slc22a-6

Overview
Nameslc22a-6 (AKN21554.1)
Smed IDSMED30020778
Length (bp)1958
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc22a-6 (SMED30020778) t-SNE clustered cells

Violin plots show distribution of expression levels for slc22a-6 (SMED30020778) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc22a-6 (SMED30020778) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc22a-6 (SMED30020778) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020778

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30020778SMESG000020910.1 SmedASXL_013454SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30020778SMESG000020910.1 dd_Smed_v4_1159_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020778SMESG000020910.1 dd_Smed_v4_1159_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
proximal tubuleSMED30020778SMESG000020910.1 Smed-slc22a-6smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc22a-6 vs. Ensembl Human
Match: SLC22A6 (solute carrier family 22 member 6 [Source:HGNC Symbol;Acc:HGNC:10970])

HSP 1 Score: 121.709 bits (304), Expect = 2.411e-28
Identity = 108/472 (22.88%), Postives = 212/472 (44.92%), Query Frame = 1
Query:  379 LPKNQTNQVFTEHRNQFKAINNETGFLIIDSSRCRLTNISSICSEIFV-KKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFE---EERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIIL---KYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKNFVE 1773
            LP+++  Q      +  +  + + G   ++ +    T  +  C++ ++       STI +++ L C + AL   A S++M+G+ LG++  G  +D  GR     L+Y   +V  T AA +P + ++   RL +G A++   ++   + +E + I  R   G      Y +G  LL  +A+ +     LQL      +   I+ +F+ ES RW  ++ +     + +  +A+ N K   E      +E+     ++ L     + S  E+ +   +    L L  ++F+ SF+YY  ++        I+   +I     L ++ +   +   LGR    ++      AL +A I +     I   ++I+ T L ++       +F  +++Y GE +PT+IR T + +GS  ARV  +++  +    E+ P++   I   + +  S  T  LLPET  +P  D +   E  +  
Sbjct:   67 LPRDRQGQ----PESCLRFTSPQWGLPFLNGTEANGTGATEPCTDGWIYDNSTFPSTIVTEWDLVCSHRALRQLAQSLYMVGVLLGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAFAPNFPIYCAFRLLSGMALAGISLNCMTLNVEWMPIHTRACVGTLIGYVYSLGQFLLAGVAYAVPHWRHLQLLVSAPFFAFFIYSWFFIESARWHSSSGRLDLTLRALQRVARINGKR--EEGAKLSMEVLRASLQKELTMGKGQASAMELLRCPTLRHLFLCLSMLWFATSFAYYGLVMDLQGFGVSIYLIQVIFGAVDLPAKLVGFLVINSLGRRPAQMA------ALLLAGICILLNGVIPQDQSIVRTSLAVLGKGCLAASFNCIFLYTGELYPTMIRQTGMGMGSTMARVGSIVSPLVSMTAELYPSMPLFIYGAVPVAASAVT-VLLPETLGQPLPDTVQDLESRWAP 525          
BLAST of slc22a-6 vs. Ensembl Human
Match: SLC22A6 (solute carrier family 22 member 6 [Source:HGNC Symbol;Acc:HGNC:10970])

HSP 1 Score: 120.939 bits (302), Expect = 3.075e-28
Identity = 108/467 (23.13%), Postives = 211/467 (45.18%), Query Frame = 1
Query:  379 LPKNQTNQVFTEHRNQFKAINNETGFLIIDSSRCRLTNISSICSEIFV-KKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFE---EERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIIL---KYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAE 1758
            LP+++  Q      +  +  + + G   ++ +    T  +  C++ ++       STI +++ L C + AL   A S++M+G+ LG++  G  +D  GR     L+Y   +V  T AA +P + ++   RL +G A++   ++   + +E + I  R   G      Y +G  LL  +A+ +     LQL      +   I+ +F+ ES RW  ++ +     + +  +A+ N K   E      +E+     ++ L     + S  E+ +   +    L L  ++F+ SF+YY  ++        I+   +I     L ++ +   +   LGR    ++      AL +A I +     I   ++I+ T L ++       +F  +++Y GE +PT+IR T + +GS  ARV  +++  +    E+ P++   I   + +  S  T  LLPET  +P  D +   E
Sbjct:   67 LPRDRQGQ----PESCLRFTSPQWGLPFLNGTEANGTGATEPCTDGWIYDNSTFPSTIVTEWDLVCSHRALRQLAQSLYMVGVLLGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAFAPNFPIYCAFRLLSGMALAGISLNCMTLNVEWMPIHTRACVGTLIGYVYSLGQFLLAGVAYAVPHWRHLQLLVSAPFFAFFIYSWFFIESARWHSSSGRLDLTLRALQRVARINGKR--EEGAKLSMEVLRASLQKELTMGKGQASAMELLRCPTLRHLFLCLSMLWFATSFAYYGLVMDLQGFGVSIYLIQVIFGAVDLPAKLVGFLVINSLGRRPAQMA------ALLLAGICILLNGVIPQDQSIVRTSLAVLGKGCLAASFNCIFLYTGELYPTMIRQTGMGMGSTMARVGSIVSPLVSMTAELYPSMPLFIYGAVPVAASAVT-VLLPETLGQPLPDTVQDLE 520          
BLAST of slc22a-6 vs. Ensembl Human
Match: SLC22A8 (solute carrier family 22 member 8 [Source:HGNC Symbol;Acc:HGNC:10972])

HSP 1 Score: 114.775 bits (286), Expect = 3.475e-26
Identity = 124/535 (23.18%), Postives = 233/535 (43.55%), Query Frame = 1
Query:  241 KIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLPKNQTNQVFTEHRNQFKAINNETGFLIIDSSRCRLTNISSICSEIFVKKYPMTST---IRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGR--IIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQID-KYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPII-GMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKNFVEWRQPWR-----KSSKKI 1809
            +I   VG   +FQ+  +  + +   N A + L+ IF       +C  P N +   +            E     +      L N +    E  +  +   ST   I +++ L C  + L   A S+FM GI +G +  G  SD FGR  I+ C  SY +++   + AA SP + ++ + R   GF +S   +S   + +E V    R          Y  G  +L  LA+ I     LQL      +V  +  ++  ES RWL+ + K  KA K++  +A FN K     ++  + +++  ++ +     + +  ++F+  ++      L   +F+  F+YY+  +G  +    ++   +I     + ++ I +     LGR T   +    +     A + L ++      + TVL +       ++F  +++Y  E +PTVIR T + + +   RV  M++  ++   E+ P +  II G+T  + GS   F  LPET  +P  + +   E   +  ++P +     K+S++I
Sbjct:    5 EILDRVGSMGHFQFLHVAILGLPILNMANHNLLQIFTAATPVHHCRPPHNASTGPWVLPMGPNG--KPERCLRFVHPPNASLPNDTQRAMEPCLDGWVYNSTKDSIVTEWDLVCNSNKLKEMAQSIFMAGILIGGLVLGDLSDRFGRRPILTC--SYLLLAASGSGAAFSPTFPIYMVFRFLCGFGISGITLSTVILNVEWVPTRMRAIMSTALGYCYTFGQFILPGLAYAIPQWRWLQLTVSIPFFVFFLSSWWTPESIRWLVLSGKSSKALKILRRVAVFNGKKEEGERLSLEELKLNLQKEISLAKAKYTASDLFRIPMLRRMTFCLSLAWFATGFAYYSLAMGVEEFGVNLYILQIIFGGVDVPAKFITILSLSYLGRHT---TQAAALLLAGGAILALTFVPLDLQTVRTVLAVFGKGCLSSSFSCLFLYTSELYPTVIRQTGMGVSNLWTRVGSMVSPLVKITGEVQPFIPNIIYGITALLGGSAALF--LPETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRI 530          
BLAST of slc22a-6 vs. Ensembl Human
Match: SLC22A8 (solute carrier family 22 member 8 [Source:HGNC Symbol;Acc:HGNC:10972])

HSP 1 Score: 114.775 bits (286), Expect = 3.475e-26
Identity = 124/535 (23.18%), Postives = 233/535 (43.55%), Query Frame = 1
Query:  241 KIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLPKNQTNQVFTEHRNQFKAINNETGFLIIDSSRCRLTNISSICSEIFVKKYPMTST---IRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGR--IIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQID-KYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPII-GMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKNFVEWRQPWR-----KSSKKI 1809
            +I   VG   +FQ+  +  + +   N A + L+ IF       +C  P N +   +            E     +      L N +    E  +  +   ST   I +++ L C  + L   A S+FM GI +G +  G  SD FGR  I+ C  SY +++   + AA SP + ++ + R   GF +S   +S   + +E V    R          Y  G  +L  LA+ I     LQL      +V  +  ++  ES RWL+ + K  KA K++  +A FN K     ++  + +++  ++ +     + +  ++F+  ++      L   +F+  F+YY+  +G  +    ++   +I     + ++ I +     LGR T   +    +     A + L ++      + TVL +       ++F  +++Y  E +PTVIR T + + +   RV  M++  ++   E+ P +  II G+T  + GS   F  LPET  +P  + +   E   +  ++P +     K+S++I
Sbjct:    5 EILDRVGSMGHFQFLHVAILGLPILNMANHNLLQIFTAATPVHHCRPPHNASTGPWVLPMGPNG--KPERCLRFVHPPNASLPNDTQRAMEPCLDGWVYNSTKDSIVTEWDLVCNSNKLKEMAQSIFMAGILIGGLVLGDLSDRFGRRPILTC--SYLLLAASGSGAAFSPTFPIYMVFRFLCGFGISGITLSTVILNVEWVPTRMRAIMSTALGYCYTFGQFILPGLAYAIPQWRWLQLTVSIPFFVFFLSSWWTPESIRWLVLSGKSSKALKILRRVAVFNGKKEEGERLSLEELKLNLQKEISLAKAKYTASDLFRIPMLRRMTFCLSLAWFATGFAYYSLAMGVEEFGVNLYILQIIFGGVDVPAKFITILSLSYLGRHT---TQAAALLLAGGAILALTFVPLDLQTVRTVLAVFGKGCLSSSFSCLFLYTSELYPTVIRQTGMGVSNLWTRVGSMVSPLVKITGEVQPFIPNIIYGITALLGGSAALF--LPETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRI 530          
BLAST of slc22a-6 vs. Ensembl Human
Match: SLC22A7 (solute carrier family 22 member 7 [Source:HGNC Symbol;Acc:HGNC:10971])

HSP 1 Score: 114.005 bits (284), Expect = 6.075e-26
Identity = 118/482 (24.48%), Postives = 212/482 (43.98%), Query Frame = 1
Query:  238 EKIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFIN----------------NYQDVY--CVLPKNQTNQVFTEHRNQFKAINNETGFLIIDSSRCRLTNISSI--CSEIFVKKY-PMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYI--EIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIAS 1614
            E++ + VGG   FQ   +  + + +    ++ L+PIF+                 ++QDV+    LP+     + +  R  +      T       SR  L +  +   CS+ +   +   +STI +++ L CE   L+  A++ F  G+ +G+V  G  SD FGR     ++Y    V    +A S  Y + A+ R  TG A++   +    + LE +++  RT  G   S  +  G +LL L+ + IRD   L LA        ++  ++  ES RWLL     K+A + ++H A+ N + V E+   +    ++   ER   V  R S  ++F+   +    L    ++F  +FSYY   L  S +   ++   L+     L S+ +     +  GR        LG TAL   + +L  +       +TVL ++  + S   F   +++  E +PTV+R T + + +   R+ G +A 
Sbjct:    4 EELLEQVGGFGPFQLRNVALLALPRVLLPLHFLLPIFLAAVPAHRCALPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYDHSEFSSTIATEWDLVCEQKGLNRAASTFFFAGVLVGAVAFGYLSDRFGRRRLLLVAYVSTLVLGLASAASVSYVMFAITRTLTGSALAGFTIIVMPLELEWLDVEHRTVAGVLSSTFWTGGVMLLALVGYLIRDWRWLLLAVTLPCAPGILSLWWVPESARWLLTQGHVKEAHRYLLHCARLNGRPVCEDSFSQEAVSKVAAGER---VVRRPSYLDLFRTPRLRHISLCCVVVWFGVNFSYYGLSLDVSGLGLNVYQTQLLFGAVELPSKLLVYLSVRYAGRRLTQAGTLLG-TALAFGTRLL--VSSDMKSWSTVLAVMGKAFSEAAFTTAYLFTSELYPTVLRQTGMGLTALVGRLGGSLAP 479          
BLAST of slc22a-6 vs. Ensembl Celegans
Match: K05F1.6 (pep chromosome:WBcel235:II:5782942:5787658:1 gene:WBGene00019408.1 transcript:K05F1.6c.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K05F1.6)

HSP 1 Score: 99.3673 bits (246), Expect = 2.534e-21
Identity = 136/574 (23.69%), Postives = 246/574 (42.86%), Query Frame = 1
Query:  238 EKIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLPK-NQTNQV-FTEHR------NQFKAIN------NETGFLIIDS-----------SRCRLTNISSICSEIFVKKYP-------------MTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGR---IIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAK-----FNRKSVTE-NQIDKYIEI--FEEERL-RSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDE---IFTA--ALISALGSLVSRSIYMFLC---KRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTM----AMFGSLCTFFLLPETFKRPSSDFLSQAEKNFVE 1773
            E I  ++GG  ++Q +I + I + Q   A+  L  +++    +  C++P  N TN    + H       +  K I+      N  G    DS            + R   + +  SE +    P             M  TI + F L C+       A   + +G  LG V GG+ SD  GR   IIG G+   M+ VF      + +Y +  L RL +      + ++   + +EI     R   G      + +GY LL L+A+  +    +Q+    + ++S+IF     ES RWL+   +  +A++V+    +     FN  + ++   +   +E+    E +L +    ++   ++F  K +    + +  +F + +  YY  ++  S  S     +FT    L + +   +     +F C    +LGR   L+ L L  + LFI   +L  + G   +    +    I+V G  F  ++I+  E +PTV+R T+V + S  AR    ++S +  +  I+   LPI+ M +    ++F  +   F+LPET ++P  + L  A  NF+E
Sbjct:  203 EGILNIIGGCRWWQIWIYVLIALQQIPHAMFNLNVVYMMYDPEFQCMVPGFNDTNDTTISSHGPYLWGVDDIKNISFVFPNANSDGAYQRDSCYFYERSEERYRQLRRMPLETAMSEAWKDVAPKKKCQAYHFEKDVMVETIVTDFNLVCDSWFAKGHAHMFYSIGYLLGCVLGGIASDKIGRKPTIIGFGILSSMLGVF---LPFNDYYPMFLLIRLLSAICNEAADLAAYTLCMEITGTKYRAMVGSMLQAPWALGYALLALIAYLTKSWKTIQVIAAGLHFMSIIFICSIPESPRWLMVQNRVSEAEEVIRKACREPPFPFNMCTTSKCGNLPSDLELVSHRERKLNKKNGGKIGFLDLFTMKELRYRTISVCIVFMATALVYYGLVMALSDQSAPGRTLFTGYFHLNNGIAGAIEIPT-LFACVWMMQLGRKKALM-LTLITSGLFIIVAMLSMVSGHYMLALAFMYFGKIAVQGA-FNILYIFTSELYPTVVRNTAVGVTSMVARFGSGLSSYIALLSNIS---LPIVPMIIFAVFSLFAGMLV-FVLPETSEKPLPETLDDA-INFLE 765          
BLAST of slc22a-6 vs. Ensembl Celegans
Match: K05F1.6 (pep chromosome:WBcel235:II:5782524:5787658:1 gene:WBGene00019408.1 transcript:K05F1.6c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K05F1.6)

HSP 1 Score: 99.3673 bits (246), Expect = 2.534e-21
Identity = 136/574 (23.69%), Postives = 246/574 (42.86%), Query Frame = 1
Query:  238 EKIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLPK-NQTNQV-FTEHR------NQFKAIN------NETGFLIIDS-----------SRCRLTNISSICSEIFVKKYP-------------MTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGR---IIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAK-----FNRKSVTE-NQIDKYIEI--FEEERL-RSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDE---IFTA--ALISALGSLVSRSIYMFLC---KRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTM----AMFGSLCTFFLLPETFKRPSSDFLSQAEKNFVE 1773
            E I  ++GG  ++Q +I + I + Q   A+  L  +++    +  C++P  N TN    + H       +  K I+      N  G    DS            + R   + +  SE +    P             M  TI + F L C+       A   + +G  LG V GG+ SD  GR   IIG G+   M+ VF      + +Y +  L RL +      + ++   + +EI     R   G      + +GY LL L+A+  +    +Q+    + ++S+IF     ES RWL+   +  +A++V+    +     FN  + ++   +   +E+    E +L +    ++   ++F  K +    + +  +F + +  YY  ++  S  S     +FT    L + +   +     +F C    +LGR   L+ L L  + LFI   +L  + G   +    +    I+V G  F  ++I+  E +PTV+R T+V + S  AR    ++S +  +  I+   LPI+ M +    ++F  +   F+LPET ++P  + L  A  NF+E
Sbjct:  203 EGILNIIGGCRWWQIWIYVLIALQQIPHAMFNLNVVYMMYDPEFQCMVPGFNDTNDTTISSHGPYLWGVDDIKNISFVFPNANSDGAYQRDSCYFYERSEERYRQLRRMPLETAMSEAWKDVAPKKKCQAYHFEKDVMVETIVTDFNLVCDSWFAKGHAHMFYSIGYLLGCVLGGIASDKIGRKPTIIGFGILSSMLGVF---LPFNDYYPMFLLIRLLSAICNEAADLAAYTLCMEITGTKYRAMVGSMLQAPWALGYALLALIAYLTKSWKTIQVIAAGLHFMSIIFICSIPESPRWLMVQNRVSEAEEVIRKACREPPFPFNMCTTSKCGNLPSDLELVSHRERKLNKKNGGKIGFLDLFTMKELRYRTISVCIVFMATALVYYGLVMALSDQSAPGRTLFTGYFHLNNGIAGAIEIPT-LFACVWMMQLGRKKALM-LTLITSGLFIIVAMLSMVSGHYMLALAFMYFGKIAVQGA-FNILYIFTSELYPTVVRNTAVGVTSMVARFGSGLSSYIALLSNIS---LPIVPMIIFAVFSLFAGMLV-FVLPETSEKPLPETLDDA-INFLE 765          
BLAST of slc22a-6 vs. Ensembl Celegans
Match: K05F1.6 (pep chromosome:WBcel235:II:5782942:5787658:1 gene:WBGene00019408.1 transcript:K05F1.6a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K05F1.6)

HSP 1 Score: 98.9821 bits (245), Expect = 2.959e-21
Identity = 137/575 (23.83%), Postives = 248/575 (43.13%), Query Frame = 1
Query:  238 EKIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLPK-NQTNQV-FTEHR------NQFKAIN------NETGFLIIDS-----------SRCRLTNISSICSEIFVKKYP-------------MTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGR---IIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAK-----FNRKSVTE-NQIDKYIEI--FEEERL-RSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDE---IFTAALISALGSLVSRSIY---MFLC---KRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTM----AMFGSLCTFFLLPETFKRPSSDFLSQAEKNFVE 1773
            E I  ++GG  ++Q +I + I + Q   A+  L  +++    +  C++P  N TN    + H       +  K I+      N  G    DS            + R   + +  SE +    P             M  TI + F L C+       A   + +G  LG V GG+ SD  GR   IIG G+   M+ VF      + +Y +  L RL +      + ++   + +EI     R   G      + +GY LL L+A+  +    +Q+    + ++S+IF     ES RWL+   +  +A++V+    +     FN  + ++   +   +E+    E +L +    ++   ++F  K +    + +  +F + +  YY  ++  S  S     +FT      L + ++ +I    +F C    +LGR   L+ L L  + LFI   +L  + G   +    +    I+V G  F  ++I+  E +PTV+R T+V + S  AR    ++S +  +  I+   LPI+ M +    ++F  +   F+LPET ++P  + L  A  NF+E
Sbjct:  201 EGILNIIGGCRWWQIWIYVLIALQQIPHAMFNLNVVYMMYDPEFQCMVPGFNDTNDTTISSHGPYLWGVDDIKNISFVFPNANSDGAYQRDSCYFYERSEERYRQLRRMPLETAMSEAWKDVAPKKKCQAYHFEKDVMVETIVTDFNLVCDSWFAKGHAHMFYSIGYLLGCVLGGIASDKIGRKPTIIGFGILSSMLGVF---LPFNDYYPMFLLIRLLSAICNEAADLAAYTLCMEITGTKYRAMVGSMLQAPWALGYALLALIAYLTKSWKTIQVIAAGLHFMSIIFICSIPESPRWLMVQNRVSEAEEVIRKACREPPFPFNMCTTSKCGNLPSDLELVSHRERKLNKKNGGKIGFLDLFTMKELRYRTISVCIVFMATALVYYGLVMALSDQSAPGRTLFTGYF--HLNNGIAGAIEIPTLFACVWMMQLGRKKALM-LTLITSGLFIIVAMLSMVSGHYMLALAFMYFGKIAVQGA-FNILYIFTSELYPTVVRNTAVGVTSMVARFGSGLSSYIALLSNIS---LPIVPMIIFAVFSLFAGMLV-FVLPETSEKPLPETLDDA-INFLE 763          
BLAST of slc22a-6 vs. Ensembl Celegans
Match: K05F1.6 (pep chromosome:WBcel235:II:5782524:5787658:1 gene:WBGene00019408.1 transcript:K05F1.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K05F1.6)

HSP 1 Score: 98.9821 bits (245), Expect = 2.959e-21
Identity = 137/575 (23.83%), Postives = 248/575 (43.13%), Query Frame = 1
Query:  238 EKIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLPK-NQTNQV-FTEHR------NQFKAIN------NETGFLIIDS-----------SRCRLTNISSICSEIFVKKYP-------------MTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGR---IIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAK-----FNRKSVTE-NQIDKYIEI--FEEERL-RSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDE---IFTAALISALGSLVSRSIY---MFLC---KRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTM----AMFGSLCTFFLLPETFKRPSSDFLSQAEKNFVE 1773
            E I  ++GG  ++Q +I + I + Q   A+  L  +++    +  C++P  N TN    + H       +  K I+      N  G    DS            + R   + +  SE +    P             M  TI + F L C+       A   + +G  LG V GG+ SD  GR   IIG G+   M+ VF      + +Y +  L RL +      + ++   + +EI     R   G      + +GY LL L+A+  +    +Q+    + ++S+IF     ES RWL+   +  +A++V+    +     FN  + ++   +   +E+    E +L +    ++   ++F  K +    + +  +F + +  YY  ++  S  S     +FT      L + ++ +I    +F C    +LGR   L+ L L  + LFI   +L  + G   +    +    I+V G  F  ++I+  E +PTV+R T+V + S  AR    ++S +  +  I+   LPI+ M +    ++F  +   F+LPET ++P  + L  A  NF+E
Sbjct:  201 EGILNIIGGCRWWQIWIYVLIALQQIPHAMFNLNVVYMMYDPEFQCMVPGFNDTNDTTISSHGPYLWGVDDIKNISFVFPNANSDGAYQRDSCYFYERSEERYRQLRRMPLETAMSEAWKDVAPKKKCQAYHFEKDVMVETIVTDFNLVCDSWFAKGHAHMFYSIGYLLGCVLGGIASDKIGRKPTIIGFGILSSMLGVF---LPFNDYYPMFLLIRLLSAICNEAADLAAYTLCMEITGTKYRAMVGSMLQAPWALGYALLALIAYLTKSWKTIQVIAAGLHFMSIIFICSIPESPRWLMVQNRVSEAEEVIRKACREPPFPFNMCTTSKCGNLPSDLELVSHRERKLNKKNGGKIGFLDLFTMKELRYRTISVCIVFMATALVYYGLVMALSDQSAPGRTLFTGYF--HLNNGIAGAIEIPTLFACVWMMQLGRKKALM-LTLITSGLFIIVAMLSMVSGHYMLALAFMYFGKIAVQGA-FNILYIFTSELYPTVVRNTAVGVTSMVARFGSGLSSYIALLSNIS---LPIVPMIIFAVFSLFAGMLV-FVLPETSEKPLPETLDDA-INFLE 763          
BLAST of slc22a-6 vs. Ensembl Celegans
Match: F32H5.4 (pep chromosome:WBcel235:V:13361203:13363357:1 gene:WBGene00009350.1 transcript:F32H5.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F32H5.4)

HSP 1 Score: 96.6709 bits (239), Expect = 8.264e-21
Identity = 113/452 (25.00%), Postives = 211/452 (46.68%), Query Frame = 1
Query:  493 ISSICSEIFVKKYPMTSTIRSQFKLY---------CEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMI---SVFSTVAAVSPWYT-LHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKF--NRKSVTENQIDKYIEI---FEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLV-SRSIYMFLCK----RLGRVTILLSLQLGVTALFIASIILKYIYGGK---NIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAP-NVLPIIGMT-MAMFGSLCTFFLLPETFKRPSSDFLSQAEKN 1764
            I  IC   F    P   TI S++  Y         C   A    + S+ M+G+ +GSV  G  +D +GR+    + +FM+   S+ +T A    ++T +  +  +F G  +S   V       ++  + ++  F     + +   Y++L  +A+   D    Q A   +S    +   F KES RWL+   + ++A++V+ HI +   N    + N+I++ ++     +EER++        + +F  K +    ++LW   FS SF+ Y F+    K+S  ++  AL+  +GSL    +I+  L      +LGR  I L  +L +T + + SI + Y +  +   ++I  V  ++A + +   F    +   E +PTVIR ++VS  S+ +R+  ++  Q+   F + P   LP   +T   +F ++     LPET  +P  + + +  KN
Sbjct:   78 IKDICKSSFDFHNPPNCTITSKYDFYSINVDYGHFCGEGAWVKTSISVQMVGVLIGSVTSGAVADRYGRLKVLSVCFFMVSSLSILNTFAKDLIYFTIIRTILSIFKGGLLSTYGV------YKMEHVPRQHRFWIATMISWAPNYMILSFVAYLCHDWITYQYAIFALSMPGAVVFLFVKESPRWLIQAGRIEEARQVLKHIMEVDGNTSDHSWNEIEEMLQTEKKRQEERIKK-RKNYDFRHLFWNKYMASVTMILWLGMFSTSFTNYGFVFNIEKLSGSLYINALL--MGSLRWVLNIFFGLADLKFAKLGRKHIHLISKLTIT-ICVFSIFVTYYFEYEEDYSLIIRVATLLASATASQVFITKSMVLMEFYPTVIRNSAVSFKSSASRIGTILGPQL---FILCPYKSLPYAILTGFCLFDAIAFQLRLPETKGKPLPETMPERHKN 516          
BLAST of slc22a-6 vs. Ensembl Fly
Match: Orct (gene:FBgn0019952 transcript:FBtr0334870)

HSP 1 Score: 134.035 bits (336), Expect = 7.542e-33
Identity = 127/523 (24.28%), Postives = 229/523 (43.79%), Query Frame = 1
Query:  274 FQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLP-KNQTNQVFTEHRNQFKAINNET-GFLIID-------SSRCRLTNISSICSEIFVKKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVT----ENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKNFVEWRQPWRKSSK 1803
            +Q  I   + +     A + L  +F+    D  C LP +N +    + H        NE   +  +D        S  R +N +  CS     +    ++  +++ L C    LS+ + S+FMLG+ LGS+  G  SD  GR      S  +  +F  +AAV+P Y  + + R+  G   S  F+    +ALE+V  S R   G    + + +G++L    A+FI D   LQ+A      + L + +   ES RWLL   +  +A  ++   AK N+  V     E  +D+  E  +++ + +     ++ ++ +Y  +    L+++F +F  S  YY     ++ +        +IS    +   ++ +F   R GR +IL    +      +A+I   ++    N +     MI      +++G ++I+  E FPTV+R   +   S  ARV G++A  ++ + EI    LP+I        +     LLPET  +P  + +   E NF +   P   + +
Sbjct:   16 YQKRIYYLLCLPAIVCAFHKLAGVFLLAKPDFRCALPYENGSIYELSPHLWNLSYPENERCSYYDVDYTEEYLNGSIPRSSNETKTCSSYVYDRSKYLNSAVTEWNLVCSRSLLSATSDSLFMLGVLLGSLIFGQMSDKLGRKPTFFASLVLQLIFGVLAAVAPEYFSYTISRMIVGATTSGVFLVAYVIALEMVGSSYRLFAGVAMQMFFSVGFMLTAGFAYFIHDWRWLQIAITLPGLLFLCYYWIIPESARWLLMKGRKDEAFVIIEKAAKENKVEVPNEIYEQLVDEVAEKKKQDEMAASQPAATVFDLLRYPNLRRKTLLIFFDWFVNSGVYYGLSWNTNNLGGNQLVNFMISGAVEIPGYTLLLFTLNRWGRRSILCGTMMVAGISLLATI---FVPSDMNWLIVACAMIGKLAITSSYGTIYIFSAEQFPTVVRNVGLGASSMVARVGGILAPYLKLLGEIW-RPLPLIICGALSLTAGLLSLLLPETLNKPMPETIEDGE-NFGKKPAPQETAEE 533          
BLAST of slc22a-6 vs. Ensembl Fly
Match: Orct (gene:FBgn0019952 transcript:FBtr0084599)

HSP 1 Score: 134.035 bits (336), Expect = 7.542e-33
Identity = 127/523 (24.28%), Postives = 229/523 (43.79%), Query Frame = 1
Query:  274 FQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLP-KNQTNQVFTEHRNQFKAINNET-GFLIID-------SSRCRLTNISSICSEIFVKKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVT----ENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKNFVEWRQPWRKSSK 1803
            +Q  I   + +     A + L  +F+    D  C LP +N +    + H        NE   +  +D        S  R +N +  CS     +    ++  +++ L C    LS+ + S+FMLG+ LGS+  G  SD  GR      S  +  +F  +AAV+P Y  + + R+  G   S  F+    +ALE+V  S R   G    + + +G++L    A+FI D   LQ+A      + L + +   ES RWLL   +  +A  ++   AK N+  V     E  +D+  E  +++ + +     ++ ++ +Y  +    L+++F +F  S  YY     ++ +        +IS    +   ++ +F   R GR +IL    +      +A+I   ++    N +     MI      +++G ++I+  E FPTV+R   +   S  ARV G++A  ++ + EI    LP+I        +     LLPET  +P  + +   E NF +   P   + +
Sbjct:   16 YQKRIYYLLCLPAIVCAFHKLAGVFLLAKPDFRCALPYENGSIYELSPHLWNLSYPENERCSYYDVDYTEEYLNGSIPRSSNETKTCSSYVYDRSKYLNSAVTEWNLVCSRSLLSATSDSLFMLGVLLGSLIFGQMSDKLGRKPTFFASLVLQLIFGVLAAVAPEYFSYTISRMIVGATTSGVFLVAYVIALEMVGSSYRLFAGVAMQMFFSVGFMLTAGFAYFIHDWRWLQIAITLPGLLFLCYYWIIPESARWLLMKGRKDEAFVIIEKAAKENKVEVPNEIYEQLVDEVAEKKKQDEMAASQPAATVFDLLRYPNLRRKTLLIFFDWFVNSGVYYGLSWNTNNLGGNQLVNFMISGAVEIPGYTLLLFTLNRWGRRSILCGTMMVAGISLLATI---FVPSDMNWLIVACAMIGKLAITSSYGTIYIFSAEQFPTVVRNVGLGASSMVARVGGILAPYLKLLGEIW-RPLPLIICGALSLTAGLLSLLLPETLNKPMPETIEDGE-NFGKKPAPQETAEE 533          
BLAST of slc22a-6 vs. Ensembl Fly
Match: Orct2 (gene:FBgn0086365 transcript:FBtr0084598)

HSP 1 Score: 131.724 bits (330), Expect = 5.296e-32
Identity = 133/533 (24.95%), Postives = 235/533 (44.09%), Query Frame = 1
Query:  235 SEKIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLP-KNQTNQVFTEHRNQFKAINNET-GFLIID-------SSRCRLTNISSICSEIFVKKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFY---KESFRWLLATXXXXXXXXVMMHIAKFNRKSVT-----------ENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEI-APNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEK 1761
             E I  L G    +Q  I   I ++    A + L  +F+    D  C LP +N ++     H        NE   +  +D        S  R +N +  CS     +    ++  +++ L C    +++ + S+FMLG+ LGS+  G  SD +GR      S  +  +F  +A V+P Y  +   RL  G   S  F+    +A+E+V   +R   G +  + + +G++L  + A+F+ D   LQ+A   ++   LIF F+Y    ES RWLL   +   A   M   A+FN+  ++           EN  +K  +  E++ L       S+ ++F Y  +    L+++  +   S  YY     +S +   +    +IS    + +    +    R GR +IL    +      +A++I+        +   +L  +AI+ S   +G ++I+  E FPTV+R  ++   S  AR+SGM+A  + ++  I  P  L I G    + G      LLPET  +P  + ++  E+
Sbjct:    4 DEAIIHL-GDFGRYQKIIYFLICLTSIPVAFHKLAGVFLLAKPDFRCALPFENGSSYDLPTHLWNLSYPENERCSYYDVDYTEEYLNGSIPRSSNETKTCSSYVYDRSKYLNSAVTEWNLVCGRDFMAATSDSLFMLGVLLGSIVFGQLSDKYGRKPILFASLVIQVLFGVLAGVAPEYFTYTFARLMVGATTSGVFLVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAVFAYFVHDWRWLQIA---LTLPGLIFMFYYWIIPESARWLLLKGRKDCAIANMQKAARFNKVEISDEALSELLDEGENSEEKAKQKLEDQELDE-GPPPSVWDLFCYPNLRRKTLLIFLDWLVTSGVYYGLSWNTSNLGGNVLLNFVISGAVEIPAYIFLLLTLNRWGRRSILCGCLVMAGLSLLATVIIPQRMHTLIVACAMLGKLAITAS---YGTVYIFSAEQFPTVVRNVALGAASMVARISGMMAPFLNFLATIWKPLPLLICGSLTLVAGL--LSLLLPETHNKPMLETIADGER 526          
BLAST of slc22a-6 vs. Ensembl Fly
Match: Orct2 (gene:FBgn0086365 transcript:FBtr0334869)

HSP 1 Score: 131.724 bits (330), Expect = 5.296e-32
Identity = 133/533 (24.95%), Postives = 235/533 (44.09%), Query Frame = 1
Query:  235 SEKIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLP-KNQTNQVFTEHRNQFKAINNET-GFLIID-------SSRCRLTNISSICSEIFVKKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFY---KESFRWLLATXXXXXXXXVMMHIAKFNRKSVT-----------ENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEI-APNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEK 1761
             E I  L G    +Q  I   I ++    A + L  +F+    D  C LP +N ++     H        NE   +  +D        S  R +N +  CS     +    ++  +++ L C    +++ + S+FMLG+ LGS+  G  SD +GR      S  +  +F  +A V+P Y  +   RL  G   S  F+    +A+E+V   +R   G +  + + +G++L  + A+F+ D   LQ+A   ++   LIF F+Y    ES RWLL   +   A   M   A+FN+  ++           EN  +K  +  E++ L       S+ ++F Y  +    L+++  +   S  YY     +S +   +    +IS    + +    +    R GR +IL    +      +A++I+        +   +L  +AI+ S   +G ++I+  E FPTV+R  ++   S  AR+SGM+A  + ++  I  P  L I G    + G      LLPET  +P  + ++  E+
Sbjct:    4 DEAIIHL-GDFGRYQKIIYFLICLTSIPVAFHKLAGVFLLAKPDFRCALPFENGSSYDLPTHLWNLSYPENERCSYYDVDYTEEYLNGSIPRSSNETKTCSSYVYDRSKYLNSAVTEWNLVCGRDFMAATSDSLFMLGVLLGSIVFGQLSDKYGRKPILFASLVIQVLFGVLAGVAPEYFTYTFARLMVGATTSGVFLVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAVFAYFVHDWRWLQIA---LTLPGLIFMFYYWIIPESARWLLLKGRKDCAIANMQKAARFNKVEISDEALSELLDEGENSEEKAKQKLEDQELDE-GPPPSVWDLFCYPNLRRKTLLIFLDWLVTSGVYYGLSWNTSNLGGNVLLNFVISGAVEIPAYIFLLLTLNRWGRRSILCGCLVMAGLSLLATVIIPQRMHTLIVACAMLGKLAITAS---YGTVYIFSAEQFPTVVRNVALGAASMVARISGMMAPFLNFLATIWKPLPLLICGSLTLVAGL--LSLLLPETHNKPMLETIADGER 526          
BLAST of slc22a-6 vs. Ensembl Fly
Match: CG8654 (gene:FBgn0034479 transcript:FBtr0086340)

HSP 1 Score: 125.561 bits (314), Expect = 3.489e-30
Identity = 116/431 (26.91%), Postives = 196/431 (45.48%), Query Frame = 1
Query:  478 CRLTNI----SSICSEIFVKKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAE 1758
            C+  N+    S  CSE         STI +++ L CE   L+S + S+ MLGI  GS+  G+F+D +GR        FM  +   +  VSP+Y  + L R     A + +  ++  + +EIV   +R      + + ++IG+  L L A+FIR+    Q +    S V +I+ +   ES RWL  T K  K+ K++  IAK N K+ TE    +    +     R    + ++ ++F+   + +  + +   +      YY      S +   IF +  I+A   +    +   + K LGR   LL L  G +AL +  I+L  +      +      I +  +   F  +++YGGE FPTV+R++ V + S   R+  ++A  +  +      V P+I    ++   L T F LPET   P  + L   E
Sbjct:   67 CKTENVTDPCSDECSETEFDTSVFQSTIITEWNLTCESKQLASLSQSIVMLGILFGSILFGMFADRYGRRPAFLTCCFMQLITGLIVCVSPYYWFYCLFRFLVAVATAGTMTTSFVLLMEIVGPKKREMVAILYQIPFNIGHASLALFAYFIREWRWFQFSITIFSIVFVIYIWLVPESPRWLFTTGKLDKSIKILEKIAKCN-KAPTETIRPEIEAAYGALAARQPVKKGTVVDLFRTPYMRIKTIFMANNWLVVCMVYYGTAQYVSALGGNIFISNAIAAGVGIPGTCLCALMTKYLGRKKTLL-LSNGCSALGL--ILLACLSTQAEAVRVTCATIGLFGASITFPNVYLYGGELFPTVVRSSGVGLCSMVGRIGSIVAPLIVDLAAYGLWVAPLIFGIFSILAMLGTIF-LPETRGTPLPETLEDGE 492          
BLAST of slc22a-6 vs. Ensembl Zebrafish
Match: slc22a7a (solute carrier family 22 member 7a [Source:ZFIN;Acc:ZDB-GENE-050506-52])

HSP 1 Score: 129.413 bits (324), Expect = 4.187e-31
Identity = 132/530 (24.91%), Postives = 237/530 (44.72%), Query Frame = 1
Query:  238 EKIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLPKNQ----TNQVFTEHRNQFKAIN---NETGFLIIDSSRCRL--------------------TNISSICSEIFV-KKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQID----KYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVT-ILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQM---EWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPET 1719
            E + + +GG + FQ+ +L  +++ +    ++ L+  FI+     +C LP+       +    E   Q  A+    N  G      S C++                    +N+S  C   +V  +   TST  +++ L C+   L+    + F +G+ +G+V  G  SD FGR     +S+   +VF  + A S  Y + A+ R   GFA++   ++   + +E  ++  RT  G   SLG+ +G +LL LLA+ IRD   L L       V +I  ++  ES RWLLA  + ++A+K +++ AK N K     ++D    K I I E+   ++ S+ + +    K + +++   + W   F+ +F+YY      +     I+    I  +  + ++        R+GR      SL +    + + S+I          + T + +I    S   F   ++Y  E +PTV+R   +   S  AR+ G +A  +   E ++   P   P++    A+F S C  FLLPET
Sbjct:    4 EDVLREIGGFNKFQFLVLYILWLPRVILPLHFLLHNFISGVPPHHCALPRLDGRFSASGAEKEELAQIVALGIPRNSDG----SYSSCKMYTMPMDFDLNGDLSVLYGNRSNVSVPCQNGWVYDRSQFTSTTATEWDLVCDNKKLNQALATFFFIGVTMGAVVFGQLSDKFGRKPMIQVSFVSSAVFGIIEAFSSSYVMFAIARTLCGFALTGMSITTVALCVEWTDVKHRTFTGTIISLGWSVGNMLLALLAYLIRDWRHLILVVTSPCLVGIIAWWWIPESARWLLANGRVEEAQKYLINCAKMNGKYSYTKKLDIENLKKITIAEDSN-KNHSY-LDLVRTPKLRKIVLCSGIFW---FAVAFTYYGISFNITGFGLNIYLTQFIYGVIEVPAKVGTYLTLDRIGRRNGQAWSLIIAGALIGLNSVIPTEFAA----VRTGIAVIGKGFSEAAFTIAFLYTSELYPTVLRQCGLGYTSFIARIGGSLAPMVILFEDIWHYGP---PVVFSATAVF-SGCVVFLLPET 516          
BLAST of slc22a-6 vs. Ensembl Zebrafish
Match: si:dkey-166k12.1 (si:dkey-166k12.1 [Source:ZFIN;Acc:ZDB-GENE-120215-78])

HSP 1 Score: 126.331 bits (316), Expect = 3.131e-30
Identity = 106/420 (25.24%), Postives = 201/420 (47.86%), Query Frame = 1
Query:  541 STIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTEN-QIDKYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFL--CKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGS-----LCTFFLLPETFKRPSSDFLSQAEKNFVEW 1776
            ST  +++ L C+   LSS  +S++MLG+ +G+V  G  +D +GR     +S  + +VF   AA +P + ++   R   G  VS   ++   +  E     +R   G +    +  GY+LL  +AF IRD  KLQLA     ++ + + +    S RWLL   + ++A  ++   A  N +++    Q+++Y    E  + RS   + ++ ++ +   +    L+L++I+F     YY   LG S +  +++    +  L  + +R++ + L  C R   +++ L +  G      A ++   +      + T L M+       +F  +++Y  E FPTV+R T + + S  AR+ G++A  +  +    P V+P     M +FGS           LPET ++P  D +   EK+ +++
Sbjct:   96 STTVTEWDLVCDKRGLSSLGSSIYMLGLLVGAVVFGAMADRYGRRFAMLVSLALQTVFGVAAAFAPNFPVYVGLRFIIGMTVSGVIINAFVLGTEWTCTQRRMLAGIFTDYFFGFGYMLLAGVAFLIRDWRKLQLAISAPGFLFIFYIWVLPHSARWLLVNNRKEEAIDLLRKAASVNGRTLPPTVQVERY----ESPQGRS---KYTVVDLLRTPQMRKRALILFYIWFVNVLVYYGLSLGVSDLGADLYLTQFMFGLVEIPARTLVLVLLPCSRKIPLSVFLVVGGG------ACLLTLTLPADSAHVRTALAMVGKFGITASFAIIYVYSAELFPTVLRQTGIGVSSMFARMGGVLAPLINLLGRHTP-VVP-----MLIFGSTPLLAAALALALPETARQPLPDSIHDTEKSTLKY 496          
BLAST of slc22a-6 vs. Ensembl Zebrafish
Match: oatx (organic anion transporter X [Source:ZFIN;Acc:ZDB-GENE-070115-1])

HSP 1 Score: 126.331 bits (316), Expect = 4.408e-30
Identity = 100/383 (26.11%), Postives = 188/383 (49.09%), Query Frame = 1
Query:  628 LGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRK-SVTENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKN--IITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKNF 1767
            L S+ GGVFS  FGR      SYF +++  +  A++P Y ++ + R  TG +VS   ++   + +E +    RT  G   S  +  G ++L  +A+ +RD  K+Q+A C   ++  ++ +++ ES RWL+   + ++A K++  +AK N K  +TE    + +E   ++ ++S     ++ ++ +   +    + L  ++FS SF+YY   +   K    I+   +I       ++ + + +   LGR      L  G   L  ASII   I+  ++  +  T L ++    +  +F  ++++ GE +PTVIR T +   S  +R+  M A  +  + +I P +  I+    A+   L   FLLPET   P  D +   E+ +
Sbjct:  150 LNSIPGGVFSCRFGRKALLIWSYFQLALLGSFTALAPSYVVYCIFRFLTGMSVSGVILNAVSLKVEWIPTKTRTLVGTLSSFFFTFGQMVLAGVAYSLRDWRKIQMAVCLPFFIFFMYSWWFSESARWLVLNGRSEEALKLLHRVAKINGKPEMTEKITLEELESHMQKEVQSSKSIYTVFDLLRTPTMRKISMCLMVVWFSTSFAYYGLAMDLQKFGVNIYLMQVIFGAVDFPAKLVALLMLSFLGR-----RLTQGACLLVSASIIFANIFVPEDMQVTRTALAVLGKGFTSASFTCVYLFTGELYPTVIRQTGMGFVSTMSRIGSMAAPAVLILDDILPALPSIVYGGSAVIAGLIA-FLLPETLNIPLPDTIDDVEEKW 526          
BLAST of slc22a-6 vs. Ensembl Zebrafish
Match: si:dkey-166k12.1 (si:dkey-166k12.1 [Source:ZFIN;Acc:ZDB-GENE-120215-78])

HSP 1 Score: 125.561 bits (314), Expect = 5.535e-30
Identity = 106/420 (25.24%), Postives = 201/420 (47.86%), Query Frame = 1
Query:  541 STIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTEN-QIDKYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFL--CKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGS-----LCTFFLLPETFKRPSSDFLSQAEKNFVEW 1776
            ST  +++ L C+   LSS  +S++MLG+ +G+V  G  +D +GR     +S  + +VF   AA +P + ++   R   G  VS   ++   +  E     +R   G +    +  GY+LL  +AF IRD  KLQLA     ++ + + +    S RWLL   + ++A  ++   A  N +++    Q+++Y    E  + RS   + ++ ++ +   +    L+L++I+F     YY   LG S +  +++    +  L  + +R++ + L  C R   +++ L +  G      A ++   +      + T L M+       +F  +++Y  E FPTV+R T + + S  AR+ G++A  +  +    P V+P     M +FGS           LPET ++P  D +   EK+ +++
Sbjct:  109 STTVTEWDLVCDKRGLSSLGSSIYMLGLLVGAVVFGAMADRYGRRFAMLVSLALQTVFGVAAAFAPNFPVYVGLRFIIGMTVSGVIINAFVLGTEWTCTQRRMLAGIFTDYFFGFGYMLLAGVAFLIRDWRKLQLAISAPGFLFIFYIWVLPHSARWLLVNNRKEEAIDLLRKAASVNGRTLPPTVQVERY----ESPQGRS---KYTVVDLLRTPQMRKRALILFYIWFVNVLVYYGLSLGVSDLGADLYLTQFMFGLVEIPARTLVLVLLPCSRKIPLSVFLVVGGG------ACLLTLTLPADSAHVRTALAMVGKFGITASFAIIYVYSAELFPTVLRQTGIGVSSMFARMGGVLAPLINLLGRHTP-VVP-----MLIFGSTPLLAAALALALPETARQPLPDSIHDTEKSTLKY 509          
BLAST of slc22a-6 vs. Ensembl Zebrafish
Match: slc22a6l (solute carrier family 22 member 6, like [Source:NCBI gene;Acc:404609])

HSP 1 Score: 122.479 bits (306), Expect = 7.658e-29
Identity = 114/433 (26.33%), Postives = 207/433 (47.81%), Query Frame = 1
Query:  535 MTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFEEERLRSVS---HRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIIL---KYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKNFVEWRQPWRKSSKKIID 1815
            M+STI +++ L C+Y AL   + + +M G+ +G++  G  SD FGR +   +S  M+++  T  A S  +T+  + R+  G A+S   +++  + +E +    RT  G      Y  G L+L  +A+ IRD   L LA     YVS ++ +++ ES RWL+ TKK ++A K +  +A+ N +S   ++ID  +E+ +E   + ++      S  ++ +   +    + L  ++FS SF+YY   +   K    I+   +I     + ++ I       LGR       Q G  AL +A I++     +     ++ T L +I       +F   ++Y GE +PTVIR + +   S  AR   M+A  +  + +  P +   I     +   +  FF LPET  +P  D +   +   +      R +SK++ +
Sbjct:  124 MSSTIITEWDLVCDYRALKQMSQTTYMGGVLVGAIVFGGLSDRFGRRVLLLISNLMMAIGGTCVAFSTSFTMFCVFRVCCGMALSGLVLNSFSLIVEWIPTRVRTVVGTGTGYCYTTGQLILAAVAYCIRDWRWLTLAVSLPFYVSFLYSWWFLESARWLVLTKKPEQAVKNLKTVARINGRSAEGDKID--LEMLQESMKKEMACSKGSYSALDLLRTSTMRTITICLSAVWFSTSFAYYGLSMDLQKFGVSIYLIQIIFGAVDIPAKIIVTICMSMLGR----RPSQCG--ALVLAGIMILINLLVPSDLQMLRTSLAVIGKGCLAASFNCCYLYAGELYPTVIRQSGMGWVSMMARFGAMVAPMVLLLGDDYPWIPGFIYGGAPIVSGIFAFF-LPETLSQPLPDTIQDIDDRGLA-----RTNSKRLPE 542          
BLAST of slc22a-6 vs. Ensembl Xenopus
Match: ENSXETT00000036038.1 (solute carrier family 22 (organic anion transporter), member 8 [Source:NCBI gene;Acc:100490266])

HSP 1 Score: 134.035 bits (336), Expect = 1.525e-32
Identity = 127/453 (28.04%), Postives = 215/453 (47.46%), Query Frame = 1
Query:  526 KYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFEEE---RLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISAL----GSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSG---TNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKNFVEWRQPWRKSSKKIIDTEIKV*HEYSVFE 1854
            K   +STI +++ L C        A S++M G+ +G++  G  SD +GR      SYF ++V    AA SP Y  + + R  TG A+S   ++ + + +E V    RT  G      Y  G LLL  LA+ +RD   LQL      ++  ++ +++ ES RWL+ + K +KA K +  +A  N K     +I   +E  + E    L S     S+ ++ +   +      L  ++FS SF+YY   +   K +  I+   +I         LVS +  +++ ++    T  +SL LG  A+ IA+I +       N + TV   +A+   G    +F  +++Y  E +PTVIR + + + S  AR+ G++A  ++ + E+ P V  +I     +   LC FF LPET  +P  D + + EK       P ++  K  +D+  +   E  V E
Sbjct:  118 KDEFSSTIITEWDLVCGRKTRRQLAQSIYMGGVLVGAIILGGLSDRYGRRALLIWSYFQLAVSGVCAAFSPNYLSYCIFRFLTGMALSGIGLNTTALIVEWVPTRVRTVTGTLAGFSYTAGQLLLAGLAYGMRDWRWLQLCVSLPFFIYFLYAWWFPESARWLVLSGKPEKAVKEIRKVANLNGKKEEGEKIT--LESLKSEMIKELASAKSSYSVIDLVRTNTIRRISCALSLVWFSTSFAYYGLAMDLQKFNVSIYLIQVIFGAVDFPAKLVSATAMIYVGRKF---TQFMSLILGGIAI-IANIFV------PNELQTVRTSLAVFGKGCLAASFSCIFLYTTELYPTVIRQSGLGMCSTMARIGGIVAPLVKILGELYPFVPLLIYGGAPIISGLCVFF-LPETVNKPLPDTIEEVEKGI---NAPKKEIEKNEMDSLKRGMKENPVNE 554          
BLAST of slc22a-6 vs. Ensembl Xenopus
Match: ENSXETT00000036031.1 (solute carrier family 22 (organic anion transporter), member 8 [Source:NCBI gene;Acc:100490266])

HSP 1 Score: 132.494 bits (332), Expect = 3.924e-32
Identity = 121/426 (28.40%), Postives = 206/426 (48.36%), Query Frame = 1
Query:  526 KYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFEEE---RLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISAL----GSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSG---TNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKNFVE 1773
            K   +STI +++ L C        A S++M G+ +G++  G  SD +GR      SYF ++V    AA SP Y  + + R  TG A+S   ++ + + +E V    RT  G      Y  G LLL  LA+ +RD   LQL      ++  ++ +++ ES RWL+ + K +KA K +  +A  N K     +I   +E  + E    L S     S+ ++ +   +      L  ++FS SF+YY   +   K +  I+   +I         LVS +  +++ ++    T  +SL LG  A+ IA+I +       N + TV   +A+   G    +F  +++Y  E +PTVIR + + + S  AR+ G++A  ++ + E+ P V  +I     +   LC FF LPET  +P  D + + EK  ++
Sbjct:  118 KDEFSSTIITEWDLVCGRKTRRQLAQSIYMGGVLVGAIILGGLSDRYGRRALLIWSYFQLAVSGVCAAFSPNYLSYCIFRFLTGMALSGIGLNTTALIVEWVPTRVRTVTGTLAGFSYTAGQLLLAGLAYGMRDWRWLQLCVSLPFFIYFLYAWWFPESARWLVLSGKPEKAVKEIRKVANLNGKKEEGEKIT--LESLKSEMIKELASAKSSYSVIDLVRTNTIRRISCALSLVWFSTSFAYYGLAMDLQKFNVSIYLIQVIFGAVDFPAKLVSATAMIYVGRKF---TQFMSLILGGIAI-IANIFV------PNELQTVRTSLAVFGKGCLAASFSCIFLYTTELYPTVIRQSGLGMCSTMARIGGIVAPLVKILGELYPFVPLLIYGGAPIISGLCVFF-LPETVNKPLPDTIEEVEKGELD 530          
BLAST of slc22a-6 vs. Ensembl Xenopus
Match: ENSXETT00000022873.1 (solute carrier family 22 (organic anion transporter), member 8 [Source:NCBI gene;Acc:100490266])

HSP 1 Score: 132.494 bits (332), Expect = 5.038e-32
Identity = 121/423 (28.61%), Postives = 204/423 (48.23%), Query Frame = 1
Query:  526 KYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFEEE---RLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISAL----GSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSG---TNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKN 1764
            K   +STI +++ L C        A S++M G+ +G++  G  SD +GR      SYF ++V    AA SP Y  + + R  TG A+S   ++ + + +E V    RT  G      Y  G LLL  LA+ +RD   LQL      ++  ++ +++ ES RWL+ + K +KA K +  +A  N K     +I   +E  + E    L S     S+ ++ +   +      L  ++FS SF+YY   +   K +  I+   +I         LVS +  +++ ++    T  +SL LG  A+ IA+I +       N + TV   +A+   G    +F  +++Y  E +PTVIR + + + S  AR+ G++A  ++ + E+ P V  +I     +   LC FF LPET  +P  D + + EK 
Sbjct:  118 KDEFSSTIITEWDLVCGRKTRRQLAQSIYMGGVLVGAIILGGLSDRYGRRALLIWSYFQLAVSGVCAAFSPNYLSYCIFRFLTGMALSGIGLNTTALIVEWVPTRVRTVTGTLAGFSYTAGQLLLAGLAYGMRDWRWLQLCVSLPFFIYFLYAWWFPESARWLVLSGKPEKAVKEIRKVANLNGKKEEGEKIT--LESLKSEMIKELASAKSSYSVIDLVRTNTIRRISCALSLVWFSTSFAYYGLAMDLQKFNVSIYLIQVIFGAVDFPAKLVSATAMIYVGRKF---TQFMSLILGGIAI-IANIFV------PNELQTVRTSLAVFGKGCLAASFSCIFLYTTELYPTVIRQSGLGMCSTMARIGGIVAPLVKILGELYPFVPLLIYGGAPIISGLCVFF-LPETVNKPLPDTIEEVEKG 527          
BLAST of slc22a-6 vs. Ensembl Xenopus
Match: ENSXETT00000022866.1 (solute carrier family 22 (organic anion transporter), member 8 [Source:NCBI gene;Acc:100490266])

HSP 1 Score: 128.257 bits (321), Expect = 1.242e-30
Identity = 121/426 (28.40%), Postives = 206/426 (48.36%), Query Frame = 1
Query:  526 KYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFEEE---RLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISAL----GSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSG---TNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKNFVE 1773
            K   +STI +++ L C        A S++M G+ +G++  G  SD +GR      SYF ++V    AA SP Y  + + R  TG A+S   ++ + + +E V    RT  G      Y  G LLL  LA+ +RD   LQL      ++  ++ +++ ES RWL+ + K +KA K +  +A  N K     +I   +E  + E    L S     S+ ++ +   +      L  ++FS SF+YY   +   K +  I+   +I         LVS +  +++ ++    T  +SL LG  A+ IA+I +       N + TV   +A+   G    +F  +++Y  E +PTVIR + + + S  AR+ G++A  ++ + E+ P V  +I     +   LC FF LPET  +P  D + +  K+ V+
Sbjct:  118 KDEFSSTIITEWDLVCGRKTRRQLAQSIYMGGVLVGAIILGGLSDRYGRRALLIWSYFQLAVSGVCAAFSPNYLSYCIFRFLTGMALSGIGLNTTALIVEWVPTRVRTVTGTLAGFSYTAGQLLLAGLAYGMRDWRWLQLCVSLPFFIYFLYAWWFPESARWLVLSGKPEKAVKEIRKVANLNGKKEEGEKIT--LESLKSEMIKELASAKSSYSVIDLVRTNTIRRISCALSLVWFSTSFAYYGLAMDLQKFNVSIYLIQVIFGAVDFPAKLVSATAMIYVGRKF---TQFMSLILGGIAI-IANIFV------PNELQTVRTSLAVFGKGCLAASFSCIFLYTTELYPTVIRQSGLGMCSTMARIGGIVAPLVKILGELYPFVPLLIYGGAPIISGLCVFF-LPETVNKPLPDTIEE-HKDIVK 529          
BLAST of slc22a-6 vs. Ensembl Xenopus
Match: ENSXETT00000046179.1 (solute carrier family 22 member 20, pseudogene gene1 [Source:NCBI gene;Acc:100489586])

HSP 1 Score: 119.783 bits (299), Expect = 7.503e-28
Identity = 113/454 (24.89%), Postives = 207/454 (45.59%), Query Frame = 1
Query:  487 TNISSICSEIFV-KKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGR---IIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFE-EERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIF----TAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKNFVEWRQPWRKSSKKIIDTE 1821
            TN +  C + +V  K   +STI +++ L C+   +   A S++M G+ +G+V  G  SD  GR   +IG   S  +++V  T AA  P +  +   R   G A S   ++ + + LE      RT  G  ++ G+  G +LL  LA+ IR+   LQ A     Y   ++ +   ES RWL+   +  +A K +  +A  N K     ++ + I I   +  L  V    S+ ++F+   +    + L  ++FS   ++Y   +        IF    T   I     +V+  +  ++ +R+ + T+L+   L   AL   +    +I  G  I+  VL +        +F   +++ GE FPTVIR T + + +  ARV  ++A  +  ++EI+P +LP     +A   +      L ET  +   + + + E ++   ++P +K +    D +
Sbjct:   98 TNHTEPCEDGWVYDKSDFSSTIVTEWDLVCKLRKMRQIAQSIYMAGVLVGAVLLGGLSDRLGRRALLIG---SNLVMAVCGTCAAFLPNFITYCTFRCLCGIAFSGITLNTNSLILEWTPPKGRTIMGTLFAAGFTCGQILLAALAYGIREWRWLQFAVSAPFYFFFLYSWLVPESARWLILKGRSHEALKALQRVAIINGKREEGQKLSEMILISHMQSELNQVKRPHSLFDLFRTPGMRKVTICLMMVWFSSGVAFYGLGMDLQNFGISIFLLQFTFGAIDMPAKVVAALLMTYMGRRVTQATVLI---LSGVALLTNA----FIPQGMKILRMVLAVFGKGCMAASFACAYLFSGELFPTVIRQTGMGVVAMMARVGSVVAPLVLLLWEISP-ILPSAIYGIAAIIAGGAATFLMETNNQQLPESVEEVEASYQLIKEPKKKKNNHYEDIQ 540          
BLAST of slc22a-6 vs. Ensembl Mouse
Match: Slc22a6 (solute carrier family 22 (organic anion transporter), member 6 [Source:MGI Symbol;Acc:MGI:892001])

HSP 1 Score: 130.954 bits (328), Expect = 9.734e-32
Identity = 109/423 (25.77%), Postives = 199/423 (47.04%), Query Frame = 1
Query:  487 TNISSICSEIFV-KKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFE---EERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTI-LLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSD 1740
            T ++  C + +V       STI +++ L C + A    A S+FM+G+ LG++  G  +D  GR     L+Y   +V  T AA +P YT++ + RL +G +++   ++   + +E + I  R   G      Y +G  LL  +A+ +     LQLA     +V+ I+ +F+ ES RW  ++ +     + +  +A+ N K   E      IE+ +   ++ L     + S  E+ +   +    L L  ++F+ SF+YY  ++        ++   +I     L ++ +   +   +GR    L SL L    + +  II +    G  II T L ++      ++F  +++Y GE +PT+IR T + +GS  ARV  +++  +    E  P++   I   + +  S  T  LLPET  +P  D
Sbjct:   93 TGVTEPCLDGWVYDNSTFPSTIVTEWNLVCSHRAFRQLAQSLFMVGVLLGAMMFGYLADRLGRRKVLILNYLQTAVSGTCAAYAPNYTVYCIFRLLSGMSLASIAINCMTLNMEWMPIHTRAYVGTLIGYVYSLGQFLLAGIAYAVPHWRHLQLAVSVPFFVAFIYSWFFIESARWYSSSGRLDLTLRALQRVARINGKQ--EEGAKLSIEVLQTSLQKELTLNKGQASAMELLRCPTLRRLFLCLSMLWFATSFAYYGLVMDLQGFGVSMYLIQVIFGAVDLPAKFVCFLVINSMGRRPAQLASLLLAGICILVNGIIPR----GHTIIRTSLAVLGKGCLASSFNCIFLYTGELYPTMIRQTGLGMGSTMARVGSIVSPLISMTAEFYPSIPLFIFGAVPVAASAVT-ALLPETLGQPLPD 508          
BLAST of slc22a-6 vs. Ensembl Mouse
Match: Slc22a7 (solute carrier family 22 (organic anion transporter), member 7 [Source:MGI Symbol;Acc:MGI:1859559])

HSP 1 Score: 126.331 bits (316), Expect = 4.054e-30
Identity = 128/532 (24.06%), Postives = 233/532 (43.80%), Query Frame = 1
Query:  238 EKIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLPKNQTN----------QVFTEHRNQF---------KAINNET-GFLIIDSSRCRLTNISSICSEIF-VKKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYI--EIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKN 1764
            E++   VGG   FQ   L+ + + +F   ++ L+PIF+      +C LP    N           +  E    F         +A+ N T G  + +S       ++  CS+ +   +   +STI +++ L C+   L+   ++ F +G+ LG+V  G  SD FGR     ++Y        ++A S  Y +    R+ TG A++   +    + LE +++  RT  G   +  +  G LLL L+ + IR    L LA        +I  ++  ES RWLL   + ++AKK +   AK N + ++E+ + +    ++   ER   VS R S  ++F+   +    L    ++F  +FSYY   L +S +   ++   L+     + S+    FL + +GR      + L     F  S++   +        T L++I  + S   F   +++  E +PTV+R T +   +   R+   +A  +  + +    +LP +      F + CT  LLPET K    + +   E+ 
Sbjct:    4 EELLHKVGGFGPFQLRNLVLLALPRFLLPMHFLLPIFMAAVPAHHCALPDAPANLSHQDLWLKTHLPRETDGSFSSCLRFAYPQALPNVTLGTEVYNSGEPEGEPLTVPCSQGWEYDRSEFSSTIATEWDLVCQQRGLNKVTSTCFFIGVLLGAVVYGYLSDRFGRRRLLLVAYVSTLALGLMSAASVNYIMFVTTRMLTGSALAGFTIIVLPLELEWLDVEHRTVAGVISTTFWTGGVLLLTLVGYLIRSWRWLLLAATLPCVPGIISIWWVPESARWLLTQGRVEEAKKYLSICAKLNGRPISEDSLSQEALNKVITMER---VSQRPSYLDLFRTSQLRHVSLCCMMMWFGVNFSYYGLTLDASGLGLTVYQTQLLFGAVEVPSKITVFFLVRLVGRRLTEAGMLLATALTFGISLL---VSSDTKSWITALVVIGKAFSEAAFTTAYLFTSELYPTVLRQTGMGFTALIGRLGASLAPLVV-LLDGVWLLLPKLAYGGISFLAACTVLLLPETKKAQLPETIQDVERK 528          
BLAST of slc22a-6 vs. Ensembl Mouse
Match: Slc22a8 (solute carrier family 22 (organic anion transporter), member 8 [Source:MGI Symbol;Acc:MGI:1336187])

HSP 1 Score: 119.783 bits (299), Expect = 5.709e-28
Identity = 130/530 (24.53%), Postives = 235/530 (44.34%), Query Frame = 1
Query:  241 KIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLPKNQTNQVFTEHRNQFKAINNETGFLIIDSSRCRLTNISSICSEIFVKKYPMTS---TIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQR----TNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFN-RKSVTENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKNFVEWRQPWRKSSKK 1806
            +I   VG    FQY  +  + +     A + L+ IF     D +C  P N + + +            E     +      L N +   +E  +  +   S   TI +++ L C  + L   A S+FM GI +G    G  SD FGR      SY +++   + AA SP  T++ + R   G ++S   +S   + +E V  S R    T  G+     Y IG  +L  LA+ +     LQL+     ++  +  ++  ES RWL+ + K+ KA K +  +A FN +K   E    + ++   ++ + S   +  + ++F+  ++      L   +F+  F+YY+  +G  +    I+   +I     + ++ I +     LGR  I     L +  + I ++I  ++     ++ T L +        +F  +++Y  E +PTV+R T + I +  ARV  MIA  ++   E+ P +  +I  TM + G    FFLL ET  RP    L +  ++  +W Q  +K+ ++
Sbjct:    5 EILDRVGSMGPFQYLHVTLLALPILGIANHNLLQIFTATTPDHHCRPPPNASLEPWVLPLGPNG--KPEKCLRFVHLPNASLPNDTQGATEPCLDGWIYNSTRDTIVTEWDLVCGSNKLKEMAQSVFMAGILVGGPVFGELSDRFGRKPILTWSYLLLAASGSSAAFSPSLTVYMIFRFLCGCSISGISLSTIILNVEWVPTSTRAISSTTIGYC----YTIGQFILPGLAYAVPQWRWLQLSVSAAFFIFSLLSWWVPESIRWLVLSGKFSKALKTLQRVATFNGKKEEGEKLTVEELKFNLQKDITSAKVKYGLSDLFRVSILRRVTFCLSLAWFATGFAYYSLAMGVEEFGVNIYILQIIFGGVDIPAKFITILSISYLGR-RITQGFLLILAGVAILALI--FVSSEMQLLRTALAVFGKGCLSGSFSCLFLYTSELYPTVLRQTGMGISNIWARVGSMIAPLVKITGELQPFIPNVIFGTMTLLGGSAAFFLL-ETLNRP----LPETIEDIQDWYQQTKKTKQE 520          
BLAST of slc22a-6 vs. Ensembl Mouse
Match: Slc22a8 (solute carrier family 22 (organic anion transporter), member 8 [Source:MGI Symbol;Acc:MGI:1336187])

HSP 1 Score: 119.783 bits (299), Expect = 5.709e-28
Identity = 130/530 (24.53%), Postives = 235/530 (44.34%), Query Frame = 1
Query:  241 KIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLPKNQTNQVFTEHRNQFKAINNETGFLIIDSSRCRLTNISSICSEIFVKKYPMTS---TIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQR----TNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFN-RKSVTENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKNFVEWRQPWRKSSKK 1806
            +I   VG    FQY  +  + +     A + L+ IF     D +C  P N + + +            E     +      L N +   +E  +  +   S   TI +++ L C  + L   A S+FM GI +G    G  SD FGR      SY +++   + AA SP  T++ + R   G ++S   +S   + +E V  S R    T  G+     Y IG  +L  LA+ +     LQL+     ++  +  ++  ES RWL+ + K+ KA K +  +A FN +K   E    + ++   ++ + S   +  + ++F+  ++      L   +F+  F+YY+  +G  +    I+   +I     + ++ I +     LGR  I     L +  + I ++I  ++     ++ T L +        +F  +++Y  E +PTV+R T + I +  ARV  MIA  ++   E+ P +  +I  TM + G    FFLL ET  RP    L +  ++  +W Q  +K+ ++
Sbjct:    5 EILDRVGSMGPFQYLHVTLLALPILGIANHNLLQIFTATTPDHHCRPPPNASLEPWVLPLGPNG--KPEKCLRFVHLPNASLPNDTQGATEPCLDGWIYNSTRDTIVTEWDLVCGSNKLKEMAQSVFMAGILVGGPVFGELSDRFGRKPILTWSYLLLAASGSSAAFSPSLTVYMIFRFLCGCSISGISLSTIILNVEWVPTSTRAISSTTIGYC----YTIGQFILPGLAYAVPQWRWLQLSVSAAFFIFSLLSWWVPESIRWLVLSGKFSKALKTLQRVATFNGKKEEGEKLTVEELKFNLQKDITSAKVKYGLSDLFRVSILRRVTFCLSLAWFATGFAYYSLAMGVEEFGVNIYILQIIFGGVDIPAKFITILSISYLGR-RITQGFLLILAGVAILALI--FVSSEMQLLRTALAVFGKGCLSGSFSCLFLYTSELYPTVLRQTGMGISNIWARVGSMIAPLVKITGELQPFIPNVIFGTMTLLGGSAAFFLL-ETLNRP----LPETIEDIQDWYQQTKKTKQE 520          
BLAST of slc22a-6 vs. Ensembl Mouse
Match: Slc22a12 (solute carrier family 22 (organic anion/cation transporter), member 12 [Source:MGI Symbol;Acc:MGI:1195269])

HSP 1 Score: 112.849 bits (281), Expect = 1.105e-25
Identity = 118/478 (24.69%), Postives = 206/478 (43.10%), Query Frame = 1
Query:  382 PKNQTNQVFTEHRNQFKAI-NNETGFLIIDSSRCRLTNISSICSEIFVKKYPM-TSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYI--EIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVS---RSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQME-------WVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKNFVE 1773
            P  Q +Q     + Q++   +N T     D++       +  C + +V  +    STI + + L C   AL   A S+F+ GI +G+   G  SD FGR      SY ++SV  T AA  P + L+ L R     AV+   ++ + + +E              +LG+  G +L   +A+ +R    LQLA     ++  ++ ++  ES RWL+   K  +  + +  +A  NR+    + +   +     EEE  R  +   S+  +     +    ++    +F+  F++Y   L    +   IF   L+ AL  +V    ++  + L  RLGR    +S  L +  L I S IL  +  G  ++ + L ++ +   G  F  + I+  E FPTVIR T+V +    AR   M+   +        W+  +   V+P++    A+        LLPET   P  D +   +K  V+
Sbjct:   81 PDQQPHQCLRFRQPQWQLTESNATATNWSDAA-------TEPCEDGWVYDHSTFRSTIVTTWDLVCNSQALRPMAQSIFLAGILVGAAVCGHASDRFGRRRVLTWSYLLVSVSGTAAAFMPTFPLYCLFRFLLASAVAGVMMNTASLLMEWTSAQGSPLVMTLNALGFSFGQVLTGSVAYGVRSWRMLQLAVSAPFFLFFVYSWWLPESARWLITVGKLDQGLQELQRVAAVNRRKAEGDTLTMEVLRSAMEEEPSRDKAG-ASLGTLLHTPGLRHRTIISMLCWFAFGFTFYGLALDLQALGSNIF---LLQALIGIVDFPVKTGSLLLISRLGRRLCQVSF-LVLPGLCILSNIL--VPHGMGVLRSALAVLGLGCLGGAFTCITIFSSELFPTVIRMTAVGLCQVAARGGAMLGPLVRLLGVYGSWMPLLVYGVVPVLSGLAAL--------LLPETKNLPLPDTIQDIQKQSVK 536          
BLAST of slc22a-6 vs. UniProt/SwissProt
Match: sp|Q9VCA2|ORCT_DROME (Organic cation transporter protein OS=Drosophila melanogaster OX=7227 GN=Orct PE=1 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 7.560e-32
Identity = 127/523 (24.28%), Postives = 229/523 (43.79%), Query Frame = 1
Query:  274 FQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLP-KNQTNQVFTEHRNQFKAINNET-GFLIID-------SSRCRLTNISSICSEIFVKKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVT----ENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKNFVEWRQPWRKSSK 1803
            +Q  I   + +     A + L  +F+    D  C LP +N +    + H        NE   +  +D        S  R +N +  CS     +    ++  +++ L C    LS+ + S+FMLG+ LGS+  G  SD  GR      S  +  +F  +AAV+P Y  + + R+  G   S  F+    +ALE+V  S R   G    + + +G++L    A+FI D   LQ+A      + L + +   ES RWLL   +  +A  ++   AK N+  V     E  +D+  E  +++ + +     ++ ++ +Y  +    L+++F +F  S  YY     ++ +        +IS    +   ++ +F   R GR +IL    +      +A+I   ++    N +     MI      +++G ++I+  E FPTV+R   +   S  ARV G++A  ++ + EI    LP+I        +     LLPET  +P  + +   E NF +   P   + +
Sbjct:   16 YQKRIYYLLCLPAIVCAFHKLAGVFLLAKPDFRCALPYENGSIYELSPHLWNLSYPENERCSYYDVDYTEEYLNGSIPRSSNETKTCSSYVYDRSKYLNSAVTEWNLVCSRSLLSATSDSLFMLGVLLGSLIFGQMSDKLGRKPTFFASLVLQLIFGVLAAVAPEYFSYTISRMIVGATTSGVFLVAYVIALEMVGSSYRLFAGVAMQMFFSVGFMLTAGFAYFIHDWRWLQIAITLPGLLFLCYYWIIPESARWLLMKGRKDEAFVIIEKAAKENKVEVPNEIYEQLVDEVAEKKKQDEMAASQPAATVFDLLRYPNLRRKTLLIFFDWFVNSGVYYGLSWNTNNLGGNQLVNFMISGAVEIPGYTLLLFTLNRWGRRSILCGTMMVAGISLLATI---FVPSDMNWLIVACAMIGKLAITSSYGTIYIFSAEQFPTVVRNVGLGASSMVARVGGILAPYLKLLGEIW-RPLPLIICGALSLTAGLLSLLLPETLNKPMPETIEDGE-NFGKKPAPQETAEE 533          
BLAST of slc22a-6 vs. UniProt/SwissProt
Match: sp|Q95R48|OCTL_DROME (Organic cation transporter-like protein OS=Drosophila melanogaster OX=7227 GN=Orct2 PE=2 SV=2)

HSP 1 Score: 131.724 bits (330), Expect = 5.309e-31
Identity = 133/533 (24.95%), Postives = 235/533 (44.09%), Query Frame = 1
Query:  235 SEKIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLP-KNQTNQVFTEHRNQFKAINNET-GFLIID-------SSRCRLTNISSICSEIFVKKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFY---KESFRWLLATXXXXXXXXVMMHIAKFNRKSVT-----------ENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEI-APNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEK 1761
             E I  L G    +Q  I   I ++    A + L  +F+    D  C LP +N ++     H        NE   +  +D        S  R +N +  CS     +    ++  +++ L C    +++ + S+FMLG+ LGS+  G  SD +GR      S  +  +F  +A V+P Y  +   RL  G   S  F+    +A+E+V   +R   G +  + + +G++L  + A+F+ D   LQ+A   ++   LIF F+Y    ES RWLL   +   A   M   A+FN+  ++           EN  +K  +  E++ L       S+ ++F Y  +    L+++  +   S  YY     +S +   +    +IS    + +    +    R GR +IL    +      +A++I+        +   +L  +AI+ S   +G ++I+  E FPTV+R  ++   S  AR+SGM+A  + ++  I  P  L I G    + G      LLPET  +P  + ++  E+
Sbjct:    4 DEAIIHL-GDFGRYQKIIYFLICLTSIPVAFHKLAGVFLLAKPDFRCALPFENGSSYDLPTHLWNLSYPENERCSYYDVDYTEEYLNGSIPRSSNETKTCSSYVYDRSKYLNSAVTEWNLVCGRDFMAATSDSLFMLGVLLGSIVFGQLSDKYGRKPILFASLVIQVLFGVLAGVAPEYFTYTFARLMVGATTSGVFLVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAVFAYFVHDWRWLQIA---LTLPGLIFMFYYWIIPESARWLLLKGRKDCAIANMQKAARFNKVEISDEALSELLDEGENSEEKAKQKLEDQELDE-GPPPSVWDLFCYPNLRRKTLLIFLDWLVTSGVYYGLSWNTSNLGGNVLLNFVISGAVEIPAYIFLLLTLNRWGRRSILCGCLVMAGLSLLATVIIPQRMHTLIVACAMLGKLAITAS---YGTVYIFSAEQFPTVVRNVALGAASMVARISGMMAPFLNFLATIWKPLPLLICGSLTLVAGL--LSLLLPETHNKPMLETIADGER 526          
BLAST of slc22a-6 vs. UniProt/SwissProt
Match: sp|Q8VC69|S22A6_MOUSE (Solute carrier family 22 member 6 OS=Mus musculus OX=10090 GN=Slc22a6 PE=1 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 6.809e-31
Identity = 109/423 (25.77%), Postives = 199/423 (47.04%), Query Frame = 1
Query:  487 TNISSICSEIFV-KKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFE---EERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTI-LLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSD 1740
            T ++  C + +V       STI +++ L C + A    A S+FM+G+ LG++  G  +D  GR     L+Y   +V  T AA +P YT++ + RL +G +++   ++   + +E + I  R   G      Y +G  LL  +A+ +     LQLA     +V+ I+ +F+ ES RW  ++ +     + +  +A+ N K   E      IE+ +   ++ L     + S  E+ +   +    L L  ++F+ SF+YY  ++        ++   +I     L ++ +   +   +GR    L SL L    + +  II +    G  II T L ++      ++F  +++Y GE +PT+IR T + +GS  ARV  +++  +    E  P++   I   + +  S  T  LLPET  +P  D
Sbjct:   93 TGVTEPCLDGWVYDNSTFPSTIVTEWNLVCSHRAFRQLAQSLFMVGVLLGAMMFGYLADRLGRRKVLILNYLQTAVSGTCAAYAPNYTVYCIFRLLSGMSLASIAINCMTLNMEWMPIHTRAYVGTLIGYVYSLGQFLLAGIAYAVPHWRHLQLAVSVPFFVAFIYSWFFIESARWYSSSGRLDLTLRALQRVARINGKQ--EEGAKLSIEVLQTSLQKELTLNKGQASAMELLRCPTLRRLFLCLSMLWFATSFAYYGLVMDLQGFGVSMYLIQVIFGAVDLPAKFVCFLVINSMGRRPAQLASLLLAGICILVNGIIPR----GHTIIRTSLAVLGKGCLASSFNCIFLYTGELYPTMIRQTGLGMGSTMARVGSIVSPLISMTAEFYPSIPLFIFGAVPVAASAVT-ALLPETLGQPLPD 508          
BLAST of slc22a-6 vs. UniProt/SwissProt
Match: sp|Q91WU2|S22A7_MOUSE (Solute carrier family 22 member 7 OS=Mus musculus OX=10090 GN=Slc22a7 PE=1 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 9.745e-30
Identity = 129/532 (24.25%), Postives = 233/532 (43.80%), Query Frame = 1
Query:  238 EKIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLPKNQTN----------QVFTEHRNQF---------KAINNET-GFLIIDSSRCRLTNISSICSEIF-VKKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYI--EIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKN 1764
            E++   VGG   FQ   L+ + + +F   ++ L+PIF+      +C LP    N           +  E    F         +A+ N T G  + +S       ++  CS+ +   +   +STI +++ L CE   L+   ++ F +G+ LG+V  G  SD FGR     ++Y        ++A S  Y +    R+ TG A++   +    + LE +++  RT  G   +  +  G LLL L+ + IR    L LA        +I  ++  ES RWLL   + ++AKK +   AK N + ++E+ + +    ++   ER   VS R S  ++F+   +    L    ++F  +FSYY   L +S +   ++   L+     + S+    FL + +GR      + L     F  S++   +        T L++I  + S   F   +++  E +PTV+R T +   +   R+   +A  +  + +    +LP +      F + CT  LLPET K    + +   E+ 
Sbjct:    4 EELLHKVGGFGPFQLRNLVLLALPRFLLPMHFLLPIFMAAVPAHHCALPDAPANLSHQDLWLKTHLPRETDGSFSSCLRFAYPQALPNVTLGTEVYNSGEPEGEPLTVPCSQGWEYDRSEFSSTIATEWDLVCEQRGLNKVTSTCFFIGVLLGAVVYGYLSDRFGRRRLLLVAYVSTLALGLMSAASVNYIMFVTTRMLTGSALAGFTIIVLPLELEWLDVEHRTVAGVISTTFWTGGVLLLTLVGYLIRSWRWLLLAATLPCVPGIISIWWVPESARWLLTQGRVEEAKKYLSICAKLNGRPISEDSLSQEALNKVITMER---VSQRPSYLDLFRTSQLRHVSLCCMMMWFGVNFSYYGLTLDASGLGLTVYQTQLLFGAVEVPSKITVFFLVRLVGRRLTEAGMLLATALTFGISLL---VSSDTKSWITALVVIGKAFSEAAFTTAYLFTSELYPTVLRQTGMGFTALIGRLGASLAPLVV-LLDGVWLLLPKLAYGGISFLAACTVLLLPETKKAQLPETIQDVERK 528          
BLAST of slc22a-6 vs. UniProt/SwissProt
Match: sp|O57379|S22A6_PSEAM (Solute carrier family 22 member 6 OS=Pseudopleuronectes americanus OX=8265 GN=SLC22A6 PE=1 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 8.796e-29
Identity = 105/410 (25.61%), Postives = 192/410 (46.83%), Query Frame = 1
Query:  538 TSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQID-KYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKN 1764
            +STI S++ L C+ H+      +++M G+ +G++  G  SD +GR I   +S  +++V  T AA S  ++L  + R   G A+S   ++   + +E +    RT  G      Y +G L+LVLLA+FIRD   L LA     YV  +  +++ ES RWL  + + + A K +  +A+FN +     ++D K +    ++ +       SI ++F    +    L L  ++ S SF+YY   +   K   +I+   +I     + ++ + +     +GR     ++ +      + ++++ Y    K  I T L ++       +F   ++Y GE FPT+IR   +   S  AR+  M+A  +    +  P +  +I     +   L   F LPET   P  D +   E++
Sbjct:  129 SSTIISEWHLVCDMHSFKQMGQTIYMGGVLVGALLFGGLSDRYGRRILLLISNLLMAVSGTCAAFSSSFSLFCVFRFGCGLALSGLGLNTFSLIVEWIPTRIRTAVGTTTGYCYTLGQLILVLLAYFIRDWRWLTLAVSLPFYVFFLIAWWFHESSRWLALSNRTEHALKNLKSVARFNGRHEEAEKLDIKMLHESMKKEMSCTQGSYSILDLFNTPAMRKRTLCLSAVWLSTSFAYYGLAMDLDKFGVDIYLIQVIFGAVDIPAKVVVVVSMSLIGRRRSQCAVLVVAGITILLNLLVPY---DKQTIRTCLAVLGKGCLAASFNCCYLYSGELFPTIIRQNGMGWVSMMARIGAMVAPMVLLTRDYIPWLPGLIYGGAPILSGLAAIF-LPETLGYPLPDTIQDVEES 534          
BLAST of slc22a-6 vs. TrEMBL
Match: A0A0H3YJ98 (Slc22a-6 OS=Schmidtea mediterranea OX=79327 GN=slc22a-6 PE=2 SV=1)

HSP 1 Score: 1046.96 bits (2706), Expect = 0.000e+0
Identity = 533/533 (100.00%), Postives = 533/533 (100.00%), Query Frame = 1
Query:  232 MSEKIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLPKNQTNQVFTEHRNQFKAINNETGFLIIDSSRCRLTNISSICSEIFVKKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKNFVEWRQPWRKSSKKIIDTEIKV 1830
            MSEKIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLPKNQTNQVFTEHRNQFKAINNETGFLIIDSSRCRLTNISSICSEIFVKKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATKKYKKAKKVMMHIAKFNRKSVTENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKVVLVNLLVLWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKNFVEWRQPWRKSSKKIIDTEIKV
Sbjct:    1 MSEKIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLPKNQTNQVFTEHRNQFKAINNETGFLIIDSSRCRLTNISSICSEIFVKKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATKKYKKAKKVMMHIAKFNRKSVTENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKVVLVNLLVLWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKNFVEWRQPWRKSSKKIIDTEIKV 533          
BLAST of slc22a-6 vs. TrEMBL
Match: A0A1D2NMQ1 (Organic cation transporter protein OS=Orchesella cincta OX=48709 GN=Ocin01_00454 PE=4 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 2.195e-37
Identity = 140/547 (25.59%), Postives = 247/547 (45.16%), Query Frame = 1
Query:  199 EIKLKITLLKQMSEK-----IYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLP-KNQTNQVFTEHRNQFKAINNETGFLIIDSSR---CRLTNISSICSEIFVKKYPMTSTI-----------------RSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEK 1761
            E+KLK+   ++   K     ++ ++G    +Q  + + + +     A++ L  +F+    D  C LP + ++  V+ E     + I     F      +   CR   +     E F    P T+T                  R  + L C+   + + A ++FM+GI +GS+  G  SD +GR     LS  +  VF  +A ++P Y    + R+  G + S  F+    +A+E+V  S+RT  G    L +  GYL+  +LA+ I D   LQ+A      V L + +F  ES RWLLA  +  +A  ++  +AK N+ +++    D+ +E   +E   +     S+ ++FKYK + +  L ++  +F  S  YY   L +S +    +    I+    + +    +F   R GR  +L    L   A F+++  L       N +     MI       ++G ++I+  E+FPTV+R + V   S CARV G++A+ +  + ++    LP++    A F S     L+PETF +   D +   EK
Sbjct:   74 EVKLKVEPREEDENKMKFDSLFPIIGDFGRYQKRVYLLLCLPAICCAMHKLAWVFLGAKLDHRCRLPIETESTAVYNELP---QGIPFNMTFPFEKDGKVESCRRLAVDFTDQEYFNAGVPSTNTTKCGDEYVFDYSKYKTSARVDYNLLCDNQFMYTNAQTLFMVGILIGSILFGDLSDRYGRRPIFFLSLVLQVVFGILAGLAPEYWTFVIARMIVGSSTSGIFLVGFVIAMEMVGPSKRTFVGVVCQLFFTAGYLVTAVLAYLITDWKMLQIALSVPGLVFLSYYWFLPESVRWLLARGRKDEANAILKDVAKENKVTLS----DEVLESLSDEPKTNPMQSASVLDLFKYKRMSLRSLNIFLCWFVNSGVYYGLSLNTSNLGGNDYINFAIAGAVEVPAYLFLLFSLNRFGRKVVLCGCMLAGGA-FMSACALVPESEEWNWVLIAFAMIGKMCITASYGVIYIFSAESFPTVVRNSGVGASSMCARVGGIVANNLLLLGDLIWKPLPLLIFGAASFISGLLSLLIPETFGKRLPDTMEDGEK 612          
BLAST of slc22a-6 vs. TrEMBL
Match: A0A3B3BBV4 (MFS domain-containing protein OS=Oryzias melastigma OX=30732 PE=4 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 3.025e-36
Identity = 108/406 (26.60%), Postives = 209/406 (51.48%), Query Frame = 1
Query:  541 STIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAE 1758
            ST  +++ L CE  ++++  +S++M G+ +G++  G  +D +GR I   +S  + +VF T AA +P + ++   R   G ++S   ++   +  E   + QR   G      +  GY+LL  LA+ IRD  KLQLA     ++ +I+ +   +S RWL+A  + ++A +V++  A+ N K ++++ I+   ++++ ++   +  + S  ++ +   +  + L++++++F     YY   L  S     I+   +I  L  + +R+I +F   R  +++ L  L +G +A  +   I   ++    I+ T+L MI       +   +++Y  E FPTVIR   + IGS CAR  G++A  M  +  I+P+   ++     + GS  T  LLPET  +P  D +   E
Sbjct:  109 STTVTEWDLVCENASMNNLGSSIYMFGLLVGALVFGNLADKYGRRIIILISLAIQAVFGTAAAFAPNFYVYTALRFMVGTSISGVIMNAFVLGTEWTGLKQRMLAGIITDYFFGFGYILLAGLAYLIRDWRKLQLAISAPGFLFIIYIWVLPKSARWLMANDRVEEALEVIVKAAQMNGKPISKD-IEMCQQVYKADQTAVLKKKHSFVDLVRTPTMRKHSLIVFYLWFVNVLVYYGLSLNISDFGMNIYLTQMIFGLVEMPARTITLFTLNRSRKISQLAFLAVGGSACLLTIFIPSRLF----IVKTILAMIGKFGITASLSIIYVYSAEVFPTVIRQNGIGIGSMCARTGGVLAPMMYLLRSISPHAPMVLSGLCPLVGSALT-LLLPETANKPLPDTIEDVE 508          
BLAST of slc22a-6 vs. TrEMBL
Match: A0A437C1E7 (MFS domain-containing protein OS=Oryzias javanicus OX=123683 GN=OJAV_G00233380 PE=4 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 9.031e-36
Identity = 108/405 (26.67%), Postives = 207/405 (51.11%), Query Frame = 1
Query:  544 TIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAE 1758
            T  +++ L CE  ++++  +S++M G+ +G++  G  +D +GR I   +S  + +VF T AA +P + ++   R   G ++S   ++   +  E   + QR   G      +  GY+LL  LA+ IRD  KLQLA     ++ +I+ +   +S RWL+A  + ++A +V++  A+ N K ++++ I+   ++++ ++   +  + S  ++ +   +    L++++++F     YY   L  S     I+   LI  L  + +R+I +F   R  +++ L  L +G +A  +   I   ++    I+ T+L MI       +   +++Y  E FPTVIR   + IGS CAR  G++A  M  +  I+P+   ++     + GS  T  LLPET  +P  D +   E
Sbjct:  110 TTVTEWDLVCENASMNNLGSSVYMFGLLVGALVFGNLADKYGRRIIILISLAIQAVFGTAAAFAPNFYVYTALRFMVGTSISGVIMNAFVLGTEWTGLKQRMLAGIITDYFFGFGYILLAGLAYLIRDWRKLQLAISAPGFLFIIYIWVLPKSARWLMANDRVEEALEVIVKAAQMNGKPISKD-IEMCQQVYKADQNTVLKKKHSFIDLVRTPTMRKQSLIVFYLWFVNVLVYYGLSLNISDFGMNIYLTQLIFGLVEMPARTITLFTLNRSRKISQLAFLAVGGSACLLTIFIPSRLF----IVKTILAMIGKFGITASLSIIYVYSAEVFPTVIRQNGIGIGSMCARTGGVLAPMMYLLRSISPHAPMVLSGLCPLVGSALT-LLLPETANKPLPDTIEDVE 508          
BLAST of slc22a-6 vs. TrEMBL
Match: B4LVT8 (MFS domain-containing protein OS=Drosophila virilis OX=7244 GN=Dvir\GJ24208 PE=4 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 2.291e-35
Identity = 133/532 (25.00%), Postives = 234/532 (43.98%), Query Frame = 1
Query:  235 SEKIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLPKNQTNQVFTEHRNQFKAINNETGFLIIDS-----------SRCRLTNISSICSEIFVKKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVT----ENQIDKYIEIFEEERLR--------SVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEK 1761
             E I QL G    +Q  I   I ++    A + L  +F+    D  C LP +       E   Q K    E  +   DS           S  R +N +  CS     +    ++  ++F L C    L++ + SMFMLG+ LGS+  G  SD +GR      S  +  +F  VA V+P Y  + L R+  G   S  F+    +A+E+V  ++R   G +  + + IGY+L    A+FI D   LQ+       + + + +   ES RWLL+  +   A +V+   A+FNR  +T    E  +D+     +E++L           +   S+ ++  Y  +    LV++F +  C+  YY     ++ +   +    +IS    + +    +    R GR +IL    L      + +II+        +   ++  +AI+ S   +G ++++  E FPTV+R   +   S  +R++GM+A  +  +  + P  LP++        + C   LLPET  RP+ + ++  E+
Sbjct:    4 DEVIVQL-GDFGRYQMIIYTLICLTSIPVAFHKLAGVFLLAKPDFRCALPTDLDESASYELPAQLK----ELAYPATDSCAYYELAYANGSYYRTSNETHSCSRYIYDQSRYQNSAVTEFDLVCGRGFLAATSDSMFMLGVLLGSIIFGQLSDKYGRKPIFFASLVIQVIFGVVAGVAPEYFTYTLARIVVGSTTSGVFLVAYVIAMEMVGPAKRLYAGIFVMMFFSIGYMLTAAFAYFIHDWRWLQIGLTLPGLLFMCYYWIIPESVRWLLSKGRKADAIQVIQKAARFNRVDITTEALEALLDEGASCQQEQKLDQDEDDDGCEETRPPSVWDLLHYPNLRRKTLVIFFDWLVCTGVYYGLSWSTNNLGGNVLLNFVISGAVEIPAYCFLLLTLNRWGRRSILCGCMLVAGVSLLLTIIVPQDMHWLTVTCAMVGKLAITGS---YGTIYLFSSEQFPTVVRTVGMGAASMVSRLTGMLAPYLNALATLWPP-LPLVIYGALSLAAGCLSLLLPETHNRPTLETIADGER 526          
BLAST of slc22a-6 vs. Ensembl Cavefish
Match: si:dkey-119m7.4 (solute carrier family 22 member 13-like [Source:NCBI gene;Acc:103028301])

HSP 1 Score: 150.214 bits (378), Expect = 1.927e-38
Identity = 128/511 (25.05%), Postives = 245/511 (47.95%), Query Frame = 1
Query:  238 EKIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLPKNQTNQV-FTEHRNQFKAINNETGFLIIDSSRCRLTNISSICSEIF-VKKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGR--IIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAE 1758
            +++   +GG   FQ  + ++I + Q   A ++L+ +F        C   K  T+   FT  ++  +A  +        ++    T+ ++ C + +   K    ST+ ++F L C+   L++  +S++M G+ +G+V  GV +D +GR  II  GL+  + ++F   AA +P + ++ L R   G  VS   ++   +  E      R   G      + +GY+LL  +A+ IRD  KLQLA     ++ + + +   +S RWL+A  K ++A  ++   A  N+K +  N ++  +   + E+     H  ++ ++ +   +    L+L++++F     YY   L  S     I+   LI  L  + +R+I +F   R  R++ L  L +G     +A ++  +I     ++ T+L M+       +   +++Y  E FPTV+R   + +GS CAR  G+IA  +  +  I+P+   ++     + G+L T  LLPET  +P  D +   E
Sbjct:    4 DEVLARIGGFGRFQKILYVWICLPQIFLAFHMLVSVFTGAVPPHLCRDTKTHTHNFNFTLSQSASEACGST------HTNSSLSTHTTTACRDGWEFSKDVFLSTVVTEFDLVCDSATLNNIGSSIYMFGLLVGAVVFGVLADRYGRRIIILVGLA--LQAMFGVGAAFAPNFFIYVLLRFVVGTTVSGIIMNAFVLGTEWTGPKHRMLAGIITDYFFGVGYILLAGVAYLIRDWRKLQLAISAPGFIFIFYIWVLPKSARWLMANGKQEEAMDLICKAALINKKPLKGNDMEFQLNNCKVEQKLQRKH--TVVDLVRTPQMRKQSLILFYLWFVNVLVYYGLSLNVSDFGMNIYLTQLIFGLVEMPARTITLFTLNRSRRISQLSFLAVG----GLACLLTIFIPQNLPVVRTILAMLGKFGITASLSIVYVYSAEVFPTVVRQNGIGMGSMCARAGGVIAPIIYLLRRISPHAPMVVFGLCPLVGALLT-ILLPETAHKPLPDTIEDVE 499          
BLAST of slc22a-6 vs. Ensembl Cavefish
Match: oatx (solute carrier family 22 member 6-like [Source:NCBI gene;Acc:103046614])

HSP 1 Score: 139.043 bits (349), Expect = 2.282e-34
Identity = 129/551 (23.41%), Postives = 244/551 (44.28%), Query Frame = 1
Query:  256 VGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLPKNQTNQVFTEHRNQFKAINNETGFLIIDSS---RC-RLTNI--------------------SSICSEIFV-KKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFN-RKSVTENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKNFVEWRQPWRKSSKKIIDTEIKV 1830
            VGG   FQ+  +  + I     A   L+  F       YC +P N T    T++ ++  +      F+ ++ S   RC R T                      +  C + +  ++    STI S++ L C+  +L   + +++M G+  G++  G  SD FGR      SYF +++  +  A+SP Y  +   R  TG +VS   ++ + + +E +    RT  G   S  +  G +LL  +A+ ++D   L +A C   ++  ++ ++Y ES RWL+   +  +A K + H+A+ N R  +T+    + ++    + + S     +  ++ +  V+    + +  ++FS SF+YY   +   K    I+   +I       ++ + + +    GR     S  L   A+  A+I   ++     ++ T L ++    + ++F  +++Y GE +PTVIR T +   S  ARV  M A  +  + E+ P    I+    A+   +   FLLPET   P  D +   E+   +W Q  R   K++    + +
Sbjct:   10 VGGFGRFQWIHVALLSIPSLLMASQNLLNNFTAGVPGHYCKIP-NITALAETQNLSEPSSAEILPAFIPLEGSKLSRCSRYTTAQWHLLHQNASHAESNTTDAETETCQDGWTYERTEFISTIVSEWDLVCKLRSLKQMSQTIYMGGVLAGAIIFGGLSDRFGRKALLIWSYFQLALLGSFTALSPSYLAYCTFRFLTGMSVSGVILNAASLKVEWIPTENRTLVGTISSFFFTFGQVLLAGVAYSLKDWRYLHVAVCSPFFIFFLYSWWYSESARWLVLNGRSDEALKQLHHVARINGRPEMTKKITLEVLQSHMRKEIESSKTVYTAYDLLRTPVMRKISMCIVAVWFSTSFAYYGLAMDLQKFGVNIYVMQIIFGAVDFPAKLVALGMLSFFGRRMTQASCLLASGAVIFANI---FVPKDMQMVRTTLAVLGKGFTSSSFTCVYLYTGELYPTVIRQTGMGFASMMARVGSMAAPAVLILDELFPAFPSIVYGGSAVVAGIIA-FLLPETLDVPLPDTVEDVEE---KWGQKGRSFQKQVASESVAL 552          
BLAST of slc22a-6 vs. Ensembl Cavefish
Match: slc22a6l (solute carrier family 22 member 6-like [Source:NCBI gene;Acc:103025663])

HSP 1 Score: 136.732 bits (343), Expect = 1.253e-33
Identity = 117/430 (27.21%), Postives = 209/430 (48.60%), Query Frame = 1
Query:  535 MTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFEEERLRSV-----SHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPII-GMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKNFVEWRQPWRKSSKK 1806
            M+STI +++ + CE  +L     +++M G+ +G++  G  SD FGR     +S+ M++V  T A+ +  + L  L R F G A+S   +++  + +E +    RT  G +    Y +G LLL  +A+ IRD   L LA     YVS ++ +++ ES RWL+ + + ++A K +  +A+FN +    ++I+  IE+ ++   + +     SH     ++ +   +    + L  ++FS SF+YY   L   K   +I+   +I     + S+ I      +LGR     S  +      + ++++ Y    +  + T L +I     G +F   +++ GE FPTV+R + +   S  ARV  M+A  +    +  P +  +I G T  + G    F  LPET   P  D +  A      W++P   SSKK
Sbjct:  125 MSSTIITEWDMVCESRSLKPMGQTIYMAGVFVGAMVFGGLSDRFGRRNLLLISHLMMAVGGTCASFATSFYLFCLFRFFCGMALSGLVLNSFSLVVEWIPTRIRTVVGTFTGYCYTLGQLLLAAVAYTIRDWRWLTLAVSVPFYVSFLYSWWFVESARWLVLSNRPEQAVKNLKAVARFNGRREEGDKIN--IEVLQQSMKKEMACSQKSHNA--LDLIRTPTMRTITICLSAVWFSTSFAYYGIALDLQKFGVDIYLIQVIFGAVDIPSKVIITLSMSKLGRRVSQCSALIMAGICILVNLLVPY---EQQTLRTSLAVIGKGCLGASFNCCYLFSGELFPTVVRQSGMGWVSMMARVGAMVAPMVLLTGDSLPWLPGVIYGGTPILCGMFAYF--LPETLSAPLPDTIQDAVDRGFRWKKP---SSKK 542          
BLAST of slc22a-6 vs. Ensembl Cavefish
Match: si:dkey-166k12.1 (organic cation transporter protein-like [Source:NCBI gene;Acc:103028750])

HSP 1 Score: 128.257 bits (321), Expect = 5.895e-31
Identity = 128/524 (24.43%), Postives = 233/524 (44.47%), Query Frame = 1
Query:  238 EKIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLPKNQTNQVFTEHRNQFKAI-------NNETGFLIIDSSRCRLTNIS-----SICSEIFVKKYPM-TSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKS-VTENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFL--CKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEK 1761
            E++    GG   FQ  + ++I + Q   A ++++ +F        C     ++ +  + H NQ  A+       N+  G     +  C   +       S C   +V    +  ST  +++ L C   +L+S  +S++MLG+ +G+V  G  +D +GR     LS  + +VF   AA +P + ++ + R   G  +S   ++   +  E     +R   G +    + +GY+LL  +A+ IRD  KLQLA     ++ + + +    S RWLL   + ++A  ++   A  N +S  T  Q+D + +  E     SV+  V   E+ K        L+L++I+F     YY   LG S +  +++    +  L  + +RS+ + +  C R   ++  L +  G   L +A      +      I T L M        +F  ++IY  E FPTV+R T + + S  AR+ G++A  +  + +  P V+P++               LPET  +P  D +  AE+
Sbjct:    4 EQLLAAAGGFGRFQKTLYVWICLPQVQLAFHMMVSVFTGATPPHRC-----RSARPGSPHLNQSHAVVLELRLANSSAGISAGHADACSAGSAENRSARSACESGWVYSQDVFESTTVTEWDLVCGRASLNSICSSIYMLGLLVGAVVFGAMADRYGRRFALLLSLALQTVFGVAAAFAPNFLVYVILRFLIGTTISGIIINAFVLGTEWTSTKRRMLAGIFTDYFFGLGYMLLAGIAYLIRDWRKLQLAISAPGFLFIFYIWVLPHSARWLLVNDRKEEAIVLLRKAAMVNGRSFPTTVQLD-WCDETEGRSQHSVADLVRTPEMRKRA------LILYYIWFVNVLVYYGLSLGVSGLGTDLYFTQFMFGLVEVPARSLVLLVLPCSRRIPLSAFLFIGGGACLLMLA------VPADNPNIQTALAMTGKFGITASFAIIYIYSAELFPTVLRQTGIGVSSMFARMGGVLAPMINLLGQHNP-VVPVLIFGSTPLLGAALALALPETANKPLPDTIQDAER 508          
BLAST of slc22a-6 vs. Ensembl Cavefish
Match: si:dkey-166k12.1 (organic cation transporter protein-like [Source:NCBI gene;Acc:103028750])

HSP 1 Score: 124.405 bits (311), Expect = 1.138e-29
Identity = 127/514 (24.71%), Postives = 230/514 (44.75%), Query Frame = 1
Query:  238 EKIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYC--VLPKNQTNQVFTEHRNQFKAINNETGFLIIDSSRCRLTNISSICSEIFVKKYPM-TSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKS-VTENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFL--CKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEK 1761
            E++    GG   FQ  + ++I + Q   A ++++ +F        C  +   N +  +   H +   A + E       S+R       S C   +V    +  ST  +++ L C   +L+S  +S++MLG+ +G+V  G  +D +GR     LS  + +VF   AA +P + ++ + R   G  +S   ++   +  E     +R   G +    + +GY+LL  +A+ IRD  KLQLA     ++ + + +    S RWLL   + ++A  ++   A  N +S  T  Q+D + +  E     SV+  V   E+ K        L+L++I+F     YY   LG S +  +++    +  L  + +RS+ + +  C R   ++  L +  G   L +A      +      I T L M        +F  ++IY  E FPTV+R T + + S  AR+ G++A  +  + +  P V+P++               LPET  +P  D +  AE+
Sbjct:    4 EQLLAAAGGFGRFQKTLYVWICLPQVQLAFHMMVSVFTGATPPHRCRSLRLANSSAGISAGHADACSAGSAEN-----RSAR-------SACESGWVYSQDVFESTTVTEWDLVCGRASLNSICSSIYMLGLLVGAVVFGAMADRYGRRFALLLSLALQTVFGVAAAFAPNFLVYVILRFLIGTTISGIIINAFVLGTEWTSTKRRMLAGIFTDYFFGLGYMLLAGIAYLIRDWRKLQLAISAPGFLFIFYIWVLPHSARWLLVNDRKEEAIVLLRKAAMVNGRSFPTTVQLD-WCDETEGRSQHSVADLVRTPEMRKRA------LILYYIWFVNVLVYYGLSLGVSGLGTDLYFTQFMFGLVEVPARSLVLLVLPCSRRIPLSAFLFIGGGACLLMLA------VPADNPNIQTALAMTGKFGITASFAIIYIYSAELFPTVLRQTGIGVSSMFARMGGVLAPMINLLGQHNP-VVPVLIFGSTPLLGAALALALPETANKPLPDTIQDAER 491          
BLAST of slc22a-6 vs. Ensembl Sea Lamprey
Match: oct2 (organic cation transporter 2 [Source:ZFIN;Acc:ZDB-GENE-080204-92])

HSP 1 Score: 94.7449 bits (234), Expect = 1.095e-20
Identity = 97/408 (23.77%), Postives = 186/408 (45.59%), Query Frame = 1
Query:  544 TIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALF-IASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLP-IIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEK 1761
            T+ S+F L CE   L   + ++  +G+ +G++  G  SD +GR     +S  M ++F  + A +P Y      R   G     S+ +    A E V   QR        + +  G ++L  +A+++R    LQLA    + V   + +   ES RWL++  + ++A  V+  IA  N + +++N I K  E  E  R    +   SI ++ +   +    +VL   +F     Y    + +  I D+++ A L+  L  +    + + L  R+GR  + + +  G++ L  +A+ ++ +  G  NI    L  + ++++   +  + +   E +PT +R  ++S  S+ + + G++A  + +        LP +I  T+A+ G      LLPET   P  +    AE 
Sbjct:  141 TLVSEFDLVCENAWLLDLSQALLNVGLLVGAILMGYVSDRYGRRWSLMVSIVMQTIFGVLVAFAPNYAAFVCMRTLQGIFNMGSWTTVFVTATEFVGSGQRRVVHMVLQMFFSFGVIMLSGIAYYLRTWRYLQLALTLPNVVLFSYYWLLPESPRWLISQNRKEQAFGVLKKIASVNGRELSDN-IRKNFE--EVTRADEKAGNPSIADLMRSAKIRKYTVVLMIYWFVVGVVYQGLAMSTGNIGDDVYLAFLMGGLAEIPGALMVIALIDRVGR-RLPMCVAPGLSGLACLATALVPHDIGWLNITLVTLGRLGLTMA---YEMVTLVNNELYPTHLRNMAMSTCSSLSGIGGIVAPFVLYRLYTIWRHLPMVIFGTLAIIGGF-VILLLPETNGLPLPETTEDAEN 540          
BLAST of slc22a-6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007122.1 (pep scaffold:Pmarinus_7.0:GL476962:153150:164773:-1 gene:ENSPMAG00000006444.1 transcript:ENSPMAT00000007122.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.2629 bits (199), Expect = 1.935e-17
Identity = 62/241 (25.73%), Postives = 112/241 (46.47%), Query Frame = 1
Query:  238 EKIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLPKNQTNQVFTEHRNQFKAINNETGFLIIDSSRC--RLTNIS-SICSEIF-VKKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLA 948
            + + + +GG   FQ  +  +I +   + A+++L+ +F       +C  P      V +       A          +  RC  RL       C+  +   +   TST+ +++ L C    L++  +S+FMLG+ +G+   G  +D +GR     +S  + + F   AA +P + ++AL R   G A+S   ++   +A E   I +R   G      + +GY+LL  +A+FIRD  +LQLA
Sbjct:    4 DDVLKKIGGFGKFQMILYTWICLPHISIAMHMLVSVFAGATPAHFCRDPPGGHAPVPSATTAPPTA-GESAAANGTERPRCGSRLNESGWQPCATGWDYDRSVFTSTVVTEWDLVCTRSYLNNVGSSIFMLGLMVGAPVLGTMADKYGRKSVILVSMAIQTAFGLGAAFAPNFVMYALARFMVGVAISGVIMNAFVLATEWTGIGERMLAGIATQQAFGVGYMLLAPVAYFIRDWRQLQLA 243          
BLAST of slc22a-6 vs. Ensembl Sea Lamprey
Match: SLC22A7 (solute carrier family 22 member 7 [Source:HGNC Symbol;Acc:HGNC:10971])

HSP 1 Score: 82.4185 bits (202), Expect = 2.219e-17
Identity = 71/279 (25.45%), Postives = 121/279 (43.37%), Query Frame = 1
Query:  238 EKIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLPKNQTNQVFTEHRNQFKAINNETGFLIIDS---SRCRL-----TNISS----------ICSEIFV-KKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLL 1017
            E+     GG S FQ ++ + + + +     ++++  FI+      C LP + T           +    +  +   D    S C L     TN S            C   +   +   T T+ +Q+ L CE+ AL+  + ++FM G+ LGS+  G  SD +GR      SY + +V  T AA +P ++     R   G ++S   V+   +++E ++   RT  G      +  G + L LLA+ +R   +LQL      Y  ++  +F  ES RWLL
Sbjct:    4 EEALSAAGGFSRFQLWLTVLLLVPRLVLPWHLMVNNFISATPHHRCRLPDSPTAAPLDNGSGPAETWGGQPPWRDDDEEGLSACSLREAAGTNASESPLRNSSEAVPCPSGWEYDRRQFTETVVTQWDLVCEHKALNHLSLTLFMAGVMLGSLVFGYLSDRYGRRNALLGSYVLNAVTGTAAAWAPSFSSFTAMRFLLGVSLSGIIVNTLSLSVEWLDQGHRTFAGTSGGFAWSTGNMALGLLAYLLRGWQQLQLVVTSPIYFCILTWWFIPESPRWLL 282          
BLAST of slc22a-6 vs. Ensembl Sea Lamprey
Match: slc22a6l (solute carrier family 22 member 6, like [Source:NCBI gene;Acc:404609])

HSP 1 Score: 67.781 bits (164), Expect = 1.574e-12
Identity = 76/317 (23.97%), Postives = 132/317 (41.64%), Query Frame = 1
Query:  820 LEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFEEERLRSVSHRV-----SIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNV-LPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQ 1752
            +E + +  RT +G    + Y  G L+LV LA++IRD   LQ +     YV  +  +   ES RWL+    Y++A   +  +A  N +     Q+   ++   +E       R      ++  +   +   + + ++W     C ++ +  ++ +   +       +  A+         + L     R T   SL +      IAS  L  I        T L ++       +F   ++Y GE FPTVIR + + + S  ARV GM+A  +    E  P + L + G    + GSL  F  LPET  RP  + + +
Sbjct:    1 VEWIAMKDRTLYGMLSGVAYTTGQLVLVALAYYIRDWRHLQHSISAAFYVFFLCSWCTPESARWLVMRGHYERALHGLKRVAVINGRKREAAQLTSPLQYLRKELEEDTGPRRFYTMFNLLTIPALRRRTLVMSLVWCDDVFCWYAGFVVIV-TRTCAHTFLLQVIYGAIDYPAKVVGLVVLSLLGRRATQAGSLAVAS----IASFCLLAIPAESGTARTCLAVLGKGALSCSFNCAYLYTGEIFPTVIRQSGLGLCSTMARVGGMLAPLVIMAGESLPALPLSMYGSASLVAGSLVYF--LPETLNRPLPETIEE 310          
BLAST of slc22a-6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002617.1 (pep scaffold:Pmarinus_7.0:GL485729:386:8898:-1 gene:ENSPMAG00000002389.1 transcript:ENSPMAT00000002617.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 6.887e-10
Identity = 48/181 (26.52%), Postives = 82/181 (45.30%), Query Frame = 1
Query: 1225 FSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFL-----CKRLGRVTILLSLQLGVTALFIASII-LKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIAS------QMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRP 1731
            F CS  YY   LG   +S ++     +S L  L S  + +FL     C R   ++  LS   G+  + +A+++ L   + G  +    L +         F  ++IY  E +PT IR  ++ + S  +R+ G++A       +  WV    P +  ++G+     G LC   LLPET ++P
Sbjct:    1 FVCSLVYYGLTLGVGDLSRDVHMGLALSGLAELPSYPLSLFLINASWCGRRRGLSGFLSCG-GIACIAVAALVTLSGEHEGCAVARQYLALAGKLCISAAFSIVYIYTSELYPTSIRNVALGLSSTSSRLGGILAPFIPSLREQSWVMPSLPFM--VLGLAGVSAGCLC--LLLPETLRQP 176          
BLAST of slc22a-6 vs. Ensembl Nematostella
Match: EDO35192 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM88])

HSP 1 Score: 107.457 bits (267), Expect = 5.987e-25
Identity = 106/434 (24.42%), Postives = 205/434 (47.24%), Query Frame = 1
Query:  556 QFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYI-EIFEE-ERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNV---LPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKNFVEWRQP-------WRKSSKKIIDTE 1821
            Q+ L C+   L + + +MF++G+ +GS+  G+ SD FGR +   +S F++ V S  ++ +   +L AL R   GF+V+   ++     LE+V  ++RT  G      + IG     LL + IRD   L L     + V   F   + E+ RWL+A      A+ ++   A  + ++V    +   + +I+EE +R    + R +  ++ K   +    +++ F +F  S  Y+ F+L  + +S +++   L+ ++  + +  I  FL +++GR     S+ L  T   I  ++L       +++T + +M     +   F  +++Y  E +PTVIR T++   S  AR+ G+IA  +  + ++ P+V   LPI+   +    +      LPET +      + + E    ++  P       WR     + + E
Sbjct:    2 QWDLICDRAHLGATSQAMFLVGMLVGSLLSGIMSDAFGRRLCMLISCFIMIVCSAASSFADCLSLFALLRFGVGFSVTGLMLTQYVYVLELVGPTKRTAAGKVTDFFWVIGACATCLLGYLIRDWRILLLVRSLPAVVFFFFWKVFPETARWLVAKGNLVDAQVILEKCA--DGRAVDSRSLQTLLQDIYEEQQRQEKTTRRYTPLDMIKTPKLRRRTIIVCFNWFVVSIIYFGFVLYITSLSGDVYINFLLMSIIDVFNTPISWFLLQKIGRRLTHCSIML--TGGLICVLVLVVPKEYTSVVTGIAIMGKFCDTAA-FSTIYLYTSELYPTVIRNTAMGTASMFARIGGIIAPYIVMLAQL-PSVSITLPIVIFGVCSLAAGVMSLWLPETLRTTMQQTIEETEMTPEDYGIPCCGCLGAWRTEDVIVNNDE 429          
BLAST of slc22a-6 vs. Ensembl Nematostella
Match: EDO36696 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHW2])

HSP 1 Score: 105.531 bits (262), Expect = 5.743e-24
Identity = 131/536 (24.44%), Postives = 241/536 (44.96%), Query Frame = 1
Query:  238 EKIYQLVGGNSYFQYFIL---MFIFIS-QFNTAINILM---PIFINNYQDVYCVLPKNQTNQVFTEHRNQFKAINNETGFLIIDSSRCRLTNISSICSEIFVKKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGR--------IIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIF-PFFYK---ESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSG-----TNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKNFVE 1773
            +++ + +G    FQ  IL   MFIF    + T I + +   P ++ +     C+L  +   ++++      +  +           RC+L       ++  + + P+  TI ++F L C++   +  A SM   G  +G++F G+ +D +GR        I+  GLS  M  V         W  L  + R F GF     F+S   +A E+V  ++R   G    + +    ++L L AFFIRD   L    C IS    +F   F+K   ES RWLL T    KA++++ ++A+ N+KS+ E       E+F  +    V H   I E+F  K + V  L+  + +F     YY   + +      I+   ++++L    +  + +  C R GR   +++  L + A  IA I + +I  G N +  ++  +   + G     T+F  ++++  E FPT++R + + + S  +RV   +A  +  +  I   +LP   M    F +    + LPET  +P+ + +   + + +E
Sbjct:    6 DQVLERIGQFGPFQKRILAMFMFIFFPLTYQTLIMVFVAYEPPWMCSTNSSACLLSNSTGREIYSTSTQPIELYHR----------RCKLNRTDWKFADPELYEGPV-HTIVTEFDLVCDHSFTAWMANSMLFFGWAIGAIFLGIIADKYGRCSVLFPSAILVMGLSLAMAFVKKA------WLVL--VLRFFIGFFEGGGFLSMFVLATELVGPAKRALAGTLVWIYFTAALMVLALKAFFIRDWSTL----CIISIAPFVFIVLFWKFVPESVRWLLVTGSKGKARRILENVARVNKKSMPEE------ELFAPQ----VEHNRGIIELFSTKRLAVLTLLQCYAWFVNGMVYYGVSMSAGDFGGSIYLNFVLTSLVEFPANVLLIHNCNRFGRKRTVVAYTL-IGA--IACITVSFIPAGTNNLGFIIGRVTGGMLGKLCITTSFNGLYVFSAELFPTMVRNSGMGLLSVISRVGAALAPFVVQLTRIN-AILPFALMGGLTFLAALACWFLPETRGKPTLEVIGDDDPHILE 504          
BLAST of slc22a-6 vs. Ensembl Nematostella
Match: EDO39860 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8P8])

HSP 1 Score: 103.99 bits (258), Expect = 1.467e-23
Identity = 120/513 (23.39%), Postives = 216/513 (42.11%), Query Frame = 1
Query:  238 EKIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLPKNQTNQVFTEHRNQFKAINNETGFLIIDSSRCRLTNISSICSEIFVKKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFEEERLRSVSHR----VSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVT--ILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAE 1758
            + + +LVGG   +  F+  F  I      +  L+ +F       Y V P           RN                  C ++   + C+E       +TS + S+++L C    L +   +++M G+ +GSV     SD FGR +   LS F+++    V+ VS   ++ AL R   G A +   ++     +E+V    RT  GF  ++   +G+  + L  +FI +     +A        LIF +F  ES RWL+A  K  +A  ++   A+ NR +V    +   I   ++  +RS  +R    + +    K +       V W +    +  ++   L    +  +I+    I  +  + +  I  F  +R GR     +  L  GV  L + ++      G +++I  + ++  I +  T F  ++I+  E +PTVIR T + + S  AR  G++A  +  V  +  N   +I   +A+   +   + LPET     S  + QAE
Sbjct:   11 DDLLRLVGGFGRYPAFLYAFTCIMSVPVGLQQLIQVF-------YAVTPPFDCKGSLPVARN----------------GSCGVSECCANCTEYGFDTSELTSAV-SEWQLVCSRSHLKAMTQAVYMAGLLVGSVTFSSISDHFGRRLSMFLSIFLMAACGIVSGVSDCLSMFALFRFGAGAACAGCLLARYVYCVELVVRKHRTAAGFISNMFVSVGFSSVTLFVYFIHEWRYQLVAVSATGLPLLIFWWFIPESPRWLIAENKLDEAHALLTKFAEKNRVTVDSKHLMHMIREVKKADIRSDDNRKYGMLDLLRTPKLRKRTFICGVNWSVN---ALVFFGLNLNVKNLGGDIYLNFFILCIIEIPAALICWFALQRFGRRIPYCVFMLTGGVAGLLVLAV--PTAKGYQSVIVGLAMIGKICIVMT-FLAIYIFTVELYPTVIRNTGIGVSSMLARFGGILAPYIADVPNVNKNFPLVIFGVLAVAAGILALW-LPETLFSQMSQTVEQAE 492          
BLAST of slc22a-6 vs. Ensembl Nematostella
Match: EDO36723 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHW3])

HSP 1 Score: 102.834 bits (255), Expect = 4.039e-23
Identity = 123/535 (22.99%), Postives = 239/535 (44.67%), Query Frame = 1
Query:  238 EKIYQLVGGNSYFQYFIL-MFIFISQFNTAINILM------PIFINNYQDVYCVLPKNQTNQVFTEHRNQFKAINNETGFLIIDSSRCRLTNISSICSEIFVKKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGR--IIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQR----TNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPF----FYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRV-TILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSG-----TNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKNFVE 1773
            +++ + +G    FQ  IL MF+FI    T   +LM      P ++       C+L  +   ++++      +  +           RC+L       ++  + + P+  TI +QF L C+    +  A SM   G  LG++  G+ +D +GR  ++    +  +   FS   A + W  +    R F+GF +  S ++   +A E+V  ++R    T   FY++L      ++L L A+FI+D +KL    C IS V  +F F    F  ES RWLL   +  +A++++  +AK N+K + +          E+ R+  V H     E+F    + +  L+  + +      YY   + +      I+   +++++    +  + +  C R GR  T++    +G     I+ +++ +I  G + I  +   +A    G     T+F  ++++  E FPT+IR + + + S  +RV   +A  +  +  I   +LP   M+   F +    + LPET  +P+ + +   +   +E
Sbjct:    6 DQVLEQIGQFGPFQIRILAMFLFIFIPLTYQTLLMVFVAYEPPWMCTTNSSACLLSNSTGREIYSTSTQPIELYHR----------RCKLNRTDWKFADPELYEGPV-HTIVTQFDLVCDNSFHAWLANSMLFFGWALGAIILGMIADKYGRRSVLFPSAACVIAITFSMSFAQASWVVIAL--RFFSGFFLGGSILTMFVLAAELVGPAKRALSSTMVWFYFTL----ALMVLGLQAYFIKD-WKL---LCIISTVPFVFIFIFWKFIPESVRWLLVVGRKDQAREILEQVAKVNKKEMPK----------EDLRVPVVKHNRGFLELFGTPRLALLTLLQCYAWLVNGLVYYAVSMSAGDFGGSIYLNFVLTSIVEFPANILVIDNCNRFGRKHTVVWYTVVGA----ISCLVVSFIPSGTDNIGYIAGRVAAGTLGKLCITTSFNSLYVFSAELFPTMIRNSGMGLLSVISRVGAALAPFVVQLTRIN-AILPFALMSGLTFLAALACWFLPETRGKPTLEVMGDDDPQHLE 504          
BLAST of slc22a-6 vs. Ensembl Nematostella
Match: EDO46087 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR13])

HSP 1 Score: 99.3673 bits (246), Expect = 4.683e-22
Identity = 114/508 (22.44%), Postives = 217/508 (42.72%), Query Frame = 1
Query:  238 EKIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLPKNQTNQVFTEHRNQFKAINNETGFLIIDSSRCRLTNISSICSE-IFVKKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLS-LQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFE-IAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQ 1752
            + + ++VG     Q  + + + +S    AI +L+ +F+       C+   + TN+   +++ Q                          C+E  +  KY   ++I +++ L CE    +    S+ M G  LG++  G  +D +GR      +   + VF   ++ +P + ++A  R  TGF +    +S   +A E+V  S R   G      + +G L+L ++A+ I+D   L +     + V ++F  +  ES RWL+   +  +A+ +++ IA  N  +V ++ +      F       V  R    ++F  + ++    VL FI+F  +  YY   L +  ++ +I+    + +L    +    +F     GR   L + + L   A      +          + TV  MI       +F  ++IY  E FPTV+R   + + S  +R+ G+ A  + ++   + P  + I GM   M G L    +LPET KRP  + +  
Sbjct:    4 DHVLKIVGEFGPHQRRLYVLLCLSIVPAAIQLLLLVFVAAQPHWICL--NSSTNETCPKNKLQ--------------------------CTERQYTSKY---TSIITEWDLVCENAYKADLVQSLLMSGTLLGALMFGALADKYGRRRVWHTTLTGLVVFGFASSFAPTFKIYATLRFLTGFCIGGEILSAFVLATELVGPSYRGFAGIMAQCFFTLGLLILPMVAYLIQDWRTLSVVLSLPASVFILFFRYVPESARWLMIRGRVSEAENILLDIALKNGIAVPKSLLQVNHPFF-------VGSRYGFFDLFCTRKIVKQTFVLIFIWFVNTLVYYGLSLNTKHLAGDIYMNFFLCSLMEFPAYLTCLFFVNWAGRRKTLFNYMVLAGLACMACMFVQPESSPADRTLATVFAMIGKFGITASFALIYIYSAEIFPTVVRNVGLGVCSMSSRIGGICAPFVVFLGTYMRPLPMVIFGMCAFMAGLLS--LMLPETHKRPLPETMDD 471          
BLAST of slc22a-6 vs. Ensembl Medaka
Match: ENSORLT00000022564.2 (solute carrier family 22 member 6 [Source:NCBI gene;Acc:101166767])

HSP 1 Score: 147.902 bits (372), Expect = 1.722e-37
Identity = 127/519 (24.47%), Postives = 244/519 (47.01%), Query Frame = 1
Query:  238 EKIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYC---------VLPKNQTNQVFTEHRNQFKAINNETGFLIIDSSRCRLTNISSICS---EIFVKKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAE 1758
            + I + +GG   FQ  + ++I + Q   A ++L+ +F        C          +P N ++         F   N  +     D  +     +S  C    E   + +   ST  +++ L CE  ++++  +S++M G+ +G++  G  +D +GR I   +S  + +VF T AA +P + ++   R   G ++S   ++   +  E   + QR   G      +  GY+LL  LA+ IRD  KLQLA     ++ +I+ +   +S RWL+A  + ++A +V+   A+ N K ++++ I+   ++++ ++   +  + S  ++ +   +  N L++++++F     YY   L  S     I+   +I  L  + +R+I +F   R  +++ L  L +G +A  +   I   ++    I+ TVL MI       +   +++Y  E FPTVIR   + IGS CAR  G++A  M  +  I+P+  P++   +          LLPET  +P  D +   E
Sbjct:    4 DDILRTIGGFGRFQKLLYVWICVPQIFLAFHMLVSVFTGAVPPHLCRSSWSSEGPPVPANFSSLSGRPELACFGPGNRSSPGGPADDGQ-----LSGTCQGGWEYSTETF--QSTTVTEWDLVCENASMNNLGSSVYMFGLLVGALVFGNLADKYGRRIIILISLAIQAVFGTAAAFAPNFYVYTALRFMVGTSISGVIMNAFVLGTEWTGLKQRMLAGIITDYFFGFGYILLAGLAYLIRDWRKLQLAISAPGFLFIIYIWVLPKSARWLMANNRVEEALEVIEKAAQMNGKPISKD-IEMCQQVYKADQNSVLKKKHSFIDLVRTPTMRKNSLIVFYLWFVNVLVYYGLSLNISDFGMNIYLTQMIFGLVEMPARTITLFTLNRSRKISQLAFLAVGGSACLLTIFIPSRLF----IVKTVLAMIGKFGITASLSIIYVYSAEVFPTVIRQNGIGIGSMCARTGGVLAPMMYLLRNISPHA-PMVLSGLCPLLGAGLTLLLPETANKPLPDTIEDVE 509          
BLAST of slc22a-6 vs. Ensembl Medaka
Match: slc22a6l (solute carrier family 22 member 6 [Source:NCBI gene;Acc:101168641])

HSP 1 Score: 122.479 bits (306), Expect = 4.807e-29
Identity = 114/435 (26.21%), Postives = 201/435 (46.21%), Query Frame = 1
Query:  535 MTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQID-KYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALI----SALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIA-------SQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKNFVEWRQPWRKSSK 1803
            MTS+I S + L C+  +L     +++M G+ +G++  G  SD +GR I   +S  +++V  T AA SP + L  L R   G A+S   ++   + +E +    RT  G      Y +G LLL  +A+FIRD   L LA     YV  +  +++ ES RWL    K+++A K +  +A+FN +     ++D K ++   ++ + S     S+ ++F+   +    + L  ++ S SF+YY   +   K   +I+   +I         +V  +   F+ +R  +   L+    GVT L   ++++ Y    K  + T L ++       +F   ++Y GE +PT+IR   +   S  AR+  M+A         ++W+        PI+    A+F        LPET      D +   E+  ++      KSSK
Sbjct:  100 MTSSIISDWDLVCDLRSLKQMGQTIYMGGVLVGAIIFGGLSDRYGRRILLLISNMLMAVAGTCAAFSPSFPLFCLFRFGCGMALSGLGLNTFSLIVEWIPTRIRTVTGTITGYCYTLGQLLLAGIAYFIRDWRWLTLAVSLPFYVFFLISWWFHESSRWLALNNKHEEAVKTLKSVARFNGRHEEGEKLDIKMLQESMKKEMSSSKGSYSVLDLFRTPKMRKMTICLSAVWLSTSFAYYGLAMDLQKFGVDIYLIQVIFGAVDIPAKVVITTCMSFIGRRPSQCGALII--AGVTILI--NVVVPY---DKQTLRTCLAVVGKGCLAASFNCCYLYSGELYPTIIRQNGMGWVSMMARIGAMVAPMVLLTGDHIQWLPGFIYGGAPILSGVAAVF--------LPETLGTNLPDTIQDVEERELQ------KSSK 513          
BLAST of slc22a-6 vs. Ensembl Medaka
Match: si:dkey-166k12.1 (solute carrier family 22 member 13 [Source:NCBI gene;Acc:101165571])

HSP 1 Score: 122.479 bits (306), Expect = 5.415e-29
Identity = 121/514 (23.54%), Postives = 229/514 (44.55%), Query Frame = 1
Query:  238 EKIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFI-----NNYQDVYCVLPKNQTNQVFTEHRNQFKAINNETGFLIIDSSRCRLTNISSICSEIFVKKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTEN-QIDKYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEK 1761
            ++I   +GG   +Q  + ++I + Q   A ++++ IF      +  +D +     NQT  +     + F A     G     + R          SE+F       S+  +++ L C    L+S  +S++M G+ +GSV  G  +D +GR     LS  + +VF    A +P + ++ L R   G  +S   ++   +  E     +R   G      + +GY+LL  +A+ IRD  KLQLA     ++ + +     +S RWLLA  + ++A  ++   A  N + +    Q++K+  +   +R  S    V   ++ K        ++L++I+F     YY   LG S++   ++    +  L  + +RS+ +       R+++   L +G  A     ++L       N++T + ++    ++ + F  +++Y  E FPTV+R T + + S  AR+ G++A  +  +   +P   P+I    +          LPET  RP  D L  AE 
Sbjct:    4 DQILAAIGGFGKYQKILYIWICLPQILLAFHMMVSIFTGATPPHQCRDSFSTGAGNQTLNLSLPDASCFSADALPPGN---RTERVPCGRGWVYSSEVF------ESSTVTEWDLVCNRAGLNSLGSSVYMSGLLVGSVVFGAMADRYGRRFVLLLSIALQTVFGVAVAFAPNFPVYVLLRFAVGTTISGVIINAFVLGTEWTCTKRRMLAGIITDYTFGLGYMLLAGVAYLIRDWRKLQLAISAPGFLLIFYIRVLPQSARWLLANDRTEEAIALLRKAALVNGRVLPPAVQVEKWEILGGSKRSHSAVDLVRTPQMRKRT------VILFYIWFVNVLVYYGLSLGVSRLGTNLYMTQFVFGLIEIPARSLVLIFLPFSRRLSLSGFLAVGGLACL---LMLTVPEDHPNVLTGLAMVGKFGITAS-FAIIYVYTAEIFPTVVRQTGIGVSSMFARMGGVLAPIINMLDSHSPAT-PLIIFGTSPLLGALLALALPETADRPLPDTLEDAEN 497          
BLAST of slc22a-6 vs. Ensembl Medaka
Match: oatx (solute carrier family 22 member 6 [Source:NCBI gene;Acc:101155455])

HSP 1 Score: 122.479 bits (306), Expect = 7.540e-29
Identity = 127/541 (23.48%), Postives = 237/541 (43.81%), Query Frame = 1
Query:  241 KIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYCVLPKNQT--NQVFTEHRNQFKAINNETGFLIIDSSRCRL-------------------TNISSICSEIFVKKYPMT-----STIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFEEERLRSV-SHRVSIK--EVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIIL---KYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKNF 1767
             + + VGG   +Q+  +  I +     A   L+  F++     +C LP NQ+  N       ++ + +     F+  D S  RL                    NIS + +E  V  +        ST  S++ L C    L     S++M G+  G++  G  SD FGR +    SY  I V    + +S  ++++ + R   G AVS   ++   + +E +    RT  G   S  +  G ++L  LA++++D   LQL+     ++   + ++Y ES RWL+  ++ + A K +  +A+ N K    N++   +E+      + + S R S    ++ + + +    + L  ++FS SF+YY   +   K    I+   +I     + ++ + + +   LGR          V+ LF++++I+    ++      + T L  +  + +  +F  +++Y GE +PTVIR T +   S  ARV  M A  +  + E+ P +  I+    A+  S    F LPET   P  D +   E+ +
Sbjct:    5 DLLEEVGGFGRYQWLHVTLISLPGLMMASQNLLNNFVSGIPAHHCSLPANQSLLNLSLYTQVDEKQLLR---AFIPPDPSGNRLDRCTRFVKPQWHLLTTNSSANISELQTEGCVDGWTFDQSEFISTTVSEWGLVCSLRPLKQMIQSIYMGGVLTGAIIYGSLSDRFGRRLVLIWSYLQIGVLGCSSVLSSSFSVYCIFRFLNGMAVSGVILNGFSLKVEWIPTKTRTVVGTLTSFFFTFGQMILAGLAYWLKDWRMLQLSVSAPHFLFFAYSWWYSESARWLVVNRRSEDALKSLHRVARINGKPEVINKLT--VEVLHSHMRKEIESSRSSFSAIDLMRTRGMRRISICLVAVWFSTSFAYYGLAMDLQKFGVSIYLMQVIFGAVDIPAKLLALGMLSYLGRRVS------QVSCLFLSAVIIFANIFVPTDMQTLRTTLACLGKAFTSASFTTVYLYTGELYPTVIRQTGMGFVSTMARVGSMAAPAVLILDEVWPALPSIVYGGAAVLASGFACF-LPETLNIPLPDTVEDVEEKW 533          
BLAST of slc22a-6 vs. Ensembl Medaka
Match: slc22a2 (solute carrier family 22 member 2 [Source:NCBI gene;Acc:101173762])

HSP 1 Score: 108.227 bits (269), Expect = 2.581e-24
Identity = 106/421 (25.18%), Postives = 191/421 (45.37%), Query Frame = 1
Query:  496 SSICSEIFVKKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAE 1758
            ++ C E +   Y    +  ++F L C +  ++    +   +G  +GS+  G  +D FGR +   +S  + +V   + AVSP YT   + R  +GF V   +++   +  EIV +  R   G  + + + +G L+L LLAFFI D   LQLA      + L + +F  ES RWLL+  K  +  K+   IAK NR+ +++N     IE   ++   + S+  S  ++ +   +  + L+L + +F+ +  Y   ++    +   ++   LIS L    +  + +F  +R+GR     S  +   A   + +I  ++     ++ TV+  I        F  +     E +PT +R   VS+ S    V G++A  + +   +    LP+I      F +     LLPET   P  D +   E
Sbjct:  114 TTACKEGWEYDYEGRQSFVTEFDLVCSHGWMADMFQATLNVGFLVGSIAIGYLADRFGRKMSFLMSTLVNAVAGILVAVSPNYTSLLVFRSLSGFGVKGGWMAGYVLITEIVGVEFRRTVGVLYQMFFSVGLLILPLLAFFITDWRWLQLAITAPYILFLSYYWFIPESPRWLLSQNKKSQVVKITESIAKENRRVLSKN-----IETLTDD--DADSNSASFMDLIRTPNMRKHTLILSYNWFTSAVVYQGLIMRLGILGGNVYVDFLISGLVEFPAAFLILFTIERIGRRLPFASANMVAGA---SCLITAFLPDDLFLLKTVVACIGRLGITMAFEMVVFVNTELYPTFVRNLGVSVCSTLCDVGGIVAPFLLYRLAVIWLELPLIIFGFLAFLAGGLVLLLPETRGVPLPDSIQDVE 524          
BLAST of slc22a-6 vs. Planmine SMEST
Match: SMESG000020910.1 (SMESG000020910.1)

HSP 1 Score: 998.038 bits (2579), Expect = 0.000e+0
Identity = 509/513 (99.22%), Postives = 512/513 (99.81%), Query Frame = 1
Query:  292 MFIFISQFNTAINILMPIFINNYQDVYCVLPKNQTNQVFTEHRNQFKAINNETGFLIIDSSRCRLTNISSICSEIFVKKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKNFVEWRQPWRKSSKKIIDTEIKV 1830
            MFIFISQFNTAINILMPIFINNYQDVYCVLPKNQTNQVFTEHRNQFKAI+NETGFLIIDSSRCRLTNISSICSEIFVKKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATKKYKKAKKVMMHIAKFNRKSVTENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKVVLVNLLVLWFIFFSCSFSYYTFLLGSSKISDEIFTAALISA+GSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKNF+EWRQPWRK SKKIIDTEIKV
Sbjct:    1 MFIFISQFNTAINILMPIFINNYQDVYCVLPKNQTNQVFTEHRNQFKAIDNETGFLIIDSSRCRLTNISSICSEIFVKKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATKKYKKAKKVMMHIAKFNRKSVTENQIDKYIEIFEEERLRSVSHRVSIKEVFKYKVVLVNLLVLWFIFFSCSFSYYTFLLGSSKISDEIFTAALISAVGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEKNFIEWRQPWRKGSKKIIDTEIKV 513          
BLAST of slc22a-6 vs. Planmine SMEST
Match: SMESG000040243.1 (SMESG000040243.1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.592e-21
Identity = 109/468 (23.29%), Postives = 214/468 (45.73%), Query Frame = 1
Query:  457 LIIDSSRCRLTNIS--SICSEIFV-KKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALG----RLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFEEERLRSVSHRV-SIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILL-SLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQ---MEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRP-SSDFLSQAEKNFVEWRQPWRKSSKKIIDTE 1821
            LI + SR    N++  S CS  F+       ST  +++ L C+   + S   ++F  G   G+V  G  SD  GR+     ++ ++ VF+ +A +  +++++ +      L  GF+     ++   +  E+V  S+R   G    L Y   ++L+ L  + +++   L L     S   L + F   ES RWLL+  + K+A  ++  + K N   ++EN   + ++  E E  ++ + +  S+ ++ K K +L+  L +WF +   +  YY  +     ++  ++   ++  L  + +  + +    R+GR  +L+ SL     A  ++  + KY      +I   + MI       ++G ++ Y  E FPT +R  ++ + S  AR+ G +A+    ++  F   P +  I  +  A+ G L   F +PET  +P   +F   + KN    R+      K +I+ E
Sbjct:   65 LIANRSRLDFQNVTLDSKCSNGFIYSTQSYGSTAPNEYDLVCDSDYIRSNLKTIFFAGRIFGAVIFGQLSDIIGRL----RTFLIVVVFNLIAGLGLYFSINPIMIGGFLLLQGFSQVGYTLTTFVLGCELVGTSKRKWTGTVLQLFYTAAFILIPLCYWGMQNWRYLALFSGLPSIFFLSYFFIVYESPRWLLSKGRSKEALIIIEKVGKTNHIKLSENLKTEILKHHESEEYKNDTEKKHSVFDLIKSKSMLLLSLNVWFNWIVNALIYYGIIYNVENLAGSLYLNFILLGLVEIPAYVLNLLFLDRIGRRNLLIISLWGTGVACLLSGCVPKY----NTVIIATIAMIGKLTVTMSYGVVYFYTSELFPTTVRNAAMGVSSMSARIGGTMATPILLLDHYFSPLPMI--IFAVLSAVAGGLT--FKMPETKGKPLDQNFHKSSVKN---ERKTAEDDPKPLINDE 517          
BLAST of slc22a-6 vs. Planmine SMEST
Match: SMESG000040243.1 (SMESG000040243.1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.802e-21
Identity = 109/468 (23.29%), Postives = 214/468 (45.73%), Query Frame = 1
Query:  457 LIIDSSRCRLTNIS--SICSEIFV-KKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALG----RLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFEEERLRSVSHRV-SIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILL-SLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQ---MEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRP-SSDFLSQAEKNFVEWRQPWRKSSKKIIDTE 1821
            LI + SR    N++  S CS  F+       ST  +++ L C+   + S   ++F  G   G+V  G  SD  GR+     ++ ++ VF+ +A +  +++++ +      L  GF+     ++   +  E+V  S+R   G    L Y   ++L+ L  + +++   L L     S   L + F   ES RWLL+  + K+A  ++  + K N   ++EN   + ++  E E  ++ + +  S+ ++ K K +L+  L +WF +   +  YY  +     ++  ++   ++  L  + +  + +    R+GR  +L+ SL     A  ++  + KY      +I   + MI       ++G ++ Y  E FPT +R  ++ + S  AR+ G +A+    ++  F   P +  I  +  A+ G L   F +PET  +P   +F   + KN    R+      K +I+ E
Sbjct:   77 LIANRSRLDFQNVTLDSKCSNGFIYSTQSYGSTAPNEYDLVCDSDYIRSNLKTIFFAGRIFGAVIFGQLSDIIGRL----RTFLIVVVFNLIAGLGLYFSINPIMIGGFLLLQGFSQVGYTLTTFVLGCELVGTSKRKWTGTVLQLFYTAAFILIPLCYWGMQNWRYLALFSGLPSIFFLSYFFIVYESPRWLLSKGRSKEALIIIEKVGKTNHIKLSENLKTEILKHHESEEYKNDTEKKHSVFDLIKSKSMLLLSLNVWFNWIVNALIYYGIIYNVENLAGSLYLNFILLGLVEIPAYVLNLLFLDRIGRRNLLIISLWGTGVACLLSGCVPKY----NTVIIATIAMIGKLTVTMSYGVVYFYTSELFPTTVRNAAMGVSSMSARIGGTMATPILLLDHYFSPLPMI--IFAVLSAVAGGLT--FKMPETKGKPLDQNFHKSSVKN---ERKTAEDDPKPLINDE 529          
BLAST of slc22a-6 vs. Planmine SMEST
Match: SMESG000040243.1 (SMESG000040243.1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.878e-21
Identity = 109/468 (23.29%), Postives = 214/468 (45.73%), Query Frame = 1
Query:  457 LIIDSSRCRLTNIS--SICSEIFV-KKYPMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIGCGLSYFMISVFSTVAAVSPWYTLHALG----RLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXXXXXXXXVMMHIAKFNRKSVTENQIDKYIEIFEEERLRSVSHRV-SIKEVFKYKXXXXXXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILL-SLQLGVTALFIASIILKYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQ---MEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRP-SSDFLSQAEKNFVEWRQPWRKSSKKIIDTE 1821
            LI + SR    N++  S CS  F+       ST  +++ L C+   + S   ++F  G   G+V  G  SD  GR+     ++ ++ VF+ +A +  +++++ +      L  GF+     ++   +  E+V  S+R   G    L Y   ++L+ L  + +++   L L     S   L + F   ES RWLL+  + K+A  ++  + K N   ++EN   + ++  E E  ++ + +  S+ ++ K K +L+  L +WF +   +  YY  +     ++  ++   ++  L  + +  + +    R+GR  +L+ SL     A  ++  + KY      +I   + MI       ++G ++ Y  E FPT +R  ++ + S  AR+ G +A+    ++  F   P +  I  +  A+ G L   F +PET  +P   +F   + KN    R+      K +I+ E
Sbjct:  106 LIANRSRLDFQNVTLDSKCSNGFIYSTQSYGSTAPNEYDLVCDSDYIRSNLKTIFFAGRIFGAVIFGQLSDIIGRL----RTFLIVVVFNLIAGLGLYFSINPIMIGGFLLLQGFSQVGYTLTTFVLGCELVGTSKRKWTGTVLQLFYTAAFILIPLCYWGMQNWRYLALFSGLPSIFFLSYFFIVYESPRWLLSKGRSKEALIIIEKVGKTNHIKLSENLKTEILKHHESEEYKNDTEKKHSVFDLIKSKSMLLLSLNVWFNWIVNALIYYGIIYNVENLAGSLYLNFILLGLVEIPAYVLNLLFLDRIGRRNLLIISLWGTGVACLLSGCVPKY----NTVIIATIAMIGKLTVTMSYGVVYFYTSELFPTTVRNAAMGVSSMSARIGGTMATPILLLDHYFSPLPMI--IFAVLSAVAGGLT--FKMPETKGKPLDQNFHKSSVKN---ERKTAEDDPKPLINDE 558          
BLAST of slc22a-6 vs. Planmine SMEST
Match: SMESG000064418.1 (SMESG000064418.1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.821e-17
Identity = 122/474 (25.74%), Postives = 218/474 (45.99%), Query Frame = 1
Query:  406 FTEHRNQFKA-INNETGFLIIDSSRCRLTNISSICSEIFVKKYP----MTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGR---IIGCGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIVEISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIFPFFYKESFRWLLATXX-XXXXXXVMMHIAKFNRKSVTE--NQIDKYIEIFEEERLRS---VSHRVSIKEVFKYKXXXX---XXXXXWFIFFSCSFSYYTFLLGSSKISDEIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIILKYIYGGKNI--ITTVLLMIA-ISVSGTNFGFMWIYGGEAFPTVIRATSVSIGSACARVSGMIASQMEWVFEIAPNVLP--IIGMTMAMFGSLCTFFLLPETFKRPSSDFLSQAEK 1761
            FT  +  FK  +NN T    I S    + N+S +C +  V  YP    + ++I S+F+L C+ + LS    S+ + G+ +G + G    D FGR    IG   S F+  +     + S   TL  +G+ F G    +S  +   +ALE +   +++ FG    + + I    + +LA+FIRD   LQ+     S++SL+      ES RWL+++ K  +    V  HI + N K+  E  + ++K     E  +++S    S R    ++ K K + +    L V W   +  + +Y    + +    +  FT    S L  +    I+ F C +  R   + SLQ+     F+ S +L      +NI  +TT+L++   ++++G+ F    I G   +P+ +R   VSI     +++ + +     +F+ +   LP  I+GM   + G L  F+  P+   +P S+ +   E 
Sbjct:   32 FTAGQISFKCQVNNLTMKTNICSWWDNIANMSLVCGKNIVF-YPSDNFVQTSIISRFELVCDQNYLSGLIQSLVIFGMVIGGLIGPTVGDKFGRKSITIG---SMFLSGILGISVSFSNSVTLFGIGKFFLGILREISMTNGCILALEYIPSHKQSLFGMISQIIWSISISFVGMLAYFIRDWDTLQMIGSIPSFLSLVLILIVSESPRWLISSGKFDELDILVKRHIKRSNMKAFMELSDILNKLRSNAENAKMQSRIKYSKRYYPWDILKSKYLTLWTGILTVTW--IYGITATYSLNFITTMVAGNPYFTFCSSSFLDGIA--IIFSFFCLKFSRNLTVFSLQMTSCLCFLISGLLS-----ENIKYVTTILIVFGKMALNGSQFIIS-ISGIYIYPSTLRIFGVSISCTIGKLAAISSPYFVELFK-SGRWLPTTILGMCSMLVGILNVFY--PDWINQPLSETIEDVEN 488          
The following BLAST results are available for this feature:
BLAST of slc22a-6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC22A62.411e-2822.88solute carrier family 22 member 6 [Source:HGNC Sym... [more]
SLC22A63.075e-2823.13solute carrier family 22 member 6 [Source:HGNC Sym... [more]
SLC22A83.475e-2623.18solute carrier family 22 member 8 [Source:HGNC Sym... [more]
SLC22A83.475e-2623.18solute carrier family 22 member 8 [Source:HGNC Sym... [more]
SLC22A76.075e-2624.48solute carrier family 22 member 7 [Source:HGNC Sym... [more]
back to top
BLAST of slc22a-6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
K05F1.62.534e-2123.69pep chromosome:WBcel235:II:5782942:5787658:1 gene:... [more]
K05F1.62.534e-2123.69pep chromosome:WBcel235:II:5782524:5787658:1 gene:... [more]
K05F1.62.959e-2123.83pep chromosome:WBcel235:II:5782942:5787658:1 gene:... [more]
K05F1.62.959e-2123.83pep chromosome:WBcel235:II:5782524:5787658:1 gene:... [more]
F32H5.48.264e-2125.00pep chromosome:WBcel235:V:13361203:13363357:1 gene... [more]
back to top
BLAST of slc22a-6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Orct7.542e-3324.28gene:FBgn0019952 transcript:FBtr0334870[more]
Orct7.542e-3324.28gene:FBgn0019952 transcript:FBtr0084599[more]
Orct25.296e-3224.95gene:FBgn0086365 transcript:FBtr0084598[more]
Orct25.296e-3224.95gene:FBgn0086365 transcript:FBtr0334869[more]
CG86543.489e-3026.91gene:FBgn0034479 transcript:FBtr0086340[more]
back to top
BLAST of slc22a-6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc22a7a4.187e-3124.91solute carrier family 22 member 7a [Source:ZFIN;Ac... [more]
si:dkey-166k12.13.131e-3025.24si:dkey-166k12.1 [Source:ZFIN;Acc:ZDB-GENE-120215-... [more]
oatx4.408e-3026.11organic anion transporter X [Source:ZFIN;Acc:ZDB-G... [more]
si:dkey-166k12.15.535e-3025.24si:dkey-166k12.1 [Source:ZFIN;Acc:ZDB-GENE-120215-... [more]
slc22a6l7.658e-2926.33solute carrier family 22 member 6, like [Source:NC... [more]
back to top
BLAST of slc22a-6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000036038.11.525e-3228.04solute carrier family 22 (organic anion transporte... [more]
ENSXETT00000036031.13.924e-3228.40solute carrier family 22 (organic anion transporte... [more]
ENSXETT00000022873.15.038e-3228.61solute carrier family 22 (organic anion transporte... [more]
ENSXETT00000022866.11.242e-3028.40solute carrier family 22 (organic anion transporte... [more]
ENSXETT00000046179.17.503e-2824.89solute carrier family 22 member 20, pseudogene gen... [more]
back to top
BLAST of slc22a-6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc22a69.734e-3225.77solute carrier family 22 (organic anion transporte... [more]
Slc22a74.054e-3024.06solute carrier family 22 (organic anion transporte... [more]
Slc22a85.709e-2824.53solute carrier family 22 (organic anion transporte... [more]
Slc22a85.709e-2824.53solute carrier family 22 (organic anion transporte... [more]
Slc22a121.105e-2524.69solute carrier family 22 (organic anion/cation tra... [more]
back to top
BLAST of slc22a-6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VCA2|ORCT_DROME7.560e-3224.28Organic cation transporter protein OS=Drosophila m... [more]
sp|Q95R48|OCTL_DROME5.309e-3124.95Organic cation transporter-like protein OS=Drosoph... [more]
sp|Q8VC69|S22A6_MOUSE6.809e-3125.77Solute carrier family 22 member 6 OS=Mus musculus ... [more]
sp|Q91WU2|S22A7_MOUSE9.745e-3024.25Solute carrier family 22 member 7 OS=Mus musculus ... [more]
sp|O57379|S22A6_PSEAM8.796e-2925.61Solute carrier family 22 member 6 OS=Pseudopleuron... [more]
back to top
BLAST of slc22a-6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJ980.000e+0100.00Slc22a-6 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A1D2NMQ12.195e-3725.59Organic cation transporter protein OS=Orchesella c... [more]
A0A3B3BBV43.025e-3626.60MFS domain-containing protein OS=Oryzias melastigm... [more]
A0A437C1E79.031e-3626.67MFS domain-containing protein OS=Oryzias javanicus... [more]
B4LVT82.291e-3525.00MFS domain-containing protein OS=Drosophila virili... [more]
back to top
BLAST of slc22a-6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-119m7.41.927e-3825.05solute carrier family 22 member 13-like [Source:NC... [more]
oatx2.282e-3423.41solute carrier family 22 member 6-like [Source:NCB... [more]
slc22a6l1.253e-3327.21solute carrier family 22 member 6-like [Source:NCB... [more]
si:dkey-166k12.15.895e-3124.43organic cation transporter protein-like [Source:NC... [more]
si:dkey-166k12.11.138e-2924.71organic cation transporter protein-like [Source:NC... [more]
back to top
BLAST of slc22a-6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
oct21.095e-2023.77organic cation transporter 2 [Source:ZFIN;Acc:ZDB-... [more]
ENSPMAT00000007122.11.935e-1725.73pep scaffold:Pmarinus_7.0:GL476962:153150:164773:-... [more]
SLC22A72.219e-1725.45solute carrier family 22 member 7 [Source:HGNC Sym... [more]
slc22a6l1.574e-1223.97solute carrier family 22 member 6, like [Source:NC... [more]
ENSPMAT00000002617.16.887e-1026.52pep scaffold:Pmarinus_7.0:GL485729:386:8898:-1 gen... [more]
back to top
BLAST of slc22a-6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc22a-6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO351925.987e-2524.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366965.743e-2424.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398601.467e-2323.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO367234.039e-2322.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460874.683e-2222.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc22a-6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000022564.21.722e-3724.47solute carrier family 22 member 6 [Source:NCBI gen... [more]
slc22a6l4.807e-2926.21solute carrier family 22 member 6 [Source:NCBI gen... [more]
si:dkey-166k12.15.415e-2923.54solute carrier family 22 member 13 [Source:NCBI ge... [more]
oatx7.540e-2923.48solute carrier family 22 member 6 [Source:NCBI gen... [more]
slc22a22.581e-2425.18solute carrier family 22 member 2 [Source:NCBI gen... [more]
back to top
BLAST of slc22a-6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020910.10.000e+099.22SMESG000020910.1[more]
SMESG000040243.11.592e-2123.29SMESG000040243.1[more]
SMESG000040243.11.802e-2123.29SMESG000040243.1[more]
SMESG000040243.11.878e-2123.29SMESG000040243.1[more]
SMESG000064418.12.821e-1725.74SMESG000064418.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30020778
GenBankAKN21554.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020778 ID=SMED30020778|Name=slc22a-6|organism=Schmidtea mediterranea sexual|type=transcript|length=1958bp
CTAGTTTATAAATCGTATTAAAAAAACGTAAAGTCCACCGAATTTTATCA
ATTTGACGTTGAACGCAGATGTAAATTCACAATCATTGACATCATGATAA
AAGGTTGATTCACAACGAAAGCCATTTTATCGAGCAAACTGGCCATTCAC
AGTGAATCAAGTTAATTACATTCAAATTTGAGCATTCATAAAAACGGTGA
AATAAAACTCAAAATCACTTTGTTAAAACAAATGTCGGAAAAAATTTATC
AATTAGTCGGGGGGAATTCCTATTTTCAATATTTTATATTGATGTTCATA
TTCATTTCCCAATTCAATACGGCAATAAATATTTTGATGCCAATTTTCAT
CAACAACTATCAGGATGTCTATTGCGTTTTGCCGAAAAACCAAACCAATC
AAGTCTTCACTGAACACCGAAACCAATTCAAAGCAATAAACAATGAGACC
GGATTCCTAATCATTGACAGTAGTCGGTGCAGACTTACAAATATCAGTAG
TATTTGTTCAGAGATTTTTGTTAAAAAATATCCCATGACATCGACAATTC
GCAGTCAGTTTAAATTGTACTGTGAATATCATGCACTCAGTTCATTTGCG
ACCTCTATGTTTATGTTGGGAATCTGTCTTGGATCTGTATTTGGAGGGGT
TTTCTCCGACACCTTTGGAAGAATTATAGGCTGTGGGCTTAGTTATTTTA
TGATTTCCGTTTTTTCCACAGTGGCAGCTGTATCCCCTTGGTATACGTTA
CATGCATTAGGGAGGCTTTTTACGGGTTTTGCAGTTAGTGTATCATTTGT
GTCTAATAGTGGAATGGCGTTGGAAATTGTTGAAATAAGCCAGAGGACAA
ATTTCGGCTTTTATTGGTCACTCGGATACGACATTGGATATTTGCTTTTG
GTGTTACTGGCTTTTTTCATTAGAGATCATTTTAAGTTGCAACTAGCTTG
CTGTTGTATTTCTTACGTGTCTCTCATTTTTCCTTTCTTTTATAAAGAAT
CTTTCCGGTGGCTTTTGGCAACAAAAAAGTACAAAAAAGCTAAGAAAGTG
ATGATGCATATCGCCAAATTCAATAGAAAGTCAGTTACAGAAAATCAAAT
TGATAAATATATTGAGATTTTTGAAGAAGAAAGACTGAGAAGTGTTTCTC
ACCGAGTCAGTATAAAGGAAGTATTTAAATATAAAGTAGTCTTGGTCAAT
CTTTTGGTTCTTTGGTTCATATTTTTCTCCTGTTCATTCAGTTATTACAC
ATTTTTGCTCGGATCATCTAAAATCAGTGATGAAATTTTTACTGCAGCCC
TAATAAGTGCCCTGGGTTCTCTAGTTTCCAGATCAATCTACATGTTTCTT
TGCAAGAGATTAGGAAGAGTTACTATATTATTATCCTTGCAATTGGGAGT
TACAGCTTTGTTCATTGCCAGCATAATACTTAAATATATTTATGGAGGAA
AGAATATAATAACAACAGTTTTACTTATGATTGCAATTTCCGTGTCCGGA
ACGAATTTTGGATTTATGTGGATATATGGAGGAGAAGCGTTTCCAACAGT
TATCAGGGCGACAAGTGTTAGCATAGGATCTGCATGTGCTCGAGTTTCGG
GAATGATTGCGTCACAAATGGAATGGGTTTTTGAAATAGCTCCTAATGTC
CTACCAATTATTGGAATGACAATGGCCATGTTTGGGTCTTTGTGCACATT
TTTTCTATTGCCAGAAACTTTCAAACGCCCGAGTTCTGACTTTTTGTCGC
AAGCTGAGAAGAATTTTGTAGAATGGCGTCAACCGTGGAGGAAAAGTTCC
AAGAAAATAATCGACACTGAAATCAAAGTGTAACATGAATATTCAGTGTT
TGAAAGGTTTAATAATAATAATATCTTGTATTTTTAATTTATAACTTTTA
ATATGTATCTTCTACTGCGTGTACTGTCAAATAATAAACATATTAATTTT
GAAAAAAA
back to top

protein sequence of SMED30020778-orf-1

>SMED30020778-orf-1 ID=SMED30020778-orf-1|Name=SMED30020778-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=534bp
MSEKIYQLVGGNSYFQYFILMFIFISQFNTAINILMPIFINNYQDVYCVL
PKNQTNQVFTEHRNQFKAINNETGFLIIDSSRCRLTNISSICSEIFVKKY
PMTSTIRSQFKLYCEYHALSSFATSMFMLGICLGSVFGGVFSDTFGRIIG
CGLSYFMISVFSTVAAVSPWYTLHALGRLFTGFAVSVSFVSNSGMALEIV
EISQRTNFGFYWSLGYDIGYLLLVLLAFFIRDHFKLQLACCCISYVSLIF
PFFYKESFRWLLATKKYKKAKKVMMHIAKFNRKSVTENQIDKYIEIFEEE
RLRSVSHRVSIKEVFKYKVVLVNLLVLWFIFFSCSFSYYTFLLGSSKISD
EIFTAALISALGSLVSRSIYMFLCKRLGRVTILLSLQLGVTALFIASIIL
KYIYGGKNIITTVLLMIAISVSGTNFGFMWIYGGEAFPTVIRATSVSIGS
ACARVSGMIASQMEWVFEIAPNVLPIIGMTMAMFGSLCTFFLLPETFKRP
SSDFLSQAEKNFVEWRQPWRKSSKKIIDTEIKV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000087proximal tubule
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR005828MFS_sugar_transport-like
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 90..504
e-value: 6.2E-52
score: 178.9
NoneNo IPR availablePANTHERPTHR24064:SF411coord: 42..509
NoneNo IPR availablePANTHERPTHR24064FAMILY NOT NAMEDcoord: 42..509
NoneNo IPR availableCDDcd17374MFS_OATcoord: 103..492
e-value: 8.51596E-31
score: 120.473
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 472..494
NoneNo IPR availableTMHMMTMhelixcoord: 381..400
NoneNo IPR availableTMHMMTMhelixcoord: 410..432
NoneNo IPR availableTMHMMTMhelixcoord: 119..141
NoneNo IPR availableTMHMMTMhelixcoord: 236..258
NoneNo IPR availableTMHMMTMhelixcoord: 180..202
NoneNo IPR availableTMHMMTMhelixcoord: 148..170
NoneNo IPR availableTMHMMTMhelixcoord: 209..231
NoneNo IPR availableTMHMMTMhelixcoord: 352..374
NoneNo IPR availableTMHMMTMhelixcoord: 320..342
IPR005828Major facilitator, sugar transporter-likePFAMPF00083Sugar_trcoord: 104..499
e-value: 2.2E-22
score: 79.5
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 19..497
score: 16.375
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 118..500