SMED30020758

Overview
NameSMED30020758
Smed IDSMED30020758
Length (bp)2663
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30020758 (SMED30020758) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30020758 (SMED30020758) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30020758 (SMED30020758) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30020758 (SMED30020758) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020758

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30020758SMESG000028508.1 SMESG000000385.1 SmedASXL_018625SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30020758SMESG000005044.1 SMESG000005033.1 Contig12192newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020758SMESG000005044.1 SMESG000005033.1 Contig12192uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020758SMESG000028508.1 Contig14574newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020758SMESG000028508.1 Contig14574uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020758SMESG000076091.1 SMESG000070487.1 SMESG000069936.1 SMESG000066411.1 SMESG000066165.1 SMESG000065866.1 SMESG000065178.1 SMESG000062279.1 SMESG000053372.1 SMESG000050587.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000046053.1 SMESG000043782.1 SMESG000029226.1 SMESG000028508.1 SMESG000026530.1 SMESG000022236.1 SMESG000004687.1 Contig17376newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020758SMESG000076091.1 SMESG000070487.1 SMESG000069936.1 SMESG000066411.1 SMESG000066165.1 SMESG000065866.1 SMESG000065178.1 SMESG000062279.1 SMESG000053372.1 SMESG000050587.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000046053.1 SMESG000043782.1 SMESG000029226.1 SMESG000028508.1 SMESG000026530.1 SMESG000022236.1 SMESG000004687.1 Contig17376uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020758SMESG000054821.1 SMESG000054819.1 SMESG000028508.1 Contig31297newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020758SMESG000054821.1 SMESG000054819.1 SMESG000028508.1 Contig31297uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020758SMESG000043908.1 SMESG000028508.1 SMESG000024555.1 SMESG000012010.1 SMESG000081278.1 SMESG000081276.1 SMESG000080770.1 SMESG000065333.1 SMESG000059844.1 SMESG000058646.1 SMESG000055266.1 SMESG000052813.1 SMESG000043147.1 SMESG000037745.1 SMESG000037601.1 SMESG000036070.1 SMESG000034368.1 SMESG000031415.1 SMESG000019663.1 SMESG000010897.1 SMESG000009005.1 SMESG000005029.1 SMESG000077800.1 SMESG000054046.1 SMESG000052058.1 Contig18859newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020758SMESG000043908.1 SMESG000028508.1 SMESG000024555.1 SMESG000012010.1 SMESG000081278.1 SMESG000081276.1 SMESG000080770.1 SMESG000065333.1 SMESG000059844.1 SMESG000058646.1 SMESG000055266.1 SMESG000052813.1 SMESG000043147.1 SMESG000037745.1 SMESG000037601.1 SMESG000036070.1 SMESG000034368.1 SMESG000031415.1 SMESG000019663.1 SMESG000010897.1 SMESG000009005.1 SMESG000005029.1 SMESG000077800.1 SMESG000054046.1 SMESG000052058.1 Contig18859uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020758SMESG000028508.1 Contig21172newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020758SMESG000028508.1 Contig21172uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
reproductive organSMED30020758SMESG000054821.1 SMESG000054819.1 SMESG000028508.1 Contig15693newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30020758SMESG000054821.1 SMESG000054819.1 SMESG000028508.1 Contig15693uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30020758 vs. TrEMBL
Match: A0A4Y2N1V9 (Uncharacterized protein OS=Araneus ventricosus OX=182803 GN=AVEN_135919_1 PE=4 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 6.354e-36
Identity = 51/90 (56.67%), Postives = 61/90 (67.78%), Query Frame = -1
Query:  279 LTFRMYSTRSKTKVYLLESYTEVLTGGKLPSLRQVLGLFLHEHKENGKTIREASTIAIESTAKFWQKARIPTRAVQHCQAKLESEFDVWR 548
            +T    STRSKT +YLL S    LTG KLPS+   LGLFLH H E  KTIRE+ST  IE   K WQKARIP + +++CQ+KLE  F+ WR
Sbjct:   51 VTMATKSTRSKTDIYLLGSTITELTGSKLPSIGMALGLFLHHHIELNKTIRESSTTTIEEITKLWQKARIPVQELRNCQSKLEKLFEQWR 140          

HSP 2 Score: 78.9518 bits (193), Expect = 6.354e-36
Identity = 41/79 (51.90%), Postives = 55/79 (69.62%), Query Frame = -3
Query:   43 SRKAETQKAKEAAFCSRLDDLFDIAHADALKNIKIEEDSEFLIAQREKGRRGSMLGLDVTLTNKEQRASEARDKLAARR 279
            +R   TQK+KE  F S+L+++FDIAHA AL  IKI +D EFL+AQ EKGRRGS LG+D  L  K Q+ ++ R   + +R
Sbjct:  147 NRNTLTQKSKEGEFVSKLNNIFDIAHATALNMIKISQDKEFLLAQCEKGRRGSTLGVDKRL-QKMQKMADFRKNASLKR 224          
BLAST of SMED30020758 vs. TrEMBL
Match: A0A4Y2VX65 (Uncharacterized protein OS=Araneus ventricosus OX=182803 GN=AVEN_11190_1 PE=4 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.561e-35
Identity = 49/84 (58.33%), Postives = 57/84 (67.86%), Query Frame = -1
Query:  279 STRSKTKVYLLESYTEVLTGGKLPSLRQVLGLFLHEHKENGKTIREASTIAIESTAKFWQKARIPTRAVQHCQAKLESEFDVWR 530
            STRSKT +YLL      LTG KLPS+   LGLFLH H +  KTIRE+ST  IE   KFWQKARIP +  ++CQ KLE  F+ WR
Sbjct:    5 STRSKTDIYLLGFTITELTGSKLPSIGMTLGLFLHHHIKLNKTIRESSTTTIEEITKFWQKARIPVQENRNCQPKLEKLFEQWR 88          

HSP 2 Score: 81.6481 bits (200), Expect = 3.561e-35
Identity = 41/79 (51.90%), Postives = 56/79 (70.89%), Query Frame = -3
Query:   43 SRKAETQKAKEAAFCSRLDDLFDIAHADALKNIKIEEDSEFLIAQREKGRRGSMLGLDVTLTNKEQRASEARDKLAARR 279
            +R   TQK+KE  F S+ +++FDIAHA+AL  IKI +D EFL+AQ EKGRRGSMLG+D  L  K Q+ ++ R   + +R
Sbjct:   95 NRNTLTQKSKEGEFVSKFNNIFDIAHANALNMIKISQDKEFLLAQLEKGRRGSMLGVDKHL-EKIQKMADFRKNASLKR 172          
BLAST of SMED30020758 vs. TrEMBL
Match: A0A4Y2QVJ7 (Uncharacterized protein OS=Araneus ventricosus OX=182803 GN=AVEN_211017_1 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 3.010e-34
Identity = 48/84 (57.14%), Postives = 57/84 (67.86%), Query Frame = -1
Query:  279 STRSKTKVYLLESYTEVLTGGKLPSLRQVLGLFLHEHKENGKTIREASTIAIESTAKFWQKARIPTRAVQHCQAKLESEFDVWR 530
            STRSKT +YLL S    +TG KLPS+   L LFLH H E  KTIRE+ST  IE   KFWQK RIP + +++CQ KLE  F+ WR
Sbjct:    5 STRSKTDIYLLGSTITEITGSKLPSIGMALSLFLHHHIELNKTIRESSTTTIEEITKFWQKPRIPVQELRNCQPKLEKLFEQWR 88          

HSP 2 Score: 77.7962 bits (190), Expect = 3.010e-34
Identity = 35/58 (60.34%), Postives = 46/58 (79.31%), Query Frame = -3
Query:  106 SRKAETQKAKEAAFCSRLDDLFDIAHADALKNIKIEEDSEFLIAQREKGRRGSMLGLD 279
            +R   TQK+KE  F S+L+++FDIAHA+AL  IKI +D EFL+AQR KG+RGSML +D
Sbjct:   95 NRNTLTQKSKEGEFVSKLNNIFDIAHANALNMIKISQDKEFLLAQRGKGKRGSMLDVD 152          
BLAST of SMED30020758 vs. TrEMBL
Match: A0A4Y2RQT1 (Uncharacterized protein OS=Araneus ventricosus OX=182803 GN=AVEN_265941_1 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.328e-32
Identity = 47/84 (55.95%), Postives = 57/84 (67.86%), Query Frame = -1
Query:  279 STRSKTKVYLLESYTEVLTGGKLPSLRQVLGLFLHEHKENGKTIREASTIAIESTAKFWQKARIPTRAVQHCQAKLESEFDVWR 530
            STRSKT +YLL S    LTG KLPS+   LGLFLH   E  K IRE+ST  IE   KFWQ+ARIP + +++C+ KLE  F+ WR
Sbjct:    5 STRSKTDIYLLGSTITDLTGSKLPSIGMALGLFLHHRIELNKAIRESSTTTIEEITKFWQQARIPVQELRNCRRKLEKLFEQWR 88          

HSP 2 Score: 75.8702 bits (185), Expect = 1.328e-32
Identity = 36/53 (67.92%), Postives = 44/53 (83.02%), Query Frame = -3
Query:  106 TQKAKEAAFCSRLDDLFDIAHADALKNIKIEEDSEFLIAQREKGRRGSMLGLD 264
            TQK+KE  F S+L+++FDIAHA  L  IKI +D EFL+AQREKGRRGSMLG+D
Sbjct:  100 TQKSKEREFVSKLNNIFDIAHA-ILNMIKISQDKEFLLAQREKGRRGSMLGVD 151          
BLAST of SMED30020758 vs. TrEMBL
Match: A0A4Y2JMC4 (Uncharacterized protein OS=Araneus ventricosus OX=182803 GN=AVEN_226597_1 PE=4 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.741e-32
Identity = 48/83 (57.83%), Postives = 57/83 (68.67%), Query Frame = -1
Query:  279 TRSKTKVYLLESYTEVLTGGKLPSLRQVLGLFLHEHKENGKTIREASTIAIESTAKFWQKARIPTRAVQHCQAKLESEFDVWR 527
            +RSKT +YL+ S    LTG KLPS+   LGLFLH H E  KTIRE+ST  IE   KFWQKARIP + + +CQ KLE  F+ WR
Sbjct:    6 SRSKTDIYLIGSTITELTGSKLPSIGMALGLFLHHHIELNKTIRESSTTTIEEI-KFWQKARIPVQELINCQPKLEKLFEQWR 87          

HSP 2 Score: 75.8702 bits (185), Expect = 1.741e-32
Identity = 35/55 (63.64%), Postives = 44/55 (80.00%), Query Frame = -3
Query:  115 SRKAETQKAKEAAFCSRLDDLFDIAHADALKNIKIEEDSEFLIAQREKGRRGSML 279
            +R   TQK+KE  F S+L+++FDIAHA+AL  IKI +D EFL+AQ EKGRRGSML
Sbjct:   94 TRSTLTQKSKEVEFVSKLNNIFDIAHANALNMIKISQDKEFLLAQLEKGRRGSML 148          
BLAST of SMED30020758 vs. Planmine SMEST
Match: SMESG000028508.1 (SMESG000028508.1)

HSP 1 Score: 176.407 bits (446), Expect = 5.468e-86
Identity = 89/94 (94.68%), Postives = 91/94 (96.81%), Query Frame = -3
Query:    1 ASRKAETQKAKEAAFCSRLDDLFDIAHADALKNIKIEEDSEFLIAQREKGRRGSMLGLDVTLTNKEQRASEARDKLAARRHRAVCE*QQLDAKA 282
            ASRKAETQKAKEAAFCSRLDDLFDIAHADA KNIKIEED +FLIAQREKGRRGSMLGLDVTLTNKEQRASEARDKLAARRHRAVC+ QQLDAKA
Sbjct:  578 ASRKAETQKAKEAAFCSRLDDLFDIAHADAHKNIKIEEDRKFLIAQREKGRRGSMLGLDVTLTNKEQRASEARDKLAARRHRAVCDQQQLDAKA 671          

HSP 2 Score: 162.54 bits (410), Expect = 5.468e-86
Identity = 79/89 (88.76%), Postives = 82/89 (92.13%), Query Frame = -1
Query:  279 TFRMYSTRSKTKVYLLESYTEVLTGGKLPSLRQVLGLFLHEHKENGKTIREASTIAIESTAKFWQKARIPTRAVQHCQAKLESEFDVWR 545
            + ++ STRSKTKVYLLESYTEVLTG KLPSL QVLGLFLHEHKENGKTIR ASTIAIESTAKFWQKARIPTRAV HCQAKLESEFD WR
Sbjct:  484 SLKINSTRSKTKVYLLESYTEVLTGRKLPSLLQVLGLFLHEHKENGKTIRVASTIAIESTAKFWQKARIPTRAVHHCQAKLESEFDAWR 572          
BLAST of SMED30020758 vs. Planmine SMEST
Match: SMESG000049843.1 (SMESG000049843.1)

HSP 1 Score: 132.494 bits (332), Expect = 3.009e-31
Identity = 64/99 (64.65%), Postives = 80/99 (80.81%), Query Frame = 3
Query: 1158 IYIFRFT*RSRIMLGEEITARKDEEYYLHIAQGKLKVLNAYGNIWKEIDKLTSWKVRKEIMSKGLLAANDDAFIAVEARRSNAEREVLLAYSEEDSDPR 1454
            +Y+F+ T RSRI L EEI+ + DEEY+LHI +GKL++L+ YGN+WKEID LTSWK+ KEIM+K L AANDD  IAVEARRS+++ EV  AYS EDSD R
Sbjct:  643 VYLFKLTRRSRIRLEEEISMKNDEEYHLHIVKGKLEMLDIYGNVWKEIDTLTSWKLLKEIMAKILRAANDDVLIAVEARRSSSKGEVSCAYSVEDSDSR 741          

HSP 2 Score: 40.0466 bits (92), Expect = 1.943e-11
Identity = 18/24 (75.00%), Postives = 21/24 (87.50%), Query Frame = 3
Query: 1887 ALEDVKLIRKVYRKVEQKWIDDIE 1958
            ALE+VK IRKVY KVE +WIDD+E
Sbjct:  795 ALENVKGIRKVYLKVEHQWIDDVE 818          

HSP 3 Score: 35.8094 bits (81), Expect = 1.943e-11
Identity = 25/40 (62.50%), Postives = 31/40 (77.50%), Query Frame = 1
Query: 1972 NLSRKSSLNEYKTSRASTNKCPESDGERQISEISIEVNET 2091
            N  RK SL+EYKT RAST K PES+ E +I E+S+EVN+T
Sbjct:  823 NPPRKYSLSEYKTMRASTCKDPESEEEYEIVEMSMEVNQT 862          

HSP 4 Score: 32.3426 bits (72), Expect = 1.943e-11
Identity = 16/34 (47.06%), Postives = 19/34 (55.88%), Query Frame = 2
Query: 1760 KYLKIWVDQLFCIRDFAANQGFKSFGVTRK*EWY 1861
            + L I  + L    D A  Q FKSFG+TR  EWY
Sbjct:  741 RLLPISEEMLKTKMDLADAQLFKSFGITRNGEWY 774          
BLAST of SMED30020758 vs. Planmine SMEST
Match: SMESG000020266.1 (SMESG000020266.1)

HSP 1 Score: 94.3597 bits (233), Expect = 2.931e-23
Identity = 45/64 (70.31%), Postives = 54/64 (84.38%), Query Frame = 3
Query: 1218 RKDEEYYLHIAQGKLKVLNAYGNIWKEIDKLTSWKVRKEIMSKGLLAANDDAFIAVEARRSNAE 1409
            RKDEEY+LHI + KLK+LN YGN+W+E+DKLTS K+ KEIM+KGL A NDD  IAVEAR SN+E
Sbjct:    2 RKDEEYHLHIVKRKLKMLNIYGNVWEEVDKLTSLKIGKEIMAKGLRADNDDVLIAVEARISNSE 65          
BLAST of SMED30020758 vs. Planmine SMEST
Match: SMESG000013248.1 (SMESG000013248.1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.504e-21
Identity = 76/152 (50.00%), Postives = 97/152 (63.82%), Query Frame = 3
Query: 1338 MSKGLLAANDDAFIAVEARRSNAEREVLLAYSEEDSDPRXXXXXXXXXXXXXXXXXXXXTIEEIRKKILFVDAEFGVSSALEMTIVH-SKNEF*WNINFGCLFHTQSEVAIFQ*KL------SR*NIQ-----RKNIQNLTRGKILVGHDLN 1757
            M KGL AANDD  IA  ARRSN+E EV  AYS E S PRLLPISE++LK K+ FI KRLTI+EIR+KILF+DAE+G+S A EM  +  +  ++   +       T+ ++  F   +      +  N Q      K+IQNLTRGKIL+GHDL 
Sbjct:    1 MVKGLRAANDDVLIAEIARRSNSEGEVPSAYSVEYSYPRLLPISEEMLKRKLLFIRKRLTIDEIREKILFMDAEYGISEAHEMIQLSVAIMDYYGRVIEDVYITTRIKLQYFNASIHGITERNSPNQQDQYEEMKSIQNLTRGKILIGHDLQ 152          

HSP 2 Score: 37.3502 bits (85), Expect = 1.504e-21
Identity = 16/22 (72.73%), Postives = 18/22 (81.82%), Query Frame = 2
Query: 1754 ELKYLKIWVDQLFCIRDFAANQ 1819
            E KYLKIWV+ L+ IRDFAA Q
Sbjct:  154 ERKYLKIWVNHLYGIRDFAAAQ 175          

HSP 3 Score: 21.557 bits (44), Expect = 1.504e-21
Identity = 6/11 (54.55%), Postives = 11/11 (100.00%), Query Frame = 3
Query: 1926 KVEQKWIDDIE 1958
            ++EQ+WIDD++
Sbjct:  175 QMEQQWIDDVD 185          
BLAST of SMED30020758 vs. Planmine SMEST
Match: SMESG000031866.1 (SMESG000031866.1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.634e-19
Identity = 59/130 (45.38%), Postives = 87/130 (66.92%), Query Frame = 3
Query: 1197 LGEEITARKDEEYYLHIAQGKLKVLNAYGNIWKEIDKLTSWKVRKEIMSKGLLAANDDAFIAVEARRSNAEREVLLAYSEEDSDPRXXXXXXXXXXXXXXXXXXXXTIEEIRKKILFVDAEFGVSSALEM 1586
            L +EI   + E+ Y+HI +  ++VLN    +W E+ KLTSWK+++E ++K + AAN++  IA+E+R  +   EV  A+  E+ D  LLPISE I+K K+SFI K + +EEIR K LFVDAE+G S   +M
Sbjct:  454 LSKEIQISRREKGYVHIMRRTIEVLNGENQLWMELKKLTSWKIQRESVTKTMRAANEEVIIAIESRTESKAHEVPKAHPAENGDSTLLPISEDIVKKKMSFIRKEMGLEEIRDKKLFVDAEYGTSETGKM 583          

HSP 2 Score: 33.4982 bits (75), Expect = 1.634e-19
Identity = 14/36 (38.89%), Postives = 23/36 (63.89%), Query Frame = 1
Query: 1588 PLFIAKMNFNGILTLDVYFTPKVKLQYFNESYHGKT 1695
            PL +A MN++G +  + Y TP  ++++FN   HG T
Sbjct:  585 PLTVAIMNYHGGVVKNTYLTPGRRIRHFNLRVHGIT 620          
The following BLAST results are available for this feature:
BLAST of SMED30020758 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020758 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020758 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020758 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020758 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020758 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020758 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020758 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y2N1V96.354e-3656.67Uncharacterized protein OS=Araneus ventricosus OX=... [more]
A0A4Y2VX653.561e-3558.33Uncharacterized protein OS=Araneus ventricosus OX=... [more]
A0A4Y2QVJ73.010e-3457.14Uncharacterized protein OS=Araneus ventricosus OX=... [more]
A0A4Y2RQT11.328e-3255.95Uncharacterized protein OS=Araneus ventricosus OX=... [more]
A0A4Y2JMC41.741e-3257.83Uncharacterized protein OS=Araneus ventricosus OX=... [more]
back to top
BLAST of SMED30020758 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020758 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020758 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020758 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020758 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020758 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028508.15.468e-8694.68SMESG000028508.1[more]
SMESG000049843.13.009e-3164.65SMESG000049843.1[more]
SMESG000020266.12.931e-2370.31SMESG000020266.1[more]
SMESG000013248.11.504e-2150.00SMESG000013248.1[more]
SMESG000031866.11.634e-1945.38SMESG000031866.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020758 ID=SMED30020758|Name=SMED30020758|organism=Schmidtea mediterranea sexual|type=transcript|length=2663bp
AGCCTTCGCATCCAACTGCTGCTATTCACACACTGCTCGATGCCGTCTAG
CCGCAAGCTTGTCCCTAGCTTCAGATGCTCTTTGCTCTTTATTGGTAAGA
GTTACATCAAGCCCCAGCATACTTCCTCTCCTTCCCTTCTCCCTCTGAGC
TATAAGAAATTCGCTGTCTTCTTCTATCTTTATATTCTTGAGTGCATCGG
CATGGGCGATGTCAAATAAATCATCCAGCCTAGAACAAAATGCCGCTTCC
TTAGCCTTCTGTGTCTCAGCTTTCCTTGACGCCATACATCGAATTCACTC
TCTAGCTTAGCTTGGCAATGCTGAACTGCCCTTGTTGGTATTCTTGCCTT
TTGCCAAAACTTAGCAGTACTTTCAATGGCAATCGTTGATGCCTCTCGTA
TTGTTTTGCCATTCTCTTTGTGTTCATGAAGGAAAAGACCGAGTACCTGC
CGTAATGAAGGCAACTTCCCACCAGTCAAAACCTCTGTATAACTCTCCAG
CAGATACACCTTTGTCTTAGACCTGGTACTGTACATTCTAAAAGTAAGTG
AAGTACAATACAATGTATGTCATGATTTGATTTACAGTGAGAAATTATTT
ATTAATTACTGCTAGCAATCCACTAAGTCCAGTAAAACTGCAACTACAAT
TCACAGTCAGGTTGCCACTATTGCAGTAACAGAAAAACTATTACAATATT
TTCAACCAGAAGCTACACAAAAATGTAAACAATAAGTTAGCAGATAATCA
GTGCATACCTTTAAATAATTACAGTAATAAATACTATTCAGAGCTTTTCT
TAAACGTAAATAACAATTCACTATAACTTCACCAGACAGTTAGTTGCACA
AAATATTGAAGAAGTAGAACAAGAACACCAAAGGCTGGTTCCCACACACT
GAGTAGTAAGTAACAAAATCAGGGATGATTTAAATGATAATCTATTGCTA
AATTTTAAACTCAGCAGTAGTGGGGGTTATGTATTTCACTATTTTTGATA
ATGCGGTCTATTATAAAACTTTGACTTCATTGAGCTACCTCTAAATGTTG
TTCAATTGAGCTCATATTTGGCCTAAATTTTTTTCTTATATATAGGAACA
AAATAAAAGGGTGAGACAGGCACTTTTTGAAAGTTGAAAAATAAGGACCA
CCCTAATATATATATTTTTAGATTCACATAGAGATCCAGAATTATGTTAG
GAGAAGAAATTACAGCGAGGAAGGACGAAGAATATTACTTACACATAGCA
CAAGGAAAATTAAAAGTGTTGAATGCTTACGGAAATATATGGAAGGAAAT
CGACAAATTAACATCGTGGAAGGTTAGAAAAGAAATAATGTCTAAAGGAT
TGCTAGCAGCCAACGATGATGCATTTATTGCTGTAGAAGCAAGAAGATCA
AATGCAGAAAGAGAAGTTCTACTTGCATATTCAGAGGAAGATTCGGATCC
AAGATTACTTCCAATTTCCGAAAAGATACTCAAGAGTAAAATTTCTTTTA
TCTGAAAACGGTTAACTATCGAAGAAATCCGGAAGAAAATATTGTTTGTG
GACGCAGAATTTGGTGTCTCTTCAGCACTTGAGATGACCATTGTTCATAG
CAAAAATGAATTTTAATGGAATATTAACTTTGGATGTTTATTTCACACCC
AAAGTGAAGTTGCAATATTTCAATGAAAGCTATCACGGTAAAACATTCAG
AGGAAAAACATTCAGAATCTCACCAGAGGTAAAATTTTGGTTGGGCATGA
TTTGAACTAAAATATCTAAAAATCTGGGTTGATCAGCTCTTTTGCATAAG
AGATTTCGCTGCTAATCAGGGGTTCAAATCGTTTGGTGTAACACGCAAAT
AAGAATGGTACATGAAATATGTAGAGGAGAAATTGAGCCTTAGAAGATGT
CAAATTAATCAGAAAAGTATATCGCAAAGTCGAACAGAAATGGATAGATG
ACATAGAATAGGATAATAAATAATCTATCAAGAAAAAGCTCACTGAATGA
GTATAAAACAAGTCGAGCCTCGACGAATAAATGTCCAGAGAGTGATGGTG
AACGTCAAATAAGTGAAATATCCATTGAGGTGAATGAAACGCACATCAAC
TAAAATGGACAAACGAAGAAATAATCAAAATCACTTGCTTTATCGATTTT
AGGGAAAAGTGCAGATATATCTAACTGATTATTTATTCGGGTAAAATTAA
TTTATGATTATACTACCGAATAATCCAGCTATTTCAATGTTACTATAACT
GGAGGTAACCCTTGGTGACTTGGTCAAAACTTAAAATTTTTAAAAATACT
ATATCATTGCGTAAAATAATGTAATCTCTGAATCCCAAAATGCCTTATTT
TGTTATTTTTGCTTAAGTAAACATAAAAATCATTGATAATACAAAACTTT
ATAATTATATATCAGAATGATGTCATGTCCTGGTACTCATTTCTTAAACA
AACAACAAAATCCTTTTGAATATTCGAACTTTGTTGGAATGCGCATTTGT
TGTCTATGTCTCGTAGCGGTATGGAATTTTACTGTACATCGTTAGTTGTT
TCATAATTGTGTTGTCTCACTCTTTTACAGCTTTACCTGAGTGCACCCCA
TCCATTTTAGTTCAGTGCCACCATAACCTTATAAACACACAATATTCAGA
ATCATTTTACCTT
back to top

protein sequence of SMED30020758-orf-1

>SMED30020758-orf-1 ID=SMED30020758-orf-1|Name=SMED30020758-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=104bp
MLGEEITARKDEEYYLHIAQGKLKVLNAYGNIWKEIDKLTSWKVRKEIMS
KGLLAANDDAFIAVEARRSNAEREVLLAYSEEDSDPRLLPISEKILKSKI
SFI*
back to top

protein sequence of SMED30020758-orf-2

>SMED30020758-orf-2 ID=SMED30020758-orf-2|Name=SMED30020758-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=119bp
MYSTRSKTKVYLLESYTEVLTGGKLPSLRQVLGLFLHEHKENGKTIREAS
TIAIESTAKFWQKARIPTRAVQHCQAKLESEFDVWRQGKLRHRRLRKRHF
VLGWMIYLTSPMPMHSRI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
PLANA:0002111X2 cell