWKTGLCSVPPVGQNYSLLTLANNTCVHNTFVDLRDRFNRLYKRKAH 428          
BLAST of TUBE1 vs. TrEMBL
Match: V4AHB8 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_224456 PE=3 SV=1)

HSP 1 Score: 487.649 bits (1254), Expect = 6.842e-166
Identity = 254/432 (58.80%), Postives = 322/432 (74.54%), Query Frame = 2
Query:   53 ITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIY-------KGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLI-----------------RMVKTFNKYSDSKESSND----KSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKVN 1264
            I +Q+GQCGNQIG +FWDLALKEH+ V K G YD ++ +FF N ++  +          KG+I  LKARAVL+DMEEGVVSEIMK  ++++FD KQLITDVSG GNNWA GN  YG +Y E ISE IR++AE CDCLQCFFILHSMGGGTGSG+GT V  +LADEYP+VYRFV AV+PS +DDV+TSPYNSVL + +LTE ADCV+P+EN +L+                 R+  T N  +DS  ++ D    +  KPFDAMN+IVANLLLN+TSS+RFEG+LNVDLNEI+MNLVP+P+LHYL+ +Q+PLY  +    P   PRR+DQ+F D+F+KD Q+I  +PK   YLAC+L+VRGNVE+SDIRRNI+R + NLKF+ WN++GWK G C++ P GQ YSLL +SNNT I ++F  L  +F KLYKRK +
Sbjct:    6 IVVQVGQCGNQIGCQFWDLALKEHASVNKQGIYDEALCSFFRNVDSRYDDPVNISLSNGKGRIRALKARAVLVDMEEGVVSEIMKGPLRDVFDCKQLITDVSGCGNNWAVGNKMYGGQYGEMISETIRRAAEHCDCLQCFFILHSMGGGTGSGVGTFVLNLLADEYPDVYRFVTAVYPSGEDDVVTSPYNSVLAMRELTEHADCVLPVENQALVDIVNKISQAIPSGKTGKRVYSTSNIKTDSTLTAIDNTTCRDEKPFDAMNNIVANLLLNMTSSARFEGSLNVDLNEITMNLVPYPRLHYLVTSQSPLYVFKDVHLP---PRRLDQMFTDAFSKDHQLIKADPKHSLYLACSLMVRGNVEMSDIRRNIDRLKPNLKFIRWNEDGWKTGLCNIPPVGQPYSLLTMSNNTCIRDSFTSLKDRFVKLYKRKAH 434          
BLAST of TUBE1 vs. Ensembl Cavefish
Match: tube1 (tubulin epsilon 1 [Source:NCBI gene;Acc:103027558])

HSP 1 Score: 465.692 bits (1197), Expect = 7.890e-161
Identity = 235/424 (55.42%), Postives = 309/424 (72.88%), Query Frame = 2
Query:   53 ITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFV-----XXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSD---------------SKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKVN 1264
            + +Q+GQCGNQ+G RFWDLAL+EH++V K G YD ++S+FF       ++         +ISGL+ARAVL+DMEEGV+SE+++  ++ LF   QLI+DVSGSGNNWA G+  YG  Y EQI + +R++AE CDCLQCFFI+HSMGGGTGSGLGT V ++L DE+PEV R V AV+PS +DDVITSPYNSVL + +LTE ADCV+PIEN SL+ +V      +                S +    K+ KPFDAMN+IVANLLLN+TSS+RFEG+LN+DLNEI+MNLVPFP+LHYL+++  PLY+L     P    RR+DQ+F D+F+KD Q++  +PK + YLACAL++RGNV++SD+RRNIER R  L FV WN EGWK G CSV P G  +SLL L+NNT +  +F EL  +F +LY++K +
Sbjct:    5 VVVQVGQCGNQVGCRFWDLALREHAHVNKKGIYDEALSSFFQNVDPRRSDGGGGGATGSRISGLRARAVLVDMEEGVLSEVLQGPLRQLFSTTQLISDVSGSGNNWAVGHHSYGSVYREQIVDQVRRAAEQCDCLQCFFIIHSMGGGTGSGLGTRVLKLLEDEFPEVCRLVTAVYPSAEDDVITSPYNSVLAMRELTEHADCVLPIENQSLVDIVSKIQHMAHTGKPGSVIKKDSTIISGQGGVAKTEKPFDAMNNIVANLLLNITSSARFEGSLNMDLNEIAMNLVPFPRLHYLVSSLTPLYTLADVNIPT---RRLDQMFTDAFSKDHQLMRADPKHNLYLACALMLRGNVQLSDLRRNIERLRPTLSFVQWNTEGWKTGLCSVPPVGHTHSLLALANNTCVKPSFMELRERFVRLYRKKAH 425          
BLAST of TUBE1 vs. Ensembl Cavefish
Match: tube1 (tubulin epsilon 1 [Source:NCBI gene;Acc:103027558])

HSP 1 Score: 448.358 bits (1152), Expect = 2.414e-154
Identity = 228/417 (54.68%), Postives = 297/417 (71.22%), Query Frame = 2
Query:   59 LQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSD---------------SKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKVN 1264
            ++ GQCGNQ+G RFWDLAL+EH++V K G YD ++S+FF                     AVL+DMEEGV+SE+++  ++ LF   QLI+DVSGSGNNWA G+  YG  Y EQI + +R++AE CDCLQCFFI+HSMGGGTGSGLGT V ++L DE+PEV R V AV+PS +DDVITSPYNSVL + +LTE ADCV+PIEN SL+ +V      +                S +    K+ KPFDAMN+IVANLLLN+TSS+RFEG+LN+DLNEI+MNLVPFP+LHYL+++  PLY+L     P    RR+DQ+F D+F+KD Q++  +PK + YLACAL++RGNV++SD+RRNIER R  L FV WN EGWK G CSV P G  +SLL L+NNT +  +F EL  +F +LY++K +
Sbjct:    6 IRFGQCGNQVGCRFWDLALREHAHVNKKGIYDEALSSFF-------------------QNAVLVDMEEGVLSEVLQGPLRQLFSTTQLISDVSGSGNNWAVGHHSYGSVYREQIVDQVRRAAEQCDCLQCFFIIHSMGGGTGSGLGTRVLKLLEDEFPEVCRLVTAVYPSAEDDVITSPYNSVLAMRELTEHADCVLPIENQSLVDIVSKIQHMAHTGKPGSVIKKDSTIISGQGGVAKTEKPFDAMNNIVANLLLNITSSARFEGSLNMDLNEIAMNLVPFPRLHYLVSSLTPLYTLADVNIPT---RRLDQMFTDAFSKDHQLMRADPKHNLYLACALMLRGNVQLSDLRRNIERLRPTLSFVQWNTEGWKTGLCSVPPVGHTHSLLALANNTCVKPSFMELRERFVRLYRKKAH 400          
BLAST of TUBE1 vs. Ensembl Cavefish
Match: tube1 (tubulin epsilon 1 [Source:NCBI gene;Acc:103027558])

HSP 1 Score: 414.075 bits (1063), Expect = 3.761e-141
Identity = 210/365 (57.53%), Postives = 272/365 (74.52%), Query Frame = 2
Query:  215 QISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSD---------------SKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKVN 1264
            +ISGL+ARAVL+DMEEGV+SE+++  ++ LF   QLI+DVSGSGNNWA G+  YG  Y EQI + +R++AE CDCLQCFFI+HSMGGGTGSGLGT V ++L DE+PEV R V AV+PS +DDVITSPYNSVL + +LTE ADCV+PIEN SL+ +V      +                S +    K+ KPFDAMN+IVANLLLN+TSS+RFEG+LN+DLNEI+MNLVPFP+LHYL+++  PLY+L     P    RR+DQ+F D+F+KD Q++  +PK + YLACAL++RGNV++SD+RRNIER R  L FV WN EGWK G CSV P G  +SLL L+NNT +  +F EL  +F +LY++K +
Sbjct:   23 RISGLRARAVLVDMEEGVLSEVLQGPLRQLFSTTQLISDVSGSGNNWAVGHHSYGSVYREQIVDQVRRAAEQCDCLQCFFIIHSMGGGTGSGLGTRVLKLLEDEFPEVCRLVTAVYPSAEDDVITSPYNSVLAMRELTEHADCVLPIENQSLVDIVSKIQHMAHTGKPGSVIKKDSTIISGQGGVAKTEKPFDAMNNIVANLLLNITSSARFEGSLNMDLNEIAMNLVPFPRLHYLVSSLTPLYTLADVNIPT---RRLDQMFTDAFSKDHQLMRADPKHNLYLACALMLRGNVQLSDLRRNIERLRPTLSFVQWNTEGWKTGLCSVPPVGHTHSLLALANNTCVKPSFMELRERFVRLYRKKAH 384          
BLAST of TUBE1 vs. Ensembl Cavefish
Match: zgc:55461 (tubulin beta-4B chain [Source:NCBI gene;Acc:103024068])

HSP 1 Score: 187.193 bits (474), Expect = 2.566e-53
Identity = 126/416 (30.29%), Postives = 209/416 (50.24%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSL----IRMVK-TFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNI--ERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+++ LQ GQCGNQIG++FW++   EH  +   G Y                ++Y  + +G K   RAVL+D+E G +  +       +F     +   SG+GNNWA G+   G +  + + + +RK AE CDCLQ F + HS+GGGTGSG+GT +   + +EYP+      +V PS    D +  PYN+ L +++L E  D    I+N +L     R +K T   Y D               +N +V+  +  +T+  RF G LN DL ++++N+VPFP+LH+ +   APL S  S+    ++   + ++    F     M   +P+   YL  A + RG + + ++   +   + +N+  FV W     K   C + PRG + +   + N+T+I   F  +  +F  +++RK 
Sbjct:    2 REIVHLQAGQCGNQIGAKFWEVISDEHG-IDPTGAYHGDSD-----LQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQVFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGD---------------LNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ---YRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKA 393          
BLAST of TUBE1 vs. Ensembl Cavefish
Match: TUBB2A (tubulin beta-2A chain [Source:NCBI gene;Acc:103041736])

HSP 1 Score: 187.963 bits (476), Expect = 7.331e-53
Identity = 124/416 (29.81%), Postives = 209/416 (50.24%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSL----IRMVK-TFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNI--ERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+++ +Q GQCGNQIG++FW++   EH  +   G Y                ++Y  + +G K   RA+L+D+E G +  +       +F     +   SG+GNNWA G+   G +  + + + +RK +E CDCLQ F + HS+GGGTGSG+GT +   + +EYP+      +V PS    D +  PYN+ L +++L E  D    I+N +L     R +K T   Y D               +N +V+  +  +T+  RF G LN DL ++++N+VPFP+LH+ +   APL S  S+    ++   + ++    F     M   +P+   YL  A + RG + + ++   +   + +N+  FV W     K   C + PRG + S   + N+T+I   F  +  +F  +++RK 
Sbjct:   79 REIVHIQAGQCGNQIGAKFWEVISDEHG-IDATGSYQGESE-----LQLERINVYYNEATGSKFVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETFSIDNEALYDICFRTLKLTTPTYGD---------------LNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ---YRALSVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLSVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFRRISEQFTAMFRRKA 470          
BLAST of TUBE1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001368.1 (pep scaffold:Pmarinus_7.0:GL476337:866089:875956:-1 gene:ENSPMAG00000001230.1 transcript:ENSPMAT00000001368.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 461.84 bits (1187), Expect = 6.268e-160
Identity = 233/424 (54.95%), Postives = 313/424 (73.82%), Query Frame = 2
Query:   53 ITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFF--------VXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKS------------RKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKVN 1264
            + +Q+GQCGNQIG RFWDLAL+EH+ V K G YD ++S+FF                   +  I  LKARAVLIDMEEGVV+E+++  ++++FD KQLITDVSGSGNNWA GN  YG ++ E+I E +R +AE CD LQCFF++HSMGGGTGSGLGT V ++L DE+P+V+RFV A++PS +DDV+TSPYNSVL + +LTE ADCV+PIEN +L+ +V   N  +   +S   ++             KPFD MN+IVANL+LN+TSSSRFEG+LNVDLNEI+MNLVPFP+LHYL+++  PLY+L     P   PRR+DQ+F+D+F+K+ Q++ V+P+   YLACAL+VRGNV++SD+RRNIER + +L FV WN+EGWK G CSV P G  +SLL L+NNT + +TF ++  +F +LY+RK +
Sbjct:    5 VVVQVGQCGNQIGCRFWDLALREHAAVNKKGIYDEALSSFFRNVDTRPGTGEEVDIPVDSRSTIRSLKARAVLIDMEEGVVNELLQGPLRDVFDQKQLITDVSGSGNNWAVGNKVYGAQFREKILERLRVTAEHCDSLQCFFLIHSMGGGTGSGLGTFVLRLLEDEFPDVHRFVMALYPSAEDDVVTSPYNSVLAMRELTEHADCVLPIENQALVDIVNKINHAAALGKSVRSQTTLSSSHGCLKGQEKPFDTMNNIVANLMLNMTSSSRFEGSLNVDLNEITMNLVPFPRLHYLVSSLTPLYALADVALP---PRRLDQMFSDAFSKENQLLRVDPRRSLYLACALMVRGNVQLSDVRRNIERLKPSLHFVDWNEEGWKTGLCSVPPVGYPHSLLALANNTCVKHTFADIQERFARLYRRKAH 425          
BLAST of TUBE1 vs. Ensembl Sea Lamprey
Match: TUBA3C (tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:12408])

HSP 1 Score: 165.236 bits (417), Expect = 7.993e-47
Identity = 112/373 (30.03%), Postives = 188/373 (50.40%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYV--------KKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIE--RYRNNLKFVPWNKEGW 1129
            R+ I++ +GQ G QIG+  W+L   EH           K  G  D+S +TFF       +            RAV +D+E  VV E+   + + LF  +QLIT    + NN+A G+   G +  + + + IRK A+ C  LQ F I HS GGGTGSG  + + + L+ +Y +  +   A++P+      +  PYNS+L  +   E +DC   ++N ++  + +           + D  R  +  +N ++  ++ ++T+S RF+G LNVDL E   NLVP+P++H+ +A  AP+ S E   +   +   + +I    F    QM+  +P+   Y+AC +L RG+V   D+   I   + +  ++FV W   G+
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHV----------PRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICR----------RNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYH---EQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGF 351          
BLAST of TUBE1 vs. Ensembl Sea Lamprey
Match: tubg1 (tubulin, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-836])

HSP 1 Score: 166.777 bits (421), Expect = 1.782e-46
Identity = 128/435 (29.43%), Postives = 213/435 (48.97%), Query Frame = 2
Query:   38 MPRDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNG-------EYDNSMSTFFVXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQ--LITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDD--DVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLES-----------KMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNN--LKFVPWNKEGWKVGHCSVAP---RGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            MPR++ITLQLGQCGNQIG  FW     EH  +  +G       E  +    FF          Y+        RAVL+D+E  V++ I+ SS  NL++ +   L     G+GNNWA+G+ + G K HE+I + I + A+  D L+   +   +     + L  +  +     +P+      +VFP+ D+  DV+  PYNS+L L +LT+ ADCV+ ++N +L R+       +D     N      F  +N +V+ ++   T++ R+ G +N DL  +  +L+P P+LH+L+    PL + +S            M  L QP+ +      S  +D Q        H Y+A   +++G V+ + + ++++R R      F+PW     +V     +P      R S L ++N+TSI + F     +++KL KR+ 
Sbjct:    1 MPREIITLQLGQCGNQIGFEFWKQLCAEHG-ISPDGILEDFATEGTDRKDVFF----------YQADDEHYIPRAVLLDLEPRVINSIVNSSYANLYNPENIYLSEHGGGAGNNWASGHSQ-GEKIHEEIFDIIDREADGSDSLEKCPLTRRLSATNWNELCKYFCR-----FPKKLIQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIA------TDRLHIQNPS----FSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNV----MVSTGRDRQT------NHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLTSAHRVSGLMMANHTSISSLFDRTCKQYDKLRKREA 398          
BLAST of TUBE1 vs. Ensembl Sea Lamprey
Match: tubb2 (tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GENE-050522-384])

HSP 1 Score: 155.606 bits (392), Expect = 4.956e-43
Identity = 117/399 (29.32%), Postives = 194/399 (48.62%), Query Frame = 2
Query:   95 RFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEY-PEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSL----IRMVK-TFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNI--ERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRK 1258
            +FW++   EH  +   G Y                ++Y  + SG K   RA+L+D+E G +  +       +F     +   SG+GNNWA G+   G +  + + + +RK AE CDCLQ F + HS+GGGTGSG+GT +   + +EY  +V   V A  PS    D +  PYN+ L +++L E  D    I+N +L     R +K T   Y D               +N +V+  +  +T+  RF G LN DL ++++N+VPFP+LH+ +   APL S  S+    ++   + ++    F     M   +P+   YL  A + RG + + ++   +   + +N+  FV W     K   C + PRG + S   + N+T+I   F  +  +F  +++RK
Sbjct:    1 QFWEVISDEHG-IDPTGSYHGDSD-----LQLERINVYYNEASGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYIIQVLYTVVASGPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGD---------------LNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ---YRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRK 375          
BLAST of TUBE1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001139.1 (pep scaffold:Pmarinus_7.0:GL478075:30403:34872:1 gene:ENSPMAG00000001018.1 transcript:ENSPMAT00000001139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 129.798 bits (325), Expect = 9.858e-34
Identity = 103/387 (26.61%), Postives = 177/387 (45.74%), Query Frame = 2
Query:   38 MPRDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEY----------DNSMSTFFVXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSE---IMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDA-------MNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIE--RYRNNLKFVPWNKEGW 1129
            + RD I++ +GQ G Q+G+  W+L   EH  +K +G            D+S +TFF    +  +            RA+ ID+E  V+ E   +   ++        ++       +    G    G K   ++    R  +E C  LQ F + HS GGGTGSG  + + + L+ +Y +  +    ++P+      +  PYN++L  +   E +DC   ++N                 E+  D  RK  D        +N ++A ++ ++T+S RF+G LNVDLNE   NLVP+P++H+ +   AP+ S E   +   +   + +I    F    QM+  +P+   Y+AC LL RG++   D+   I   + R  ++FV W   G+
Sbjct:    1 LQRDCISIHIGQAGVQMGNACWELYCLEHG-IKPDGHLATHPDVTSVVDSSFNTFFSETGSGKHV----------PRAIFIDLEPSVIGEPCGLRTLTVGGXLRMSMMLAGREVRSSRIWRGQKGGGRKICSRVLRRNRPQSERCTGLQGFLLFHSFGGGTGSGFTSLLMERLSADYGKKSKLEFCIYPAPQVSTAVVEPYNAILTTHTTLEHSDCSFMVDN-----------------EAIYDICRKKLDIDFPSYFNLNRLIAQMVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLTTYAPVISAEKAYH---EQLSVAEITNACFEPSNQMVKCDPRNGKYMACCLLYRGDIVPKDVNTAIAIIKSRRAVRFVDWCPTGF 356          
BLAST of TUBE1 vs. Ensembl Yeast
Match: TUB3 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; expressed at lower level than Tub1p; TUB3 has a paralog, TUB1, that arose from the whole genome duplication [Source:SGD;Acc:S000004593])

HSP 1 Score: 192.971 bits (489), Expect = 1.934e-56
Identity = 131/417 (31.41%), Postives = 222/417 (53.24%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRN--NLKFVPWNKEGWKVGHC----SVAPRGQ----RYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R++I++ +GQ G QIG+  W+L   EH  +K++G  ++ +S         S   ++        RA+ +D+E  V+ E+     K LF  +QLI     + NN+A G+   G +  +++ E IRK A+ CD LQ F   HS+GGGTGSGLG+ + + L+ EY +  +   AV+P+      +  PYN+VL  +   E ADC   ++N ++  + K           +   SR  F  +N ++A ++ ++T+S RF+G+LNVDLNE   NLVP+P++H+ + + AP+    SK     +   + +I    F    QM+  +P    Y+A  LL RG+V   D++R +E+ +N   ++ V W   G+K+G C    SV P  +      ++  LSN T+I + +  +  KF+ +Y ++ 
Sbjct:    2 REVISINVGQAGCQIGNACWELYSLEHG-IKEDGHLEDGLSKPKGGEEGFSTFFHETGYGKFVPRAIYVDLEPNVIDEVRTGRFKELFHPEQLINGKEDAANNYARGHYTVGREIVDEVEERIRKMADQCDGLQGFLFTHSLGGGTGSGLGSLLLENLSYEYGKKSKLEFAVYPAPQLSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDICK----------RNLGISRPSFSNLNGLIAQVISSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPIL---SKKRATHESNSVSEITNACFEPGNQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKKTVQMVDWCPTGFKIGICYEPPSVIPSSELANVDRAVCMLSNTTAIADAWKRIDQKFDLMYAKRA 404          
BLAST of TUBE1 vs. Ensembl Yeast
Match: TUB1 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; relative distribution to nuclear foci increases upon DNA replication stress; TUB1 has a paralog, TUB3, that arose from the whole genome duplication [Source:SGD;Acc:S000004550])

HSP 1 Score: 190.274 bits (482), Expect = 2.051e-55
Identity = 131/417 (31.41%), Postives = 219/417 (52.52%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRN--NLKFVPWNKEGWKVGHCSVAPRGQRYSLLN--------LSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R++I++ +GQ G QIG+  W+L   EH  +K +G  ++ +S         S   ++        RA+ +D+E  V+ E+     K+LF  +QLI+    + NN+A G+   G +    + + IRK A+ CD LQ F   HS+GGGTGSGLG+ + + L+ EY +  +   AV+P+      +  PYN+VL  +   E ADC   ++N ++  M K           + D  R  F  +N+++A ++ ++T+S RF+G+LNVDLNE   NLVP+P++H+ + + +P+    SK     +   + +I    F    QM+  +P+   Y+A  LL RG+V   D++R +E+ +N   ++ V W   G+K+G C   P     S L         LSN TSI   +  +  KF+ +Y ++ 
Sbjct:    2 REVISINVGQAGCQIGNACWELYSLEHG-IKPDGHLEDGLSKPKGGEEGFSTFFHETGYGKFVPRAIYVDLEPNVIDEVRNGPYKDLFHPEQLISGKEDAANNYARGHYTVGREILGDVLDRIRKLADQCDGLQGFLFTHSLGGGTGSGLGSLLLEELSAEYGKKSKLEFAVYPAPQVSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDMCK----------RNLDIPRPSFANLNNLIAQVVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYSPVL---SKSKAFHESNSVSEITNACFEPGNQMVKCDPRDGKYMATCLLYRGDVVTRDVQRAVEQVKNKKTVQLVDWCPTGFKIGICYEPPTATPNSQLATVDRAVCMLSNTTSIAEAWKRIDRKFDLMYAKRA 404          
BLAST of TUBE1 vs. Ensembl Yeast
Match: TUB2 (Beta-tubulin; associates with alpha-tubulin (Tub1p and Tub3p) to form tubulin dimer, which polymerizes to form microtubules; mutation in human ortholog is associated with congenital fibrosis of the extraocular muscles (CFEOM) with polymicrogyria [Source:SGD;Acc:S000001857])

HSP 1 Score: 185.267 bits (469), Expect = 1.838e-53
Identity = 126/411 (30.66%), Postives = 214/411 (52.07%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPS-DDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERY--RNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R++I +  GQCGNQIG+ FW+    EH  +  NG Y                ++Y  + S  K   R++ +D+E G +  +  S+I NLF     I   S +GN WA G+   G +  + + + IR+ AE CD LQ F I HS+GGGTGSG+GT +   + +E+P+      +V PS    D +  PYN+ L +++L E +D    I+N +L  + +   K +          +  +  +N++V++++  +T+S R+ G LN DL ++++NLVPFP+LH+ +   APL ++ S+    F+   + ++    F     M   +P+   YL  A   RG V + ++   + +   +N+  FV W     +   CSVAP+G   +   ++N+TSI   F  +  +F+ ++KRK 
Sbjct:    2 REIIHISTGQCGNQIGAAFWETICGEHG-LDFNGTYHGHDDI-----QKERLNVYFNEASSGKWVPRSINVDLEPGTIDAVRNSAIGNLFRPDNYIFGQSSAGNVWAKGHYTEGAELVDSVMDVIRREAEGCDSLQGFQITHSLGGGTGSGMGTLLISKIREEFPDRMMATFSVLPSPKTSDTVVEPYNATLSVHQLVEHSDETFCIDNEALYDICQRTLKLN----------QPSYGDLNNLVSSVMSGVTTSLRYPGQLNSDLRKLAVNLVPFPRLHFFMVGYAPLTAIGSQS---FRSLTVPELTQQMFDAKNMMAAADPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQSKNSDYFVEWIPNNVQTAVCSVAPQGLDMAATFIANSTSIQELFKRVGDQFSAMFKRKA 393          
BLAST of TUBE1 vs. Ensembl Yeast
Match: TUB4 (Gamma-tubulin; involved in nucleating microtubules from both the cytoplasmic and nuclear faces of the spindle pole body; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004202])

HSP 1 Score: 117.087 bits (292), Expect = 8.873e-29
Identity = 110/434 (25.35%), Postives = 199/434 (45.85%), Query Frame = 2
Query:   38 MPRDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNG---------EYDNSMSTFFVXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQ--LITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMV-KTFNKYSDSKESSNDKSRKP---FDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKE------GWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRK--VNNF 1270
            M  ++ITLQ GQCGN +G   W    KEH+ +  +G         E D+    FF           +   +    RA+++D E  V++++ +++ +  FD +   + +D + +GN+WA G  + G +  + I   I K  +  D  + F +LHS+ GGTGSGLG+++ + L D YP+      +VFP+   +V+   YN++L L +L E +D  +  +N SL+ +  K F              R P       N +++ ++ ++T+S RF   +   ++ I   L+P P+LH+L  +  P  S     +   +      +  D       ++       TY      + GNVE   I R + + +  +KF  W+        G +  +  + P     S + LSN +++ N F      F+K++ +   +NN+
Sbjct:    1 MGGEIITLQAGQCGNHVGKFLWSQLAKEHA-IGTDGLSQLPDSSTERDDDTKPFF----------RENSRNKFTPRAIMMDSEPSVIADV-ENTFRGFFDPRNTWVASDGASAGNSWANG-YDIGTRNQDDILNKIDKEIDSTDNFEGFQLLHSVAGGTGSGLGSNLLEALCDRYPKKILTTYSVFPARSSEVVVQSYNTILALRRLIEDSDATVVFDNASLLNISGKVF--------------RNPNIDLQHTNQLISTIISSVTNSIRFPSYMYSSMSSIYSTLIPSPELHFLSPSFTPFTSDYIHDDIAHKGHSSYDVMLDLLDPSNSLVSTAMNNPTYFNVYNTIIGNVEPRQISRAMTKLQQRIKFPSWSSSAMHVNIGRRSPYLPLQPNENEVSGMMLSNMSTVVNVFENACNTFDKVFAKGAFLNNY 407          
BLAST of TUBE1 vs. Ensembl Nematostella
Match: EDO46346 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQD7])

HSP 1 Score: 494.582 bits (1272), Expect = 1.859e-172
Identity = 258/434 (59.45%), Postives = 325/434 (74.88%), Query Frame = 2
Query:   53 ITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXI----YKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLI-----------------RMVKTFNKYSDSKESS---------NDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKVN 1264
            I +Q+GQCGNQIG RFWDLAL+EH+   K G +D S+S+FF N +     I     KG+I  LKARAVLIDMEEGVV+ I+K  + ++FD +QLITDVSG GNNWATG++ YG +Y EQISE IR +AELCDCLQCFF++HSMGGGTGSG+GT+V  +L D+YP+VYRF  AV+PS DDDVITSPYNSVL +++LTE ADCV+PIEN +L+                 R++ T + +S  K +S            + KPFDAMN+IVANL+LN+TSS+RFEG+LNVDLNEI+MNLVPFPKLHYL+++Q PLY+L     P   PRR+DQ+F D+F+KD Q+I  +PK + YLACAL++RGNVE+SDIRRNIER + +LKF+ WN+EGWK G CSV P GQ YSLL L+NN+ I NTF EL  +F KLYKRK +
Sbjct:    5 IVVQVGQCGNQIGCRFWDLALREHASTNKTGVFDESLSSFFRNVDTRLKDIPVGNSKGKIKSLKARAVLIDMEEGVVNNILKGPLHDVFDCQQLITDVSGCGNNWATGHMLYGHQYKEQISETIRHAAELCDCLQCFFLIHSMGGGTGSGVGTYVLNLLHDDYPDVYRFTTAVYPSADDDVITSPYNSVLAMHQLTEHADCVLPIENQALVDICNKVSSSLPPSRPGKRVMATDSSHSHVKSNSAITSGEGGITKGADKPFDAMNNIVANLILNMTSSARFEGSLNVDLNEITMNLVPFPKLHYLVSSQTPLYALTDVKLP---PRRLDQMFTDAFSKDHQLIKADPKHNLYLACALILRGNVEVSDIRRNIERLKPSLKFIHWNQEGWKTGLCSVPPVGQPYSLLTLANNSCIKNTFVELKDRFMKLYKRKAH 435          
BLAST of TUBE1 vs. Ensembl Nematostella
Match: EDO41766 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3G2])

HSP 1 Score: 189.119 bits (479), Expect = 1.958e-54
Identity = 131/425 (30.82%), Postives = 217/425 (51.06%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYV--------KKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIE--RYRNNLKFVPWNKEGWKVG----HCSVAPRGQ----RYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+ I++ +GQ G QIG+  W+L   EH           K  G  D+S +TFF       +            RAV +D+E  VV E+   S + LF  +QLIT    + NN+A G+   G +  +Q+ + +RK A+ C  LQ FFI HS GGGTGSG  + + + L+ +Y +  +   AV+P+      +  PYNS+L  +   E +DC   ++N ++  + +           + D  R  +  +N ++  ++ ++T+S RF+G+LNVDLNE   NLVP+P++H+ +A  AP+ S E   +   +   + +I    F    Q++  +P+   Y+AC LL RG+V   D+   I   + +  ++FV W   G+KVG      +V P G     + ++  LSN T+I   +  L  KF+ +Y ++ 
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTQGGGDDSFNTFFSETGAGKHV----------PRAVFVDLEPTVVDEVRTGSYRQLFHPEQLITGKEDAANNYARGHYTIGKQQVDQVLDRLRKLADQCSGLQGFFIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLEFAVYPAPHIASAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICR----------RNLDIERPSYTNLNRLIGQIVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLATYAPVISAEKAYH---EQLTVAEITNACFEPANQLVKCDPRHGKYMACCLLFRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRA 403          
BLAST of TUBE1 vs. Ensembl Nematostella
Match: EDO35958 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJX9])

HSP 1 Score: 187.963 bits (476), Expect = 4.542e-54
Identity = 125/416 (30.05%), Postives = 210/416 (50.48%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSL----IRMVK-TFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNI--ERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R++++LQ GQCGNQIG++FW++   EH  +   G Y                ++Y  + +G K   R+VLID+E G +  +       +F     +   SG+GNNWA G+   G +  + + + +RK AE CDC+Q F + HS+GGGTGSG+GT +   + +EYP+      ++ PS    D +  PYN+ L +++L E  D    I+N +L     R +K T   Y D               +N +V+  +  +T+  RF G LN DL ++++N+VPFP+LH+ +   APL S  S+    ++   + ++    F     M   +P+   YL  A + RG + + ++   +   + +N+  FV W     K   C + PRG + S   + N+T+I   F  +  +F  +++RK 
Sbjct:    2 REIVSLQAGQCGNQIGAKFWEVISDEHG-IDPTGTYHGDSD-----LQLERINVYYNEATGGKYVPRSVLIDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELMDSVLDVVRKEAESCDCIQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSIVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGD---------------LNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ---YRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKA 393          
BLAST of TUBE1 vs. Ensembl Nematostella
Match: EDO39945 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8I3])

HSP 1 Score: 186.422 bits (472), Expect = 1.801e-53
Identity = 125/416 (30.05%), Postives = 208/416 (50.00%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSL----IRMVK-TFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNI--ERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+++  Q GQCGNQIG++FW++   EH  +   G Y                ++Y  + +G K   RA+L+D+E G +  +       +F     +   SG+GNNWA G+   G +  + + + +RK AE CDCLQ F + HS+GGGTGSG+GT +   + +EYP+      +V PS    D +  PYN+ L +++L E  D    I+N +L     R +K T   Y D               +N +V+  +  +T+  RF G LN DL ++++N+VPFP+LH+ +   APL S  S+    ++   + ++    F     M   +P+   YL  A + RG + + ++   +   + +N+  FV W     K   C + PRG + S   + N+T+I   F  +  +F  +++RK 
Sbjct:    2 REIVHCQAGQCGNQIGAKFWEVISDEHG-IDPTGTYHGDSD-----LQLERINVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGD---------------LNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ---YRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKA 393          
BLAST of TUBE1 vs. Ensembl Nematostella
Match: EDO45429 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT99])

HSP 1 Score: 183.726 bits (465), Expect = 1.737e-52
Identity = 131/427 (30.68%), Postives = 219/427 (51.29%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNG---------EYDNSMSTFFVXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIE--RYRNNLKFVPWNKEGWKVG----HCSVAPRG-----QRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+ I+L +GQ G QIG+  W+L   EH+ ++ +G           D+S +TFF           +        RAVL+D+E  V+ E+     + L+  +Q+I+    + NN+A G+   G +  E + + IRK  + C  LQ F I HS GGGTGSG  + +T+ L+ +Y +  +   AV+P+      +  PYNSVL  +   E +DC   ++N ++  + +           + D  R  +  +N ++  ++ ++TSS RF+G LNVDL E   NLVP+P++H+ +   AP+ S E   +   +   + QI    F  + QM+  +P+   Y+AC +L RG+V   D+   I   + R +++FV W   G+KVG      +V P G     QR +L  L+N T+I   + +L  KF+ +Y ++ 
Sbjct:    2 RECISLHIGQAGVQIGNACWELYCLEHA-IQPDGLMLGGPSEEAGDDSFNTFFS----------EAAAGKYVPRAVLVDLEPTVIDEVRTGMYRYLYHPEQMISGKEDAANNYARGHYTIGKEMVEVVMDKIRKMTDQCSGLQGFLIFHSFGGGTGSGFASLITEHLSVDYGKKSKLEFAVYPAPHISTAVVEPYNSVLTTHTTLEHSDCTFMVDNEAIYDLCR----------RNLDVERPGYANLNRLIGQIVSSITSSLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISPEKAYH---EQLTVAQITNMCFDPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIGAIKTRRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQR-ALCMLTNTTAIAEAWAKLNHKFDLMYAKRA 403          
BLAST of TUBE1 vs. Ensembl Medaka
Match: tube1 (tubulin epsilon 1 [Source:NCBI gene;Acc:105357241])

HSP 1 Score: 462.996 bits (1190), Expect = 4.372e-160
Identity = 237/420 (56.43%), Postives = 310/420 (73.81%), Query Frame = 2
Query:   53 ITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFF--VXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTF---------------NKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            + +Q+GQCGNQ+G RFWDLAL+E++ V K G YD++ S+FF  V+    +     GQI  LKARAVL+DMEEGV+S+I++  ++ LFD  QL+TDVSGSGNNWATG++ YG  Y E I + +RK+AELCDCLQCFF++HS+GGGTGSGLGT V  +L +E+P V R V +++PS +DDVITSPYNSVL + +LTE A CV+P+EN SL+ +V+                 N    S +    +  KPFDAMN+IVANLLLN+TSS+RFEG+LNVDLNEI+MNLVPFP+LHYL+ +  PLY+L + +N +  PRR+DQ+F+D+F+KD Q+I   PK   YLACAL+VRGNV +SD+RRNIER R +L FV WN+EGWK G CSV P G  +SLL L+NNT +   F EL  +F KLY++KV
Sbjct:    5 VVVQVGQCGNQVGYRFWDLALREYASVNKRGLYDDATSSFFRNVDWRKGAACSVGGQIQHLKARAVLVDMEEGVISQILQGPLRELFDSAQLLTDVSGSGNNWATGHMTYGSVYRELIVDKLRKAAELCDCLQCFFLIHSLGGGTGSGLGTRVLGLLEEEFPGVSRIVTSMYPSAEDDVITSPYNSVLAMRELTEHAHCVLPVENQSLMDIVQKIQMVAHGAKPELMVRRNATLSSGQGGVHEVEKPFDAMNNIVANLLLNMTSSARFEGSLNVDLNEIAMNLVPFPRLHYLVPSLTPLYTL-ADVNAV--PRRLDQMFSDAFSKDHQLIHANPKQSMYLACALMVRGNVHVSDLRRNIERLRPSLSFVSWNQEGWKTGLCSVPPVGHSHSLLALANNTCMKLNFMELKERFTKLYRKKV 421          
BLAST of TUBE1 vs. Ensembl Medaka
Match: tube1 (tubulin epsilon 1 [Source:NCBI gene;Acc:105357241])

HSP 1 Score: 462.225 bits (1188), Expect = 1.610e-159
Identity = 236/421 (56.06%), Postives = 310/421 (73.63%), Query Frame = 2
Query:   53 ITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFF--VXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTF---------------NKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKVN 1264
            + +Q+GQCGNQ+G RFWDLAL+E++ V K G YD++ S+FF  V+    +     GQI  LKARAVL+DMEEGV+S+I++  ++ LFD  QL+TDVSGSGNNWATG++ YG  Y E I + +RK+AELCDCLQCFF++HS+GGGTGSGLGT V  +L +E+P V R V +++PS +DDVITSPYNSVL + +LTE A CV+P+EN SL+ +V+                 N    S +    +  KPFDAMN+IVANLLLN+TSS+RFEG+LNVDLNEI+MNLVPFP+LHYL+ +  PLY+L + +N +  PRR+DQ+F+D+F+KD Q+I   PK   YLACAL+VRGNV +SD+RRNIER R +L FV WN+EGWK G CSV P G  +SLL L+NNT +   F EL  +F KLY++K +
Sbjct:    5 VVVQVGQCGNQVGYRFWDLALREYASVNKRGLYDDATSSFFRNVDWRKGAACSVGGQIQHLKARAVLVDMEEGVISQILQGPLRELFDSAQLLTDVSGSGNNWATGHMTYGSVYRELIVDKLRKAAELCDCLQCFFLIHSLGGGTGSGLGTRVLGLLEEEFPGVSRIVTSMYPSAEDDVITSPYNSVLAMRELTEHAHCVLPVENQSLMDIVQKIQMVAHGAKPELMVRRNATLSSGQGGVHEVEKPFDAMNNIVANLLLNMTSSARFEGSLNVDLNEIAMNLVPFPRLHYLVPSLTPLYTL-ADVNAV--PRRLDQMFSDAFSKDHQLIHANPKQSMYLACALMVRGNVHVSDLRRNIERLRPSLSFVSWNQEGWKTGLCSVPPVGHSHSLLALANNTCMKLNFMELKERFTKLYRKKAH 422          
BLAST of TUBE1 vs. Ensembl Medaka
Match: tube1 (tubulin epsilon 1 [Source:NCBI gene;Acc:105357241])

HSP 1 Score: 462.225 bits (1188), Expect = 1.610e-159
Identity = 236/421 (56.06%), Postives = 310/421 (73.63%), Query Frame = 2
Query:   53 ITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFF--VXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTF---------------NKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKVN 1264
            + +Q+GQCGNQ+G RFWDLAL+E++ V K G YD++ S+FF  V+    +     GQI  LKARAVL+DMEEGV+S+I++  ++ LFD  QL+TDVSGSGNNWATG++ YG  Y E I + +RK+AELCDCLQCFF++HS+GGGTGSGLGT V  +L +E+P V R V +++PS +DDVITSPYNSVL + +LTE A CV+P+EN SL+ +V+                 N    S +    +  KPFDAMN+IVANLLLN+TSS+RFEG+LNVDLNEI+MNLVPFP+LHYL+ +  PLY+L + +N +  PRR+DQ+F+D+F+KD Q+I   PK   YLACAL+VRGNV +SD+RRNIER R +L FV WN+EGWK G CSV P G  +SLL L+NNT +   F EL  +F KLY++K +
Sbjct:    5 VVVQVGQCGNQVGYRFWDLALREYASVNKRGLYDDATSSFFRNVDWRKGAACSVGGQIQHLKARAVLVDMEEGVISQILQGPLRELFDSAQLLTDVSGSGNNWATGHMTYGSVYRELIVDKLRKAAELCDCLQCFFLIHSLGGGTGSGLGTRVLGLLEEEFPGVSRIVTSMYPSAEDDVITSPYNSVLAMRELTEHAHCVLPVENQSLMDIVQKIQMVAHGAKPELMVRRNATLSSGQGGVHEVEKPFDAMNNIVANLLLNMTSSARFEGSLNVDLNEIAMNLVPFPRLHYLVPSLTPLYTL-ADVNAV--PRRLDQMFSDAFSKDHQLIHANPKQSMYLACALMVRGNVHVSDLRRNIERLRPSLSFVSWNQEGWKTGLCSVPPVGHSHSLLALANNTCMKLNFMELKERFTKLYRKKAH 422          
BLAST of TUBE1 vs. Ensembl Medaka
Match: tube1 (tubulin epsilon 1 [Source:NCBI gene;Acc:105357241])

HSP 1 Score: 448.743 bits (1153), Expect = 2.705e-154
Identity = 229/419 (54.65%), Postives = 307/419 (73.27%), Query Frame = 2
Query:   53 ITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTF---------------NKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKVN 1264
            + +Q+GQCGNQ+G RFWDLAL+E++ V K G YD++ S+FF N +   +      ++ +  +AVL+DMEEGV+S+I++  ++ LFD  QL+TDVSGSGNNWATG++ YG  Y E I + +RK+AELCDCLQCFF++HS+GGGTGSGLGT V  +L +E+P V R V +++PS +DDVITSPYNSVL + +LTE A CV+P+EN SL+ +V+                 N    S +    +  KPFDAMN+IVANLLLN+TSS+RFEG+LNVDLNEI+MNLVPFP+LHYL+ +  PLY+L + +N +  PRR+DQ+F+D+F+KD Q+I   PK   YLACAL+VRGNV +SD+RRNIER R +L FV WN+EGWK G CSV P G  +SLL L+NNT +   F EL  +F KLY++K +
Sbjct:    5 VVVQVGQCGNQVGYRFWDLALREYASVNKRGLYDDATSSFFRNVDWRWDECAGLTLAYVNPQAVLVDMEEGVISQILQGPLRELFDSAQLLTDVSGSGNNWATGHMTYGSVYRELIVDKLRKAAELCDCLQCFFLIHSLGGGTGSGLGTRVLGLLEEEFPGVSRIVTSMYPSAEDDVITSPYNSVLAMRELTEHAHCVLPVENQSLMDIVQKIQMVAHGAKPELMVRRNATLSSGQGGVHEVEKPFDAMNNIVANLLLNMTSSARFEGSLNVDLNEIAMNLVPFPRLHYLVPSLTPLYTL-ADVNAV--PRRLDQMFSDAFSKDHQLIHANPKQSMYLACALMVRGNVHVSDLRRNIERLRPSLSFVSWNQEGWKTGLCSVPPVGHSHSLLALANNTCMKLNFMELKERFTKLYRKKAH 420          
BLAST of TUBE1 vs. Ensembl Medaka
Match: tube1 (tubulin epsilon 1 [Source:NCBI gene;Acc:105357241])

HSP 1 Score: 427.943 bits (1099), Expect = 1.679e-146
Identity = 222/419 (52.98%), Postives = 291/419 (69.45%), Query Frame = 2
Query:   53 ITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTF---------------NKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKVN 1264
            + +Q+GQCGNQ+G RFWDLAL+E++ V K                                 AVL+DMEEGV+S+I++  ++ LFD  QL+TDVSGSGNNWATG++ YG  Y E I + +RK+AELCDCLQCFF++HS+GGGTGSGLGT V  +L +E+P V R V +++PS +DDVITSPYNSVL + +LTE A CV+P+EN SL+ +V+                 N    S +    +  KPFDAMN+IVANLLLN+TSS+RFEG+LNVDLNEI+MNLVPFP+LHYL+ +  PLY+L + +N +  PRR+DQ+F+D+F+KD Q+I   PK   YLACAL+VRGNV +SD+RRNIER R +L FV WN+EGWK G CSV P G  +SLL L+NNT +   F EL  +F KLY++K +
Sbjct:    5 VVVQVGQCGNQVGYRFWDLALREYASVNK---------------------------------AVLVDMEEGVISQILQGPLRELFDSAQLLTDVSGSGNNWATGHMTYGSVYRELIVDKLRKAAELCDCLQCFFLIHSLGGGTGSGLGTRVLGLLEEEFPGVSRIVTSMYPSAEDDVITSPYNSVLAMRELTEHAHCVLPVENQSLMDIVQKIQMVAHGAKPELMVRRNATLSSGQGGVHEVEKPFDAMNNIVANLLLNMTSSARFEGSLNVDLNEIAMNLVPFPRLHYLVPSLTPLYTL-ADVNAV--PRRLDQMFSDAFSKDHQLIHANPKQSMYLACALMVRGNVHVSDLRRNIERLRPSLSFVSWNQEGWKTGLCSVPPVGHSHSLLALANNTCMKLNFMELKERFTKLYRKKAH 387          
BLAST of TUBE1 vs. Planmine SMEST
Match: SMESG000015155.1 (SMESG000015155.1)

HSP 1 Score: 663.3 bits (1710), Expect = 0.000e+0
Identity = 335/337 (99.41%), Postives = 336/337 (99.70%), Query Frame = 2
Query:  254 MEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKVN 1264
            MEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFILHSMGGGTGSGLGTHVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRK +
Sbjct:    1 MEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFILHSMGGGTGSGLGTHVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKAH 337          
BLAST of TUBE1 vs. Planmine SMEST
Match: SMESG000038050.1 (SMESG000038050.1)

HSP 1 Score: 652.899 bits (1683), Expect = 0.000e+0
Identity = 340/344 (98.84%), Postives = 343/344 (99.71%), Query Frame = 2
Query:   53 ITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIER 1084
            I +Q+GQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVNNNNSSNSIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITD+SGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFILHSMGGGTGSGLGTHVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIER
Sbjct:    5 IVIQVGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVNNNNSSNSIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDISGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFILHSMGGGTGSGLGTHVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIER 348          
BLAST of TUBE1 vs. Planmine SMEST
Match: SMESG000038050.1 (SMESG000038050.1)

HSP 1 Score: 650.588 bits (1677), Expect = 0.000e+0
Identity = 338/340 (99.41%), Postives = 340/340 (100.00%), Query Frame = 2
Query:   65 LGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIER 1084
            +GQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVNNNNSSNSIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITD+SGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFILHSMGGGTGSGLGTHVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIER
Sbjct:  173 IGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVNNNNSSNSIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDISGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFILHSMGGGTGSGLGTHVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFADCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIER 512          
BLAST of TUBE1 vs. Planmine SMEST
Match: SMESG000044907.1 (SMESG000044907.1)

HSP 1 Score: 196.438 bits (498), Expect = 6.248e-57
Identity = 135/417 (32.37%), Postives = 212/417 (50.84%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSL----IRMVK-TFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNV---EISDIRRNIERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+++ LQ GQCGNQIG++FW++   EH  +   G Y                ++Y  + +G K   RAVLID+E G++  +       LF     I   SG+GNNWA G+   G +  + + + +RK AE CDCLQ F + HS+GGGTGSG+GT +   + +EYP+      +V PS    D +  PYN+ L +++L E  D    I+N +L     R +K T   Y D               +N +V+  +  +T+  RF G LN DL ++++N+VPFP+LH+ I   APL S  S+    ++   + ++    F     M   +P+   YL  A + RG +   E+ D   N++  +N+  FV W     K   C +APRG + S   + N+T+I   F  +  +F  +++RK 
Sbjct:    2 REILHLQAGQCGNQIGAKFWEVISDEHG-IDPTGSYHGDSD-----LQLERINVYYNEATGGKYVPRAVLIDLEPGIMDSVRSGPFGQLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDCVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMTTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLTTPTYGD---------------LNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQ---YRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDDQMLNVQN-KNSSYFVEWIPNNVKTAVCDIAPRGLKMSATFIGNSTAIQELFKRVSEQFTAMFRRKA 393          
BLAST of TUBE1 vs. Planmine SMEST
Match: SMESG000047291.1 (SMESG000047291.1)

HSP 1 Score: 192.586 bits (488), Expect = 1.415e-55
Identity = 132/416 (31.73%), Postives = 209/416 (50.24%), Query Frame = 2
Query:   44 RDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVXXXXXXXXIYKGQISGLK--ARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVSGSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFIXXXXXXXXXXXXXXXVTQMLADEYPEVYRFVNAVFPSDD-DDVITSPYNSVLGLNKLTEFADCVMPIENNSL----IRMVK-TFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNLTSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQPRRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNI--ERYRNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKFNKLYKRKV 1261
            R+++ LQ GQCGNQIGS+FW++   EH  +   G Y                ++Y  + +G K   RAVLID+E G +  +       LF     +   SG+GNNWA G+   G +  + + + +RK AE CDCLQ F + HS+GGGTGSG+GT +   + +EYP+      +V PS    D +  PYN+ L +++L E  D    I+N +L     R +K T   Y D               +N +V+  +  +T+  RF G LN DL ++++N+VPFP+LH+ I   APL S  S+    ++   + ++    F     M   +P+   YL  A L RG + + ++   +   + +N+  FV W     K   C + PRG + S   + N+T+I   F  +  +F  +++RK 
Sbjct:    2 REIVHLQAGQCGNQIGSKFWEVISDEHG-IDPTGTYHGDSD-----LQLERINVYFNEATGGKYVPRAVLIDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDIVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLTTPTYGD---------------LNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQ---YRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAALFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRVSEQFTAMFRRKA 393          
The following BLAST results are available for this feature:
BLAST of TUBE1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUBE18.268e-16257.08tubulin epsilon 1 [Source:HGNC Symbol;Acc:HGNC:207... [more]
TUBE16.398e-7760.66tubulin epsilon 1 [Source:HGNC Symbol;Acc:HGNC:207... [more]
TUBB13.009e-5533.01tubulin beta 1 class VI [Source:HGNC Symbol;Acc:HG... [more]
TUBB88.243e-5430.68tubulin beta 8 class VIII [Source:HGNC Symbol;Acc:... [more]
TUBB4B2.328e-5330.53tubulin beta 4B class IVb [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of TUBE1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ben-14.160e-5430.58Tubulin beta chain [Source:UniProtKB/TrEMBL;Acc:Q... [more]
tbb-48.248e-5430.29Tubulin beta-4 chain [Source:UniProtKB/Swiss-Prot... [more]
mec-71.835e-5230.79Tubulin beta-1 chain [Source:UniProtKB/Swiss-Prot... [more]
tbb-21.202e-5129.44Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot... [more]
tbb-21.202e-5129.44Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of TUBE1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
betaTub97EF8.658e-5632.20gene:FBgn0003890 transcript:FBtr0300611[more]
betaTub97EF2.496e-5431.96gene:FBgn0003890 transcript:FBtr0334906[more]
betaTub56D6.732e-5430.94gene:FBgn0284243 transcript:FBtr0086536[more]
betaTub60D2.187e-5330.41gene:FBgn0003888 transcript:FBtr0343443[more]
betaTub85D4.250e-5330.22gene:FBgn0003889 transcript:FBtr0082046[more]
back to top
BLAST of TUBE1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tube12.359e-16455.92tubulin, epsilon 1 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
tube12.359e-16455.92tubulin, epsilon 1 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
tube19.888e-8954.14tubulin, epsilon 1 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
tubb11.951e-5632.30tubulin, beta 1 class VI [Source:ZFIN;Acc:ZDB-GENE... [more]
tubb2b8.375e-5430.41tubulin, beta 2b [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
back to top
BLAST of TUBE1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tube11.064e-16758.53tubulin epsilon 1 [Source:NCBI gene;Acc:100488997][more]
tube12.967e-16758.53tubulin epsilon 1 [Source:NCBI gene;Acc:100488997][more]
tube14.037e-16157.66tubulin epsilon 1 [Source:NCBI gene;Acc:100488997][more]
tube12.743e-14459.19tubulin epsilon 1 [Source:NCBI gene;Acc:100488997][more]
reps21.547e-5330.53RALBP1 associated Eps domain containing 2 [Source:... [more]
back to top
BLAST of TUBE1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tube12.250e-16458.02tubulin, epsilon 1 [Source:MGI Symbol;Acc:MGI:1919... [more]
Tube12.861e-7962.98tubulin, epsilon 1 [Source:MGI Symbol;Acc:MGI:1919... [more]
Tubb12.941e-5531.96tubulin, beta 1 class VI [Source:MGI Symbol;Acc:MG... [more]
Tubb4b1.598e-5330.53tubulin, beta 4B class IVB [Source:MGI Symbol;Acc:... [more]
Tubb54.545e-5330.05tubulin, beta 5 class I [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of TUBE1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9D6T1|TBE_MOUSE1.574e-16358.02Tubulin epsilon chain OS=Mus musculus OX=10090 GN=... [more]
sp|Q9UJT0|TBE_HUMAN3.970e-16157.08Tubulin epsilon chain OS=Homo sapiens OX=9606 GN=T... [more]
sp|P50259|TBB_PORPU8.246e-5931.14Tubulin beta chain OS=Porphyra purpurea OX=2787 GN... [more]
sp|Q9HFQ3|TBB_MELLI2.000e-5831.14Tubulin beta chain OS=Melampsora lini OX=5261 GN=T... [more]
sp|P12458|TBB2_PHYPO4.782e-5832.45Tubulin beta-2 chain OS=Physarum polycephalum OX=5... [more]
back to top
BLAST of TUBE1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H6WA430.000e+099.01TUBE1 (Fragment) OS=Schmidtea mediterranea OX=7932... [more]
A0A4E0QWZ22.507e-17060.99Tubulin epsilon chain OS=Fasciola hepatica OX=6192... [more]
A7RQD71.344e-16859.45Predicted protein OS=Nematostella vectensis OX=453... [more]
K1QYQ33.772e-16658.99Tubulin epsilon chain (Fragment) OS=Crassostrea gi... [more]
V4AHB86.842e-16658.80Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of TUBE1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tube17.890e-16155.42tubulin epsilon 1 [Source:NCBI gene;Acc:103027558][more]
tube12.414e-15454.68tubulin epsilon 1 [Source:NCBI gene;Acc:103027558][more]
tube13.761e-14157.53tubulin epsilon 1 [Source:NCBI gene;Acc:103027558][more]
zgc:554612.566e-5330.29tubulin beta-4B chain [Source:NCBI gene;Acc:103024... [more]
TUBB2A7.331e-5329.81tubulin beta-2A chain [Source:NCBI gene;Acc:103041... [more]
back to top
BLAST of TUBE1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001368.16.268e-16054.95pep scaffold:Pmarinus_7.0:GL476337:866089:875956:-... [more]
TUBA3C7.993e-4730.03tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:1240... [more]
tubg11.782e-4629.43tubulin, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
tubb24.956e-4329.32tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000001139.19.858e-3426.61pep scaffold:Pmarinus_7.0:GL478075:30403:34872:1 g... [more]
back to top
BLAST of TUBE1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
TUB31.934e-5631.41Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB12.051e-5531.41Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB21.838e-5330.66Beta-tubulin; associates with alpha-tubulin (Tub1p... [more]
TUB48.873e-2925.35Gamma-tubulin; involved in nucleating microtubules... [more]
back to top
BLAST of TUBE1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO463461.859e-17259.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417661.958e-5430.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359584.542e-5430.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399451.801e-5330.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454291.737e-5230.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TUBE1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tube14.372e-16056.43tubulin epsilon 1 [Source:NCBI gene;Acc:105357241][more]
tube11.610e-15956.06tubulin epsilon 1 [Source:NCBI gene;Acc:105357241][more]
tube11.610e-15956.06tubulin epsilon 1 [Source:NCBI gene;Acc:105357241][more]
tube12.705e-15454.65tubulin epsilon 1 [Source:NCBI gene;Acc:105357241][more]
tube11.679e-14652.98tubulin epsilon 1 [Source:NCBI gene;Acc:105357241][more]
back to top
BLAST of TUBE1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015155.10.000e+099.41SMESG000015155.1[more]
SMESG000038050.10.000e+098.84SMESG000038050.1[more]
SMESG000038050.10.000e+099.41SMESG000038050.1[more]
SMESG000044907.16.248e-5732.37SMESG000044907.1[more]
SMESG000047291.11.415e-5531.73SMESG000047291.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30020804
GenBankAFB74725.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020804 ID=SMED30020804|Name=TUBE1|organism=Schmidtea mediterranea sexual|type=transcript|length=1526bp
TTTGTTTTAATACTTTAATTTGTGAGCTTAATTTGAAATGCCTAGAGATT
TAATTACATTGCAATTAGGACAATGTGGAAATCAAATTGGATCGAGATTT
TGGGATTTAGCTCTTAAAGAGCATTCATATGTTAAAAAAAATGGTGAATA
CGATAATTCAATGTCAACATTTTTTGTTAATAATAACAACTCTTCAAACA
GTATTTACAAGGGTCAAATTTCTGGTTTGAAGGCCCGAGCTGTCCTTATT
GACATGGAAGAGGGAGTAGTTAGTGAAATAATGAAAAGTTCGATAAAAAA
CTTATTCGATCATAAACAATTGATCACCGACGTCTCGGGTTCTGGGAATA
ATTGGGCTACTGGGAATTTGGAGTATGGACTGAAATACCACGAGCAAATT
TCAGAAAATATTCGAAAATCTGCCGAATTATGCGATTGTCTTCAATGTTT
TTTTATCCTTCATTCGATGGGGGGAGGAACTGGGTCAGGTCTAGGGACAC
ATGTCACCCAAATGTTAGCCGATGAATATCCAGAAGTGTACAGGTTTGTC
AATGCTGTATTTCCATCTGACGACGACGACGTGATAACCTCCCCATATAA
CAGTGTTCTTGGTTTGAATAAATTAACGGAATTTGCTGATTGTGTCATGC
CGATTGAAAATAATTCTTTAATTCGAATGGTAAAAACATTCAACAAATAT
TCAGATTCCAAAGAATCTAGCAATGATAAATCAAGAAAGCCTTTTGATGC
AATGAATGATATTGTCGCTAATTTGCTGTTGAATTTAACTAGCTCATCTC
GCTTTGAAGGAACACTAAATGTGGATTTAAATGAAATATCAATGAATCTG
GTTCCATTTCCGAAACTTCACTACTTAATTGCGGCTCAGGCACCTTTATA
TTCTCTAGAATCTAAAATGAATCCATTATTTCAGCCAAGGAGAATAGATC
AAATATTTGCCGATTCCTTTACAAAAGATTTTCAAATGATTGATGTAGAA
CCGAAAATGCATACATATTTGGCTTGTGCATTGCTAGTGCGTGGTAATGT
GGAAATATCTGATATCAGGCGCAATATTGAGAGATATAGAAACAATTTAA
AATTTGTTCCTTGGAATAAAGAAGGTTGGAAAGTTGGCCATTGTTCCGTT
GCCCCGAGGGGTCAGCGTTATTCTCTTTTAAATTTGTCAAATAATACTTC
AATCCACAATACATTTCATGAACTATTAATCAAATTCAACAAACTATACA
AAAGAAAAGTAAATAATTTTTGATATTTTATTACATAATCAATTATTTTT
TAAATTGATTTTGAAAGAATAAATTTGAGTAGTGTAACGCAGTGATGTGC
AAACTAAGGGTCTCGATATTGTAATGATAATTTGATAATCTACACAGTCA
TTTTATCTTGTTCGTATTAGAATGCAATATTTAACTATTTTTATTTTAAG
AACTTCTTTTGTTTTCACCTCTGACTTTTTTTCATTCCCAAACTTTTTTT
TTACTATGAATCAATAATGACAACAA
back to top

protein sequence of SMED30020804-orf-1

>SMED30020804-orf-1 ID=SMED30020804-orf-1|Name=SMED30020804-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=412bp
MPRDLITLQLGQCGNQIGSRFWDLALKEHSYVKKNGEYDNSMSTFFVNNN
NSSNSIYKGQISGLKARAVLIDMEEGVVSEIMKSSIKNLFDHKQLITDVS
GSGNNWATGNLEYGLKYHEQISENIRKSAELCDCLQCFFILHSMGGGTGS
GLGTHVTQMLADEYPEVYRFVNAVFPSDDDDVITSPYNSVLGLNKLTEFA
DCVMPIENNSLIRMVKTFNKYSDSKESSNDKSRKPFDAMNDIVANLLLNL
TSSSRFEGTLNVDLNEISMNLVPFPKLHYLIAAQAPLYSLESKMNPLFQP
RRIDQIFADSFTKDFQMIDVEPKMHTYLACALLVRGNVEISDIRRNIERY
RNNLKFVPWNKEGWKVGHCSVAPRGQRYSLLNLSNNTSIHNTFHELLIKF
NKLYKRKVNNF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036525Tubulin/FtsZ_GTPase_sf
IPR004057Epsilon_tubulin
IPR000217Tubulin
IPR003008Tubulin_FtsZ_GTPase
IPR018316Tubulin/FtsZ_2-layer-sand-dom
IPR017975Tubulin_CS
IPR008280Tub_FtsZ_C
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
GO:0005737cytoplasm
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0000166nucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000217TubulinPRINTSPR01161TUBULINcoord: 39..63
score: 31.03
coord: 122..142
score: 27.74
coord: 313..339
score: 25.25
coord: 108..121
score: 38.67
coord: 84..105
score: 24.68
coord: 26..37
score: 52.02
coord: 65..83
score: 60.18
IPR000217TubulinPANTHERPTHR11588TUBULINcoord: 1..336
IPR004057Epsilon tubulinPRINTSPR01519EPSLNTUBULINcoord: 13..31
score: 52.63
coord: 55..74
score: 67.5
coord: 273..293
score: 59.52
coord: 104..121
score: 61.11
coord: 34..52
score: 47.37
coord: 81..103
score: 50.0
coord: 122..137
score: 50.0
IPR003008Tubulin/FtsZ, GTPase domainSMARTSM00864Tubulin_4coord: 2..186
e-value: 1.8E-23
score: 94.0
IPR003008Tubulin/FtsZ, GTPase domainPFAMPF00091Tubulincoord: 1..143
e-value: 2.0E-44
score: 152.1
IPR018316Tubulin/FtsZ, 2-layer sandwich domainSMARTSM00865Tubulin_C_4coord: 188..326
e-value: 0.0053
score: 15.7
IPR018316Tubulin/FtsZ, 2-layer sandwich domainPFAMPF03953Tubulin_Ccoord: 203..324
e-value: 7.1E-28
score: 97.3
IPR036525Tubulin/FtsZ, GTPase domain superfamilyGENE3DG3DSA:3.40.50.1440coord: 1..315
e-value: 2.2E-109
score: 367.9
IPR036525Tubulin/FtsZ, GTPase domain superfamilySUPERFAMILYSSF52490Tubulin nucleotide-binding domain-likecoord: 1..184
NoneNo IPR availablePANTHERPTHR11588:SF13TUBULIN EPSILON CHAINcoord: 1..336
IPR017975Tubulin, conserved sitePROSITEPS00227TUBULINcoord: 73..79
IPR008280Tubulin/FtsZ, C-terminalSUPERFAMILYSSF55307Tubulin C-terminal domain-likecoord: 189..335