Sushi/SCR/CCP,domain-containing protein

Overview
NameSushi/SCR/CCP,domain-containing protein
Smed IDSMED30020777
Length (bp)1828
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sushi/SCR/CCP,domain-containing protein (SMED30020777) t-SNE clustered cells

Violin plots show distribution of expression levels for Sushi/SCR/CCP,domain-containing protein (SMED30020777) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020777

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30020777h1SMcG0012967 dd_Smed_v4_41498_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020777h1SMcG0012967 dd_Smed_v4_41498_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30020777h1SMcG0012967 dd_Smed_v4_41498_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30020777h1SMcG0012967 dd_Smed_v6_41498_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sushi/SCR/CCP,domain-containing protein vs. TrEMBL
Match: A0A5K4F2G1 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 9.764e-64
Identity = 164/560 (29.29%), Postives = 266/560 (47.50%), Query Frame = 1
Query:  145 YRNETGKCY--MVMNELYPYITAQKTC----------GVGLTVIRDTNDLMILHRMLIEIGNSEALWLNAYFNEKDKEWKWSTSEQSVNKTIFQDVNLNQINSCAILKFNYIYVDGP--FTLSSTIQNENCSNPHSVVCEIQTESCTTDTIRGFDNSIMELNPDISYIENTVQVQCKDGFYSE--------SDYEYWVTCTQTEVK---------------QAWKPKM---SQRIIQCKMVGCNKPEEQFSNA-NKDKNHV--DKQIYNYGDEILFRCIRGFVDYKYRNQTIAKLKCKQSKTNKREGLWEPQSFAPCVAIECNMGELQILKPTNAIFSGARNRITQEEFNPEFQMNQFPYFNNIVDIQCNSDLFFSDRKMIKNFLCDIKNLSEIKGSWIGYAGTEVNNPLKCEAVTCMYEDVRTQKFQNLEELFEMKISGNQMINITNHEWMSYNYTNTLRFFCKNGFLTGNQETFQLVKCGPDGNWIPRLSDCIKKTEQVDSGNKKFYIPPPQNANGAREVGAXXXXXXXXXXXXXXXLDLSTITRDIKILRKNIRFLR 1695
            Y NETGKCY  ++  +  P+  A + C           + L  + D N+     ++L E    E +W+ A  ++  + + W     +   +        Q  +C    +    + G   +T+  TI N+ C    S +CE +   CT +   GF+++ M L P I    + VQVQC  G   +        S +E  ++ ++   K                 ++P++      +  C  V C    E   N  NK +  V  D  IY+YG  I  +C RG+V ++  N T+A + C  + T    GLW+P+++  C+A+ CN  EL    P NA    ARNRIT++ F    Q+NQF  + N++ I+CN    F+DR   K   C++   S  +G + GY+GT +  P +C+  TC+YE    Q   N+E  F +  S   ++N+T H  + Y     +R+FCKNG+ +  Q +   + CG  G W P+L  CI + E+V  G        P+ A  A ++ +I+ +++ IF  II++LDL TI RD + +R+NIR  R
Sbjct:   25 YSNETGKCYKPIMGAQKLPFSNASQACKTYLQNISKVSINLVKLSDENEADAFVKLLSENAFKETIWIGANRSDAKQPFIWYMDGSTALFSYTDWSQGAQPGNCIGFSYTTQPISGTDKWTIIKTIDNKPCDIMRSFICEHKVPLCT-NPPGGFNSTTMILKPSIMAPGSIVQVQCAPGTIKDPVTSGNRLSGFEVDLSLSENSYKCTGKRFNDNPNPEDPLKFQPQLFYSGYLLSTCSYVKCPLFPELMENIENKPQVPVGSDSLIYDYGQNITLQCSRGYVSFQNPNSTLATMVCAHASTTFNLGLWDPENYQACIAVRCNETELDNTIPKNAKLVTARNRITEQVFGLH-QVNQFYSYGNVISIRCNPGYLFNDRTTEKQVSCELVPGSNTEGEYRGYSGTILPLPAECQEATCLYEQAVIQPDYNMEPYFIVMKSNIDVMNLTKHSGVPYPRGTVIRYFCKNGYESIYQNSGLNITCGNYGQWTPQLIGCIARIEKVSVGLTGRLYTEPKEAESASKLSSIMFVMVFIFLGIILLLDLVTIGRDFRQIRENIRLQR 582          
BLAST of Sushi/SCR/CCP,domain-containing protein vs. TrEMBL
Match: A0A4E0RGX6 (Sushi/SCR/CCP domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_002908 PE=4 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 1.573e-62
Identity = 156/557 (28.01%), Postives = 270/557 (48.47%), Query Frame = 1
Query:  133 ENFKYRNETGKCYMVMNELYP--YITAQKTCG-------VGLTVIRDTNDLMILHRMLIEIGNSEALWLNAYFNEKDKEWKWSTSEQSVNKTIFQDVNLNQINSCAILKFNYIYVDGP----FTLSSTIQNENCSNPHSVVCEIQTESCTTDTIRGFDNSIMELNPDISYIENTVQVQCKDGFYS----------ESDYEYWVTCTQTEVKQAWKP-----------KMSQRII-QCKMVGCN-KPE--EQFSNANKDKNHVDKQIYNYGDEILFRCIRGFVDYKYRNQTIAKLKCKQSKTNKREGLWEPQSFAPCVAIECNMGELQILKPTNAIFSGARNRITQEEFNPEFQMNQFPYFNNIVDIQCNSDLFFSDRKMIKNFLCDIKNLSEIKGSWIGYAGTEVNNPLKCEAVTCMYEDVRTQKFQNLEELFEMKISGNQMINITNHEWMSYNYTNTLRFFCKNGFLTGNQETFQLVKCGPDGNWIPRLSDCIKKTEQVDSGNKKFYIPPPQNANGAREVGAXXXXXXXXXXXXXXXLDLSTITRDIKILRKNIRF 1689
            E ++Y + +GKCY  + +  P  +  A   C        V L      ++L  L  +++ +GN +++WL+A+ +   K+++W    + + +  F D +  + N    L+ +Y+    P    + +  T+Q  +C      VCE   + C  +   GFDN+ M L P  +     V V CK+G Y           ++D    +   Q        P           K S  ++ +C  + C   P+  +   NA +      + I+N+G+ I   C  G+V  +    T+ +++C Q      EG+W P+++  CVA+ C++ EL+ + P NA  S ARN  T +    + Q+N+F Y+ N++ I+CN+   + DR   K  +C +   S+  G + GY GT +  P  CEA TCMYE+   +   ++   F ++      +N++ HE + Y     +RFFCK GF T NQ     + C   G W P+L  CI KT ++ S N   +   P+ A  A+E+ +I++I++ IF  +I++LDL+TI RD+K L  N++ 
Sbjct:   40 ETWQYSDVSGKCYKFVGKSAPLKWAEASAACSQSLSTQSVRLIQFSSEDELRALIEIMLRLGNMDSIWLDAHRDSSGKDFRWQNGTEPL-QFPFLDWSEGRGNG-QCLELSYLTSALPTSSNWKMDVTLQETDCEERKPFVCEHDVQLCQ-NPPGGFDNTSMVLTPPKAAPRKLVTVVCKEGSYMTPGPTTERSVDADVNDTLGANQYYCDGKRDPSGDPQLYVAKFKYSGYLVSKCARLQCPLYPQLLKNVENAPELPPGTTQLIFNFGETIDLNCTGGYVSLQNATSTVGRMECSQVDRLAAEGVWIPENYQVCVAVRCDLDELKSMVPKNAFLSSARNYQT-DRLYAQHQVNEFSYYGNVITIRCNNGFLYPDRTTEKLVICKLAENSKTSGVYGGYGGTSLPLPGSCEATTCMYENAVIKPEHHMNPYFLIQNGTGDWMNVSKHEGIPYALQAKIRFFCKEGFETVNQNEDFNITCSDTGLWSPQLIGCIAKTAEIPSTNTGRFYTEPEEAKSAKEISSIMLILIFIFLGLIILLDLTTIGRDMKQLWSNLKL 592          
BLAST of Sushi/SCR/CCP,domain-containing protein vs. TrEMBL
Match: A0A504Z6P6 (Sushi/SCR/CCP domain-containing protein OS=Fasciola gigantica OX=46835 GN=FGIG_07331 PE=4 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 1.503e-60
Identity = 151/560 (26.96%), Postives = 267/560 (47.68%), Query Frame = 1
Query:  133 ENFKYRNETGKCYMVMNELYPY------------ITAQKTCGVGLTVIRDTNDLMILHRMLIEIGNSEALWLNAYFNEKDKEWKWSTSEQSVNKTIFQDVNLNQINSCAILKFNYIYVDGP----FTLSSTIQNENCSNPHSVVCEIQTESCTTDTIRGFDNSIMELNPDISYIENTVQVQCKDGFYS----------ESDYEYWVTCTQTEVKQAWKP-----------KMSQRII-QCKMVGCN-KPE--EQFSNANKDKNHVDKQIYNYGDEILFRCIRGFVDYKYRNQTIAKLKCKQSKTNKREGLWEPQSFAPCVAIECNMGELQILKPTNAIFSGARNRITQEEFNPEFQMNQFPYFNNIVDIQCNSDLFFSDRKMIKNFLCDIKNLSEIKGSWIGYAGTEVNNPLKCEAVTCMYEDVRTQKFQNLEELFEMKISGNQMINITNHEWMSYNYTNTLRFFCKNGFLTGNQETFQLVKCGPDGNWIPRLSDCIKKTEQVDSGNKKFYIPPPQNANGAREVGAXXXXXXXXXXXXXXXLDLSTITRDIKILRKNIRF 1689
            E ++Y + +GKCY  + +  P             ++ Q    V L      ++L  L  +++ +GN +++WL+A+ +   K+++W    + + +  F D +  + N    L+ +Y+    P    + +  T+Q  +C      +CE   + C  +   GFDNS M L P  +       V CK+G Y           ++D    +   Q        P           K S  ++ +C  + C   P+  +   NA +      + I+N+G+ I   C  G+V       T+ +++C Q      EG+W P+++  CVA+ C++ EL+ + P NA  S ARN  T +    + Q+N+F Y+ N++ I+CN+   + DR   K  +C +   S+  G + GY GT +  P  CEA TCMYE+   +   +++  F ++      +N++ HE + Y     +RFFC+ GF T NQ     + C   G W P+L  CI KT ++ S N   +   P+ A  A+ + +I++I++ IF   +++LDL+TI RD+K L  N++ 
Sbjct:   23 ETWQYSDVSGKCYRFVGKSAPLKWAEASAACLQSLSTQSNQSVRLIQFSSEDELRALIEIMLRLGNMDSIWLDAHRDSSGKDFRWQNGTEPL-QFPFLDWSEGRGNG-QCLELSYLTSALPTSSNWKMDVTLQETDCEERKPFLCEHDVQLCQ-NPPGGFDNSSMVLTPPKAAPRKVFTVVCKEGSYMTPGSTSSRSVDADVNDTLGANQYYCDGKRDPSGDPQLYVANFKYSGYLVSKCARLQCPLYPQLLKNVENAPELPQGTTQLIFNFGETIDLNCTGGYVSLHNATSTVGRMECSQVDRFAAEGVWIPENYQVCVAVRCDLDELKSMVPKNAFLSSARNYQT-DRLYAQHQVNEFSYYGNVITIRCNNGFLYPDRTTEKLVICKLAENSKTNGVYGGYGGTSLPLPGSCEATTCMYENAVIKHEHHMKPYFLIQNGTGDWMNVSKHEGIPYALQAKIRFFCEEGFETVNQNEDFNITCSDTGLWSPQLIGCIAKTAEIPSTNTGRFYTEPEEAKSAKAISSIMLILIFIFLGFVILLDLTTIGRDMKQLWSNLKL 578          
BLAST of Sushi/SCR/CCP,domain-containing protein vs. TrEMBL
Match: C1LG80 (Sushi/SCR/CCP,domain-containing protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 1.628e-58
Identity = 167/576 (28.99%), Postives = 274/576 (47.57%), Query Frame = 1
Query:  145 YRNETGKCY--MVMNELYPYITAQKTCGVGLTVIR----------DTNDLMILHRMLIEIGNSEALWLNAYFNEKDKEWKWSTSEQSVNKTIFQDVNLNQ-INSCAILKFNYIYVDGPFT----LSSTIQNENCSNPHSVVCEIQTESCTTDTIRGFDNSIMELNPDISYIENTVQVQCKDGFYSE--------SDYEYWVT-------CT--------QTEVKQAWKPKM---SQRIIQCKMVGCNKPEEQFSNA-NKDKNHV--DKQIYNYGDEILFRCIRGFVDYKYRNQTIAKLKCKQSKTNKREGLWEPQSFAPCVAIECNMGELQILKPTNAIFSGARNRITQEEFNPEFQMNQFPYFNNIVDIQCNSDLFFSDRKMIKNFLCDIKNLSEIKGSWIGYAGTEVNNPLKCEAVTCMYEDVRTQKFQNLEELFEMKISGNQMINITNHEWMSYNYTNTLRFFCKNGFLTGNQETFQLVKCGPDGNWIPRLSDCIKKTEQVDSGNKKFYIPPPQNANGAREVGAXXXXXXXXXXXXXXXLDLSTITRDIKILRKNI-----RFLRIYNKSEKG 1719
            Y N TGKCY  ++  +   +  A   C + L  I           D ++   +  +L   G  E +W+ A  ++  + + W T   +    +F  ++ ++  NS   ++F+Y     P T    ++  + N+ C    S +CE +   CT     GF+++ M   P I    + VQV C  G   +        S +E  ++       CT         +E    ++P++      +  C  V C    E   N  NK +  V  D  IY+YG  I  +C RG+V ++  N T+A + C Q+     +GLW+P+++  C+A+ CN  EL  + P  A    ARNRIT++ F    Q+NQF  + N++ I+CN    F+DR   K+  C++   S   G + GY+GT +  P  CE  TC+YE    Q   N++  F +  S   ++N+T H    Y     +R+FCK+G+ + NQ +   + CG  G W P+L  CI + E+V       +  PP+ A  A ++ +I+ I++ IF  +I++LDL+TI RD K +R NI     R   + NKS+ G
Sbjct:   27 YSNLTGKCYKPILGAQKLTFSDASYACKIHLQNISEVSINLIQFFDEDEANAVVDLLSRNGFKETIWIGANRSDAKQPFVWYTDGSTA---LFSYIDWSEGTNSGNCIEFSYSTQPIPGTDKWSVTKIVDNKPCDLTRSFICEHKVPLCTNPQ-GGFNSTTMIFKPPIMAPRSVVQVLCAPGTLPDPIVPGSRLSGFEVDLSLPRGSYKCTGKRFNNNPNSEDPLKFQPQLFYSGYSLTTCSYVKCPLYPELMENIENKPQVPVGSDSLIYDYGQNITLQCSRGYVSFQNPNSTLATMICAQASATFNQGLWDPENYQACIAVRCNQKELDDMIPKYAKLVSARNRITEQVFG-SHQVNQFYSYGNVISIRCNPGYLFNDRTTEKSVSCELVPGSNTIGEYRGYSGTLLPLPTTCEEATCLYEQAVIQPDSNMQPYFIVMKSTIDVMNLTKHSGDPYPRGTVIRYFCKDGYESINQNSELNITCGNYGQWTPQLIGCIARIEKVPVSLAGRFYSPPEEAESASKLSSIMFIMVFIFLGLILLLDLATIGRDFKQIRSNIKLKKRRLNHLKNKSKVG 597          
BLAST of Sushi/SCR/CCP,domain-containing protein vs. TrEMBL
Match: A0A4Z2D6A3 (Sushi/SCR/CCP,domain-containing protein isoform 3 OS=Schistosoma japonicum OX=6182 GN=EWB00_004131 PE=4 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 1.662e-58
Identity = 167/576 (28.99%), Postives = 274/576 (47.57%), Query Frame = 1
Query:  145 YRNETGKCY--MVMNELYPYITAQKTCGVGLTVIR----------DTNDLMILHRMLIEIGNSEALWLNAYFNEKDKEWKWSTSEQSVNKTIFQDVNLNQ-INSCAILKFNYIYVDGPFT----LSSTIQNENCSNPHSVVCEIQTESCTTDTIRGFDNSIMELNPDISYIENTVQVQCKDGFYSE--------SDYEYWVT-------CT--------QTEVKQAWKPKM---SQRIIQCKMVGCNKPEEQFSNA-NKDKNHV--DKQIYNYGDEILFRCIRGFVDYKYRNQTIAKLKCKQSKTNKREGLWEPQSFAPCVAIECNMGELQILKPTNAIFSGARNRITQEEFNPEFQMNQFPYFNNIVDIQCNSDLFFSDRKMIKNFLCDIKNLSEIKGSWIGYAGTEVNNPLKCEAVTCMYEDVRTQKFQNLEELFEMKISGNQMINITNHEWMSYNYTNTLRFFCKNGFLTGNQETFQLVKCGPDGNWIPRLSDCIKKTEQVDSGNKKFYIPPPQNANGAREVGAXXXXXXXXXXXXXXXLDLSTITRDIKILRKNI-----RFLRIYNKSEKG 1719
            Y N TGKCY  ++  +   +  A   C + L  I           D ++   +  +L   G  E +W+ A  ++  + + W T   +    +F  ++ ++  NS   ++F+Y     P T    ++  + N+ C    S +CE +   CT     GF+++ M   P I    + VQV C  G   +        S +E  ++       CT         +E    ++P++      +  C  V C    E   N  NK +  V  D  IY+YG  I  +C RG+V ++  N T+A + C Q+     +GLW+P+++  C+A+ CN  EL  + P  A    ARNRIT++ F    Q+NQF  + N++ I+CN    F+DR   K+  C++   S   G + GY+GT +  P  CE  TC+YE    Q   N++  F +  S   ++N+T H    Y     +R+FCK+G+ + NQ +   + CG  G W P+L  CI + E+V       +  PP+ A  A ++ +I+ I++ IF  +I++LDL+TI RD K +R NI     R   + NKS+ G
Sbjct:   27 YSNLTGKCYKPILGAQKLTFSDASYACKIHLQNISEVSINLIQFFDEDEANAVVDLLSRNGFKETIWIGANRSDAKQPFVWYTDGSTA---LFSYIDWSEGTNSGNCIEFSYSTQPIPGTDKWSVTKIVDNKPCDLTRSFICEHKVPLCTNPQ-GGFNSTTMIFKPPIMAPRSVVQVLCAPGTLPDPIVPGSRLSGFEVDLSLPRGSYKCTGKRFNNNPNSEDPLKFQPQLFYSGYSLTTCSYVKCPLYPELMENIENKPQVPVGSDSLIYDYGQNITLQCSRGYVSFQNPNSTLATMICAQASATFNQGLWDPENYQACIAVRCNQKELDDMIPKYAKLVSARNRITEQVFG-SHQVNQFYSYGNVISIRCNPGYLFNDRTTEKSVSCELVPGSNTIGEYRGYSGTLLPLPTTCEEATCLYEQAVIQPDSNMQPYFIVMKSTIDVMNLTKHSGDPYPRGTVIRYFCKDGYESINQNSELNITCGNYGQWTPQLIGCIARIEKVPVSLAGRFYSPPEEAESASKLSSIMFIMVFIFLGLILLLDLATIGRDFKQIRSNIKLQKRRLNHLKNKSKVG 597          
BLAST of Sushi/SCR/CCP,domain-containing protein vs. Planmine SMEST
Match: SMESG000010733.1 (SMESG000010733.1)

HSP 1 Score: 1061.6 bits (2744), Expect = 0.000e+0
Identity = 529/529 (100.00%), Postives = 529/529 (100.00%), Query Frame = 1
Query:  172 MVMNELYPYITAQKTCGVGLTVIRDTNDLMILHRMLIEIGNSEALWLNAYFNEKDKEWKWSTSEQSVNKTIFQDVNLNQINSCAILKFNYIYVDGPFTLSSTIQNENCSNPHSVVCEIQTESCTTDTIRGFDNSIMELNPDISYIENTVQVQCKDGFYSESDYEYWVTCTQTEVKQAWKPKMSQRIIQCKMVGCNKPEEQFSNANKDKNHVDKQIYNYGDEILFRCIRGFVDYKYRNQTIAKLKCKQSKTNKREGLWEPQSFAPCVAIECNMGELQILKPTNAIFSGARNRITQEEFNPEFQMNQFPYFNNIVDIQCNSDLFFSDRKMIKNFLCDIKNLSEIKGSWIGYAGTEVNNPLKCEAVTCMYEDVRTQKFQNLEELFEMKISGNQMINITNHEWMSYNYTNTLRFFCKNGFLTGNQETFQLVKCGPDGNWIPRLSDCIKKTEQVDSGNKKFYIPPPQNANGAREVGAXXXXXXXXXXXXXXXLDLSTITRDIKILRKNIRFLRIYNKSEKGFDVENFETNERAN 1758
            MVMNELYPYITAQKTCGVGLTVIRDTNDLMILHRMLIEIGNSEALWLNAYFNEKDKEWKWSTSEQSVNKTIFQDVNLNQINSCAILKFNYIYVDGPFTLSSTIQNENCSNPHSVVCEIQTESCTTDTIRGFDNSIMELNPDISYIENTVQVQCKDGFYSESDYEYWVTCTQTEVKQAWKPKMSQRIIQCKMVGCNKPEEQFSNANKDKNHVDKQIYNYGDEILFRCIRGFVDYKYRNQTIAKLKCKQSKTNKREGLWEPQSFAPCVAIECNMGELQILKPTNAIFSGARNRITQEEFNPEFQMNQFPYFNNIVDIQCNSDLFFSDRKMIKNFLCDIKNLSEIKGSWIGYAGTEVNNPLKCEAVTCMYEDVRTQKFQNLEELFEMKISGNQMINITNHEWMSYNYTNTLRFFCKNGFLTGNQETFQLVKCGPDGNWIPRLSDCIKKTEQVDSGNKKFYIPPPQNANGAREVGAIVIIIMVIFFSIIVILDLSTITRDIKILRKNIRFLRIYNKSEKGFDVENFETNERAN
Sbjct:    1 MVMNELYPYITAQKTCGVGLTVIRDTNDLMILHRMLIEIGNSEALWLNAYFNEKDKEWKWSTSEQSVNKTIFQDVNLNQINSCAILKFNYIYVDGPFTLSSTIQNENCSNPHSVVCEIQTESCTTDTIRGFDNSIMELNPDISYIENTVQVQCKDGFYSESDYEYWVTCTQTEVKQAWKPKMSQRIIQCKMVGCNKPEEQFSNANKDKNHVDKQIYNYGDEILFRCIRGFVDYKYRNQTIAKLKCKQSKTNKREGLWEPQSFAPCVAIECNMGELQILKPTNAIFSGARNRITQEEFNPEFQMNQFPYFNNIVDIQCNSDLFFSDRKMIKNFLCDIKNLSEIKGSWIGYAGTEVNNPLKCEAVTCMYEDVRTQKFQNLEELFEMKISGNQMINITNHEWMSYNYTNTLRFFCKNGFLTGNQETFQLVKCGPDGNWIPRLSDCIKKTEQVDSGNKKFYIPPPQNANGAREVGAIVIIIMVIFFSIIVILDLSTITRDIKILRKNIRFLRIYNKSEKGFDVENFETNERAN 529          
BLAST of Sushi/SCR/CCP,domain-containing protein vs. Planmine SMEST
Match: SMESG000010733.1 (SMESG000010733.1)

HSP 1 Score: 1056.97 bits (2732), Expect = 0.000e+0
Identity = 527/527 (100.00%), Postives = 527/527 (100.00%), Query Frame = 1
Query:  178 MNELYPYITAQKTCGVGLTVIRDTNDLMILHRMLIEIGNSEALWLNAYFNEKDKEWKWSTSEQSVNKTIFQDVNLNQINSCAILKFNYIYVDGPFTLSSTIQNENCSNPHSVVCEIQTESCTTDTIRGFDNSIMELNPDISYIENTVQVQCKDGFYSESDYEYWVTCTQTEVKQAWKPKMSQRIIQCKMVGCNKPEEQFSNANKDKNHVDKQIYNYGDEILFRCIRGFVDYKYRNQTIAKLKCKQSKTNKREGLWEPQSFAPCVAIECNMGELQILKPTNAIFSGARNRITQEEFNPEFQMNQFPYFNNIVDIQCNSDLFFSDRKMIKNFLCDIKNLSEIKGSWIGYAGTEVNNPLKCEAVTCMYEDVRTQKFQNLEELFEMKISGNQMINITNHEWMSYNYTNTLRFFCKNGFLTGNQETFQLVKCGPDGNWIPRLSDCIKKTEQVDSGNKKFYIPPPQNANGAREVGAXXXXXXXXXXXXXXXLDLSTITRDIKILRKNIRFLRIYNKSEKGFDVENFETNERAN 1758
            MNELYPYITAQKTCGVGLTVIRDTNDLMILHRMLIEIGNSEALWLNAYFNEKDKEWKWSTSEQSVNKTIFQDVNLNQINSCAILKFNYIYVDGPFTLSSTIQNENCSNPHSVVCEIQTESCTTDTIRGFDNSIMELNPDISYIENTVQVQCKDGFYSESDYEYWVTCTQTEVKQAWKPKMSQRIIQCKMVGCNKPEEQFSNANKDKNHVDKQIYNYGDEILFRCIRGFVDYKYRNQTIAKLKCKQSKTNKREGLWEPQSFAPCVAIECNMGELQILKPTNAIFSGARNRITQEEFNPEFQMNQFPYFNNIVDIQCNSDLFFSDRKMIKNFLCDIKNLSEIKGSWIGYAGTEVNNPLKCEAVTCMYEDVRTQKFQNLEELFEMKISGNQMINITNHEWMSYNYTNTLRFFCKNGFLTGNQETFQLVKCGPDGNWIPRLSDCIKKTEQVDSGNKKFYIPPPQNANGAREVGAIVIIIMVIFFSIIVILDLSTITRDIKILRKNIRFLRIYNKSEKGFDVENFETNERAN
Sbjct:    1 MNELYPYITAQKTCGVGLTVIRDTNDLMILHRMLIEIGNSEALWLNAYFNEKDKEWKWSTSEQSVNKTIFQDVNLNQINSCAILKFNYIYVDGPFTLSSTIQNENCSNPHSVVCEIQTESCTTDTIRGFDNSIMELNPDISYIENTVQVQCKDGFYSESDYEYWVTCTQTEVKQAWKPKMSQRIIQCKMVGCNKPEEQFSNANKDKNHVDKQIYNYGDEILFRCIRGFVDYKYRNQTIAKLKCKQSKTNKREGLWEPQSFAPCVAIECNMGELQILKPTNAIFSGARNRITQEEFNPEFQMNQFPYFNNIVDIQCNSDLFFSDRKMIKNFLCDIKNLSEIKGSWIGYAGTEVNNPLKCEAVTCMYEDVRTQKFQNLEELFEMKISGNQMINITNHEWMSYNYTNTLRFFCKNGFLTGNQETFQLVKCGPDGNWIPRLSDCIKKTEQVDSGNKKFYIPPPQNANGAREVGAIVIIIMVIFFSIIVILDLSTITRDIKILRKNIRFLRIYNKSEKGFDVENFETNERAN 527          
BLAST of Sushi/SCR/CCP,domain-containing protein vs. Planmine SMEST
Match: SMESG000009423.1 (SMESG000009423.1)

HSP 1 Score: 262.692 bits (670), Expect = 2.003e-79
Identity = 176/577 (30.50%), Postives = 279/577 (48.35%), Query Frame = 1
Query:   73 LISFWIIFQKCFLTLQNLCKENFKYRNETGKCYMVMNELYPYITAQKTCGVGLTVI--------------RDTNDLMILHRMLIEIGNSEALWLNAYFNEKDKEWKWS-TSEQSVNKTIFQDVNLNQINSCAILKFNYIYVDGPFTLSSTIQNENCSNPHSVVCEIQTESCTTDTIRGFDNSIMELNPDISYIENTVQVQCKDGFYSESDYEY------------WVTCTQTEVKQAWKPKM------SQRIIQCKMVGCNKPEEQFSNANKD--KNHVDKQI-YNYGDEILFRCIRGFVDYKYRNQTIAKLKCKQSKTNKREGLWEPQSFAPCVAIECNMGELQILKPTNAIFSGARNRITQEEFNPEFQMNQFPYFNNIVDIQCNSDLFFSDRKMIKNFLCDIKNLSEIKGSWIGYAGTEVNNPLKCEAVTCMYEDVRTQKFQNLEELFEMKISGNQMINITNHEWMSYNYTNTLRFFCKNGFLTGNQETFQLVKCGPDGNWIPRLSDCIKKTEQVDSGNKKFYIPPPQNANGAREVGAXXXXXXXXXXXXXXXLDLSTITRDIKILRKNIRFLR 1695
            L+SF I+F   +    N C + + Y N  GKCY         +TA   C   L  I               + ND   +   +  IGN+  +W++A  N    +W+WS  S   +N        LN  N C + ++ YIYV G   +   I  + C N ++ +CE  + SC    ++      M+L P+  +I +   V CK G+Y  S+               +  CT T       P +        +I  C+ V C       +N      ++ V+ Q  +++G  +   C RGFV+Y   +   + + C+QS T+K +G+W P ++ PC +I+C+M  L  + P NA+    RN++TQ+ ++  FQ +  P FNNIV +QC    F+ DR  +K  +CD+ N S    SW GY GT +     C+ VTC  E +      N++ ++++  S    +N T      + +   L F C +GF T    + Q++ CGP GNW P L+ CI     ++ GN + Y+P    A+ A+++G + I IMVIFFS+IVILD+ST+ RDIK++R NI  L+
Sbjct:    5 LVSFVILFLNGYYCQDNPCYDGWGYSNINGKCYSNSFNFSNQLTAAAICKSSLVSIDRRFTQFVPRLLRISNINDATAISNQMTLIGNNALVWMDAQLNPS-SQWQWSDGSLVDINALKGVAPTLNLTNPCVLFQYYYIYVSGTPQIQYNILGDKCDNLNTFICEHDSISCDLMLLQ-MQPDTMQLIPNSIFISSYPYVSCKPGYYRPSELPAAKVIQAGPVPNNYAYCTGTR-DVTKNPALYNAKWNVSQIDACQSVSCAPFSGVLNNVQSQIPQSMVNSQTSFSFGFTLYVDCARGFVNYMNSSSASSSIVCQQSITDKTQGVWTPINYTPCNSIKCDMSILTSMIPNNALIQSVRNKVTQQPYDVTFQTSFIPLFNNIVGVQCIDGYFYPDRSWVKQLICDLNNNSLTSASWQGYMGTILPLFSSCQNVTCKNEAIIITPTMNIQPIYQILNSIGIFVNQTQSNGNPFPFQAQLLFTCLSGFTTAIGSSTQVLVCGPQGNWNPNLTPCITIIPALNVGNAQHYVPDAVEASSAKQIGIVAIGIMVIFFSLIVILDMSTLARDIKVMRTNIIRLK 578          
The following BLAST results are available for this feature:
BLAST of Sushi/SCR/CCP,domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sushi/SCR/CCP,domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sushi/SCR/CCP,domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sushi/SCR/CCP,domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sushi/SCR/CCP,domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sushi/SCR/CCP,domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sushi/SCR/CCP,domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sushi/SCR/CCP,domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4F2G19.764e-6429.29Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A4E0RGX61.573e-6228.01Sushi/SCR/CCP domain-containing protein OS=Fasciol... [more]
A0A504Z6P61.503e-6026.96Sushi/SCR/CCP domain-containing protein OS=Fasciol... [more]
C1LG801.628e-5828.99Sushi/SCR/CCP,domain-containing protein OS=Schisto... [more]
A0A4Z2D6A31.662e-5828.99Sushi/SCR/CCP,domain-containing protein isoform 3 ... [more]
back to top
BLAST of Sushi/SCR/CCP,domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sushi/SCR/CCP,domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sushi/SCR/CCP,domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sushi/SCR/CCP,domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sushi/SCR/CCP,domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sushi/SCR/CCP,domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000010733.10.000e+0100.00SMESG000010733.1[more]
SMESG000010733.10.000e+0100.00SMESG000010733.1[more]
SMESG000009423.12.003e-7930.50SMESG000009423.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020777 ID=SMED30020777|Name=Sushi/SCR/CCP,domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1828bp
ATGGCTTCAAATGTTGATTTCAATATTATTTGTTTAAAATTATAAATTAT
GTTTTATCATAGTGCGATCTGTCTCATCAGTTTTTGGATCATTTTTCAAA
AATGTTTTTTGACCTTGCAAAACTTGTGTAAGGAAAATTTTAAATACAGA
AACGAAACTGGAAAATGTTATATGGTAATGAATGAATTATATCCCTATAT
CACAGCGCAGAAAACTTGTGGTGTTGGTCTAACCGTCATCAGAGATACAA
ATGACTTGATGATTCTTCACAGGATGTTAATTGAGATCGGAAATAGTGAA
GCTCTGTGGTTAAACGCCTATTTTAATGAAAAGGATAAGGAATGGAAATG
GAGTACCAGTGAACAAAGTGTGAACAAGACGATTTTCCAAGACGTAAATT
TAAATCAGATTAATTCATGTGCTATTTTGAAATTTAATTACATTTATGTT
GATGGACCATTCACGTTGAGCTCTACTATTCAAAATGAAAATTGCAGCAA
TCCCCACTCAGTAGTCTGCGAAATTCAAACTGAAAGTTGTACTACGGATA
CTATTCGCGGTTTTGATAATTCAATTATGGAGCTCAACCCAGATATATCT
TATATTGAAAACACTGTACAAGTTCAATGCAAAGATGGCTTTTATTCTGA
ATCCGATTATGAATATTGGGTAACTTGTACACAGACGGAAGTCAAGCAAG
CTTGGAAACCAAAAATGTCACAAAGAATTATCCAATGCAAAATGGTTGGT
TGTAATAAACCAGAAGAGCAATTCTCAAATGCTAATAAAGATAAAAATCA
TGTTGACAAGCAAATCTATAACTATGGCGATGAAATTTTATTCAGATGTA
TCAGAGGTTTTGTAGATTATAAATATAGAAACCAAACAATAGCAAAACTG
AAATGCAAACAATCTAAAACAAACAAAAGAGAAGGATTGTGGGAACCTCA
ATCCTTTGCTCCTTGTGTTGCTATTGAGTGTAATATGGGTGAACTCCAAA
TTCTCAAGCCCACCAACGCTATTTTCAGTGGAGCCCGAAATCGAATAACA
CAAGAGGAGTTCAATCCTGAATTTCAGATGAATCAGTTTCCTTATTTTAA
TAACATTGTTGATATTCAGTGCAATAGTGATCTGTTTTTTTCCGATCGAA
AAATGATTAAAAACTTTTTATGTGACATAAAAAATTTATCAGAAATCAAA
GGAAGTTGGATTGGATATGCTGGAACCGAAGTAAACAATCCCCTCAAATG
TGAAGCTGTTACGTGCATGTATGAAGACGTTCGGACTCAAAAGTTTCAAA
ATCTAGAAGAGTTATTCGAAATGAAAATTTCAGGGAATCAGATGATAAAT
ATTACGAATCATGAATGGATGAGTTACAATTACACAAATACTCTAAGATT
TTTTTGTAAAAACGGATTTCTTACCGGAAATCAAGAAACATTTCAGCTTG
TGAAATGTGGACCTGACGGAAATTGGATTCCTCGGCTATCCGATTGCATA
AAGAAGACAGAACAGGTTGATAGTGGAAATAAAAAGTTTTATATTCCTCC
TCCTCAGAACGCTAATGGTGCTAGAGAAGTTGGAGCCATAGTGATCATTA
TTATGGTTATATTCTTCTCGATCATTGTCATATTGGATCTCTCTACAATA
ACAAGAGATATAAAGATCCTAAGAAAAAATATTCGATTCTTGAGGATTTA
TAATAAGTCAGAGAAAGGTTTTGATGTTGAAAATTTTGAAACTAATGAAA
GAGCTAATTGAATAAAAATTTGACATTGATTATAAAATTTATTTTTAATT
TAATTTTCCATAAAAACTTTTCTTTATG
back to top

protein sequence of SMED30020777-orf-1

>SMED30020777-orf-1 ID=SMED30020777-orf-1|Name=SMED30020777-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=571bp
MFYHSAICLISFWIIFQKCFLTLQNLCKENFKYRNETGKCYMVMNELYPY
ITAQKTCGVGLTVIRDTNDLMILHRMLIEIGNSEALWLNAYFNEKDKEWK
WSTSEQSVNKTIFQDVNLNQINSCAILKFNYIYVDGPFTLSSTIQNENCS
NPHSVVCEIQTESCTTDTIRGFDNSIMELNPDISYIENTVQVQCKDGFYS
ESDYEYWVTCTQTEVKQAWKPKMSQRIIQCKMVGCNKPEEQFSNANKDKN
HVDKQIYNYGDEILFRCIRGFVDYKYRNQTIAKLKCKQSKTNKREGLWEP
QSFAPCVAIECNMGELQILKPTNAIFSGARNRITQEEFNPEFQMNQFPYF
NNIVDIQCNSDLFFSDRKMIKNFLCDIKNLSEIKGSWIGYAGTEVNNPLK
CEAVTCMYEDVRTQKFQNLEELFEMKISGNQMINITNHEWMSYNYTNTLR
FFCKNGFLTGNQETFQLVKCGPDGNWIPRLSDCIKKTEQVDSGNKKFYIP
PPQNANGAREVGAIVIIIMVIFFSIIVILDLSTITRDIKILRKNIRFLRI
YNKSEKGFDVENFETNERAN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR035976Sushi/SCR/CCP_sf
IPR000436Sushi_SCR_CCP_dom
IPR016187CTDL_fold
IPR001304C-type_lectin-like
IPR016186C-type_lectin-like/link_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001304C-type lectin-likeSMARTSM00034CLECT_2coord: 27..158
e-value: 4.7E-4
score: 29.5
IPR001304C-type lectin-likePROSITEPS50041C_TYPE_LECTIN_2coord: 36..158
score: 9.754
NoneNo IPR availableGENE3DG3DSA:2.20.28.230coord: 187..256
e-value: 2.4E-7
score: 32.7
NoneNo IPR availableGENE3DG3DSA:2.10.70.10coord: 257..290
e-value: 2.4E-7
score: 32.7
NoneNo IPR availableCDDcd00037CLECTcoord: 39..159
e-value: 6.93672E-8
score: 49.1554
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.644
NoneNo IPR availableTMHMMTMhelixcoord: 512..534
IPR016186C-type lectin-like/link domain superfamilyGENE3DG3DSA:3.10.100.10coord: 21..161
e-value: 3.3E-10
score: 42.1
IPR000436Sushi/SCR/CCP domainPROSITEPS50923SUSHIcoord: 233..308
score: 8.075
IPR000436Sushi/SCR/CCP domainPROSITEPS50923SUSHIcoord: 162..232
score: 6.811
IPR000436Sushi/SCR/CCP domainPROSITEPS50923SUSHIcoord: 404..485
score: 6.77
IPR016187C-type lectin foldSUPERFAMILYSSF56436C-type lectin-likecoord: 15..159
IPR035976Sushi/SCR/CCP superfamilySUPERFAMILYSSF57535Complement control module/SCR domaincoord: 442..485