60S acidic ribosomal protein P2

Overview
Name60S acidic ribosomal protein P2
Smed IDSMED30020749
Length (bp)415
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 60S acidic ribosomal protein P2 (SMED30020749) t-SNE clustered cells

Violin plots show distribution of expression levels for 60S acidic ribosomal protein P2 (SMED30020749) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 60S acidic ribosomal protein P2 (SMED30020749) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 60S acidic ribosomal protein P2 (SMED30020749) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020749

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30020749SMESG000057890.1 SmedASXL_018702SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30020749SMESG000057890.1 dd_Smed_v4_556_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30020749SMESG000057890.1 dd_Smed_v4_556_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30020749SMESG000057890.1 dd_Smed_v4_556_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30020749SMESG000057890.1 dd_Smed_v4_556_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020749SMESG000057890.1 dd_Smed_v4_556_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020749SMESG000057890.1 dd_Smed_v4_556_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30020749SMESG000057890.1 dd_Smed_v4_556_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020749SMESG000057890.1 dd_Smed_v4_556_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30020749SMESG000057890.1 dd_Smed_v4_556_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020749SMESG000057890.1 dd_Smed_v4_556_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30020749SMESG000057890.1 dd_Smed_v4_556_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30020749SMESG000057890.1 dd_Smed_v4_556_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
progenitor cellSMED30020749SMESG000057890.1 dd_Smed_v6_556_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020749SMESG000057890.1 dd_Smed_v6_556_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Human
Match: RPLP2 (ribosomal protein lateral stalk subunit P2 [Source:HGNC Symbol;Acc:HGNC:10377])

HSP 1 Score: 50.8322 bits (120), Expect = 1.564e-8
Identity = 24/62 (38.71%), Postives = 40/62 (64.52%), Query Frame = 2
Query:   56 MRYIAAYMLCLL-NEKTPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            MRY+A+Y+L  L    +P   DI+ IL SVG+E D + + ++ + +  K+I+ +I+ GI KL
Sbjct:    1 MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Human
Match: RPLP2 (ribosomal protein lateral stalk subunit P2 [Source:HGNC Symbol;Acc:HGNC:10377])

HSP 1 Score: 50.8322 bits (120), Expect = 1.564e-8
Identity = 24/62 (38.71%), Postives = 40/62 (64.52%), Query Frame = 2
Query:   56 MRYIAAYMLCLL-NEKTPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            MRY+A+Y+L  L    +P   DI+ IL SVG+E D + + ++ + +  K+I+ +I+ GI KL
Sbjct:    1 MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Celegans
Match: rla-2 (Ribosomal protein, Large subunit, Acidic (P1) [Source:UniProtKB/TrEMBL;Acc:Q9U1X9])

HSP 1 Score: 46.595 bits (109), Expect = 2.013e-7
Identity = 23/62 (37.10%), Postives = 39/62 (62.90%), Query Frame = 2
Query:   56 MRYIAAYMLCLLN-EKTPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            MRY++AY+L +L     PK  D++NILS+VGV+ D      + + +  K+++ LI+ G + L
Sbjct:    1 MRYVSAYLLAVLGGNANPKVDDLKNILSAVGVDADAETAKLVVSRLAGKTVEELIAEGSAGL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Celegans
Match: rla-2 (Ribosomal protein, Large subunit, Acidic (P1) [Source:UniProtKB/TrEMBL;Acc:Q9U1X9])

HSP 1 Score: 46.595 bits (109), Expect = 2.013e-7
Identity = 23/62 (37.10%), Postives = 39/62 (62.90%), Query Frame = 2
Query:   56 MRYIAAYMLCLLN-EKTPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            MRY++AY+L +L     PK  D++NILS+VGV+ D      + + +  K+++ LI+ G + L
Sbjct:    1 MRYVSAYLLAVLGGNANPKVDDLKNILSAVGVDADAETAKLVVSRLAGKTVEELIAEGSAGL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Fly
Match: RpLP2 (gene:FBgn0003274 transcript:FBtr0087105)

HSP 1 Score: 60.4622 bits (145), Expect = 1.402e-12
Identity = 32/62 (51.61%), Postives = 41/62 (66.13%), Query Frame = 2
Query:   56 MRYIAAYMLCLLNEK-TPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            MRY+AAY+L +L  K +P  SD+E ILSSVGVE D   +T++   +  KSID LI  G  KL
Sbjct:    1 MRYVAAYLLAVLGGKDSPANSDLEKILSSVGVEVDAERLTKVIKELAGKSIDDLIKEGREKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Zebrafish
Match: rplp2 (ribosomal protein, large P2 [Source:ZFIN;Acc:ZDB-GENE-031018-2])

HSP 1 Score: 56.6102 bits (135), Expect = 5.538e-11
Identity = 27/62 (43.55%), Postives = 42/62 (67.74%), Query Frame = 2
Query:   56 MRYIAAYMLCLLNEKT-PKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            MRY+AAY+L +L   T P   DI+NIL SVG+E D   + ++ + +  K I+ +++AG+SKL
Sbjct:    1 MRYVAAYLLAVLGGNTNPSAKDIKNILGSVGIEADDERLNKVVSELNGKDINEVMNAGLSKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Zebrafish
Match: rplp2l (ribosomal protein, large P2, like [Source:ZFIN;Acc:ZDB-GENE-070327-2])

HSP 1 Score: 51.2174 bits (121), Expect = 8.589e-9
Identity = 25/62 (40.32%), Postives = 40/62 (64.52%), Query Frame = 2
Query:   56 MRYIAAYMLCLLNEK-TPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            MRY+AAY+L  L  K +P   DI+ IL SVG+E D   ++++   +  K+++ +I+ G SKL
Sbjct:    1 MRYVAAYLLAALGGKDSPSTGDIKKILESVGIEADDVRMSKVVAELNGKNVEEVIAQGFSKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Zebrafish
Match: rplp2l (ribosomal protein, large P2, like [Source:ZFIN;Acc:ZDB-GENE-070327-2])

HSP 1 Score: 51.2174 bits (121), Expect = 8.589e-9
Identity = 25/62 (40.32%), Postives = 40/62 (64.52%), Query Frame = 2
Query:   56 MRYIAAYMLCLLNEK-TPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            MRY+AAY+L  L  K +P   DI+ IL SVG+E D   ++++   +  K+++ +I+ G SKL
Sbjct:    1 MRYVAAYLLAALGGKDSPSTGDIKKILESVGIEADDVRMSKVVAELNGKNVEEVIAQGFSKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Xenopus
Match: rplp2 (ribosomal protein lateral stalk subunit P2 [Source:NCBI gene;Acc:549399])

HSP 1 Score: 55.4546 bits (132), Expect = 2.886e-10
Identity = 27/62 (43.55%), Postives = 42/62 (67.74%), Query Frame = 2
Query:   56 MRYIAAYMLCLLN-EKTPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            MRY+AAY+L +L   ++P  +D+  ILSSVG+E D+    ++   +K KSID +I+ G +KL
Sbjct:    1 MRYVAAYLLAVLGGTESPSIADLTKILSSVGIETDQQRAEKVVKELKGKSIDEVIAQGNTKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Xenopus
Match: RPLP2 (uncharacterized loc100135138 [Source:NCBI gene;Acc:100135138])

HSP 1 Score: 53.5286 bits (127), Expect = 1.387e-9
Identity = 24/62 (38.71%), Postives = 44/62 (70.97%), Query Frame = 2
Query:   56 MRYIAAYMLCLLNEKT-PKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            MRY+AAY+L +L  KT P  +DI++IL SVG++ D   V ++ + +  K ++ ++++G++KL
Sbjct:    1 MRYVAAYLLAVLGGKTSPSANDIKSILKSVGIDADDERVKKVISELSGKDLEDVVNSGLAKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Mouse
Match: AC124742.1 (ribosomal protein, large P2 (Rplp2), retrogene)

HSP 1 Score: 50.8322 bits (120), Expect = 1.231e-8
Identity = 23/62 (37.10%), Postives = 40/62 (64.52%), Query Frame = 2
Query:   56 MRYIAAYMLCLL-NEKTPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            MRY+A+Y+L  L    +P   DI+ IL SVG+E D + + ++ + +  K+I+ +I+ G+ KL
Sbjct:    1 MRYVASYLLAALGGNSSPSAKDIKKILGSVGIEADDDRLNKVISELNGKNIEDVIAQGVGKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Mouse
Match: Rplp2 (ribosomal protein, large P2 [Source:MGI Symbol;Acc:MGI:1914436])

HSP 1 Score: 50.447 bits (119), Expect = 1.689e-8
Identity = 23/62 (37.10%), Postives = 40/62 (64.52%), Query Frame = 2
Query:   56 MRYIAAYMLCLL-NEKTPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            MRY+A+Y+L  L    +P   DI+ IL SVG+E D + + ++ + +  K+I+ +I+ G+ KL
Sbjct:    1 MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGVGKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Mouse
Match: Rplp2 (ribosomal protein, large P2 [Source:MGI Symbol;Acc:MGI:1914436])

HSP 1 Score: 50.447 bits (119), Expect = 1.689e-8
Identity = 23/62 (37.10%), Postives = 40/62 (64.52%), Query Frame = 2
Query:   56 MRYIAAYMLCLL-NEKTPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            MRY+A+Y+L  L    +P   DI+ IL SVG+E D + + ++ + +  K+I+ +I+ G+ KL
Sbjct:    1 MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGVGKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Mouse
Match: Rplp2 (ribosomal protein, large P2 [Source:MGI Symbol;Acc:MGI:1914436])

HSP 1 Score: 50.447 bits (119), Expect = 1.689e-8
Identity = 23/62 (37.10%), Postives = 40/62 (64.52%), Query Frame = 2
Query:   56 MRYIAAYMLCLL-NEKTPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            MRY+A+Y+L  L    +P   DI+ IL SVG+E D + + ++ + +  K+I+ +I+ G+ KL
Sbjct:    1 MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGVGKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. UniProt/SwissProt
Match: sp|P05389|RLA2_DROME (60S acidic ribosomal protein P2 OS=Drosophila melanogaster OX=7227 GN=RpLP2 PE=1 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.405e-11
Identity = 32/62 (51.61%), Postives = 41/62 (66.13%), Query Frame = 2
Query:   56 MRYIAAYMLCLLNEK-TPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            MRY+AAY+L +L  K +P  SD+E ILSSVGVE D   +T++   +  KSID LI  G  KL
Sbjct:    1 MRYVAAYLLAVLGGKDSPANSDLEKILSSVGVEVDAERLTKVIKELAGKSIDDLIKEGREKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. UniProt/SwissProt
Match: sp|O61463|RLA2_CRYST (60S acidic ribosomal protein P2 OS=Cryptochiton stelleri OX=6655 PE=3 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 3.860e-11
Identity = 31/63 (49.21%), Postives = 45/63 (71.43%), Query Frame = 2
Query:   56 MRYIAAYMLCLL--NEKTPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            MRY+AAYML  L  NEK P  SD++ IL SVG+E +K+ +T++ N +K K++D +I+ G  KL
Sbjct:    1 MRYVAAYMLATLGGNEK-PSESDLKKILDSVGIEVEKDQLTKVINELKGKNLDEVIAEGEKKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. UniProt/SwissProt
Match: sp|P02399|RLA2_ARTSA (60S acidic ribosomal protein P2 OS=Artemia salina OX=85549 PE=1 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 9.785e-11
Identity = 28/62 (45.16%), Postives = 44/62 (70.97%), Query Frame = 2
Query:   56 MRYIAAYMLCLLNEKT-PKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            MRY+AAY+L  L+    P  +DIE ILSSVG+EC+ + + ++ N +K K +++LI+ G +KL
Sbjct:    1 MRYVAAYLLAALSGNADPSTADIEKILSSVGIECNPSQLQKVMNELKGKDLEALIAEGQTKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. UniProt/SwissProt
Match: sp|Q06383|RLA2_LEIIN (60S acidic ribosomal protein P2-1 OS=Leishmania infantum OX=5671 GN=LIP PE=2 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 2.567e-10
Identity = 24/61 (39.34%), Postives = 40/61 (65.57%), Query Frame = 2
Query:   56 MRYIAAYMLCLLNEKTPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            M+Y+AAY L  L+ KTP  +D++ +L + GV  D + V  +F  ++ KS D+L++ G +KL
Sbjct:    1 MQYLAAYALVALSGKTPSKADVQAVLKAAGVAVDASRVDAVFQEVEGKSFDALVAEGRTKL 61          
BLAST of 60S acidic ribosomal protein P2 vs. UniProt/SwissProt
Match: sp|P08094|RLA2_SCHPO (60S acidic ribosomal protein P2-alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpp201 PE=1 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 6.111e-10
Identity = 28/62 (45.16%), Postives = 41/62 (66.13%), Query Frame = 2
Query:   56 MRYIAAYMLCLLNEK-TPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            M+Y+AAY+L  +  K +P  SDIE++LS+VG+E +   +  L N +  K ID LI+AG  KL
Sbjct:    1 MKYLAAYLLLTVGGKDSPSASDIESVLSTVGIEAESERIETLINELNGKDIDELIAAGNEKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. TrEMBL
Match: A0A182Q3T5 (Uncharacterized protein OS=Anopheles farauti OX=69004 PE=3 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 8.852e-12
Identity = 34/62 (54.84%), Postives = 45/62 (72.58%), Query Frame = 2
Query:   56 MRYIAAYMLCLLN-EKTPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            MRY+AAY+L +L    TP  SDIE ILSSVG+E D   VT++ N +K+KSI+ LI++G  KL
Sbjct:    1 MRYVAAYLLAVLGGNATPSNSDIEKILSSVGIEADSTRVTKVVNELKDKSIEELIASGREKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. TrEMBL
Match: A0A024US91 (Uncharacterized protein OS=Aphanomyces invadans OX=157072 GN=DYB32_003539 PE=3 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 9.544e-12
Identity = 31/61 (50.82%), Postives = 44/61 (72.13%), Query Frame = 2
Query:   56 MRYIAAYMLCLLNEKTPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            MRY+AAY+L  L ++  KP+D++N+L S GVE D   + +LF  I +KSID +I+AG SKL
Sbjct:    1 MRYVAAYLLVALAKEDVKPADVKNVLKSAGVEVDAERLEKLFEDIADKSIDEIIAAGSSKL 61          
BLAST of 60S acidic ribosomal protein P2 vs. TrEMBL
Match: A2I3Z6 (Ribosomal protein P2-like protein OS=Maconellicoccus hirsutus OX=177089 PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 1.878e-11
Identity = 29/61 (47.54%), Postives = 43/61 (70.49%), Query Frame = 2
Query:   56 MRYIAAYMLCLLNEKTPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            MRY+AAYML  L  K P+ +DIE ILSSVG+E D + + ++   +K K++D L+++G  KL
Sbjct:    1 MRYVAAYMLSALTGKEPQSADIERILSSVGIEADNDKIQKVIKELKGKNVDELVASGRGKL 61          
BLAST of 60S acidic ribosomal protein P2 vs. TrEMBL
Match: A0A0K8TQF0 (Putative 60s acidic ribosomal protein p2 OS=Tabanus bromius OX=304241 PE=2 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 2.670e-11
Identity = 33/62 (53.23%), Postives = 46/62 (74.19%), Query Frame = 2
Query:   56 MRYIAAYMLCLLNEK-TPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            MRY+AAYML +L  K +P PSDIE ILSSVG+E DK  ++++ + +K K+I+ LI+ G  KL
Sbjct:    1 MRYVAAYMLAVLGGKDSPAPSDIEKILSSVGIEADKERLSKVCDELKGKNIEELIAQGREKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. TrEMBL
Match: A0A182U088 (Uncharacterized protein OS=Anopheles melas OX=34690 PE=3 SV=2)

HSP 1 Score: 65.855 bits (159), Expect = 3.240e-11
Identity = 52/112 (46.43%), Postives = 73/112 (65.18%), Query Frame = 2
Query:   56 MRYIAAYMLCLLN-EKTPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKLXXXXXXXXXXXXXXXXXXXXXXXXTKVXXXXXXXXXXXXXXXDMGFGLFD 388
            MRY+AAY+L +L    +P  SDIE ILSSVG+E D   VT++ N +K+KSI+ LI++G  KL+++PAGG A A + A    G       E+ + +KE S   + DMGFGLF+
Sbjct:    1 MRYVAAYLLAVLGGNASPSNSDIEKILSSVGIEADSTRVTKVVNELKDKSIEELIASGREKLSSMPAGGGAAAAAPAAAGGGGGAAPAAEKKEEKKEESESEDDDMGFGLFE 112          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Cavefish
Match: rplp2 (60S acidic ribosomal protein P2-like [Source:NCBI gene;Acc:103029731])

HSP 1 Score: 53.5286 bits (127), Expect = 7.181e-10
Identity = 26/62 (41.94%), Postives = 41/62 (66.13%), Query Frame = 2
Query:   56 MRYIAAYMLCLLNEKT-PKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            MRY+AAY+L +L   T P   DI+NIL SVG+E     + ++ + +  K I+ +++AG+SKL
Sbjct:    1 MRYVAAYLLAVLGGNTSPSAKDIKNILGSVGIEASDERLNKVVSELNGKDINEVMNAGLSKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Cavefish
Match: rplp2l (ribosomal protein, large P2, like [Source:ZFIN;Acc:ZDB-GENE-070327-2])

HSP 1 Score: 44.2838 bits (103), Expect = 2.319e-6
Identity = 50/112 (44.64%), Postives = 72/112 (64.29%), Query Frame = 2
Query:   56 MRYIAAYMLCLLNEK-TPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKLXXXXXXXXXXXXXXXXXXXXXXXXTKVXXXXXXXXXXXXXXXDMGFGLFD 388
            MRY+AAY+L  L+ K  P  +DI+ IL SVG+E D+  + ++ + +  K ++ +I A   KLA+VP+GGA    S+A  AAG A     E+ + +KE S ES+ DMGFGLFD
Sbjct:    1 MRYVAAYLLAALSGKDNPSSNDIKKILESVGIEVDETRMGKVVSELNGKKVEDVI-AQYGKLASVPSGGAVAVASSAAPAAGGAAAPAEEKKEEKKEESEESDDDMGFGLFD 111          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Sea Lamprey
Match: rplp2 (ribosomal protein, large P2 [Source:ZFIN;Acc:ZDB-GENE-031018-2])

HSP 1 Score: 55.0694 bits (131), Expect = 4.538e-11
Identity = 27/64 (42.19%), Postives = 46/64 (71.88%), Query Frame = 2
Query:   53 KMRYIAAYMLCLL--NEKTPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            +MRY+AAY+L  L  NE+ P   DI+ IL SVG+E D + ++++ + +K K+++ +ISAG +K+
Sbjct:    2 RMRYVAAYLLATLGGNEQ-PTAIDIKKILGSVGIEADDSKLSKVISELKGKNVEEVISAGFTKI 64          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Nematostella
Match: EDO47503 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLY2])

HSP 1 Score: 57.7658 bits (138), Expect = 7.539e-12
Identity = 29/62 (46.77%), Postives = 40/62 (64.52%), Query Frame = 2
Query:   56 MRYIAAYMLCLL-NEKTPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            MRY+AAY+L  L N K P   DI+ IL SVG+E D   + ++ + +  KS+D +I AG SKL
Sbjct:    1 MRYVAAYLLATLGNNKNPSAKDIKGILDSVGIESDMERLNKVISELSGKSVDEIIQAGKSKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Medaka
Match: lin7c (60S acidic ribosomal protein P2 [Source:NCBI gene;Acc:101168608])

HSP 1 Score: 54.6842 bits (130), Expect = 3.363e-10
Identity = 26/62 (41.94%), Postives = 41/62 (66.13%), Query Frame = 2
Query:   56 MRYIAAYMLCLLN-EKTPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            MRY+AAY+L  L     P+  DI+ IL SVG+E D   + ++ + +K K+++ +I+AG SKL
Sbjct:    1 MRYVAAYLLAALGGNGNPEAGDIKKILDSVGIEADSERLGKVLSELKGKNVEEVIAAGYSKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Medaka
Match: lin7c (60S acidic ribosomal protein P2 [Source:NCBI gene;Acc:101168608])

HSP 1 Score: 56.9954 bits (136), Expect = 3.621e-10
Identity = 26/64 (40.62%), Postives = 43/64 (67.19%), Query Frame = 2
Query:   50 IKMRYIAAYMLCLLN-EKTPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            ++MRY+AAY+L  L     P+  DI+ IL SVG+E D   + ++ + +K K+++ +I+AG SKL
Sbjct:  171 VRMRYVAAYLLAALGGNGNPEAGDIKKILDSVGIEADSERLGKVLSELKGKNVEEVIAAGYSKL 234          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Medaka
Match: lin7c (60S acidic ribosomal protein P2 [Source:NCBI gene;Acc:101168608])

HSP 1 Score: 54.6842 bits (130), Expect = 4.053e-10
Identity = 27/64 (42.19%), Postives = 42/64 (65.62%), Query Frame = 2
Query:   50 IKMRYIAAYMLCLLN-EKTPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            I MRY+AAY+L  L     P+  DI+ IL SVG+E D   + ++ + +K K+++ +I+AG SKL
Sbjct:   16 ITMRYVAAYLLAALGGNGNPEAGDIKKILDSVGIEADSERLGKVLSELKGKNVEEVIAAGYSKL 79          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Medaka
Match: rplp2 (60S acidic ribosomal protein P2 [Source:NCBI gene;Acc:101170669])

HSP 1 Score: 53.9138 bits (128), Expect = 5.478e-10
Identity = 25/62 (40.32%), Postives = 41/62 (66.13%), Query Frame = 2
Query:   56 MRYIAAYMLCLLNEKT-PKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            MRY+AAY+L  L   T P   DI++IL SVG+E D   + ++   +  K+I+ ++++G+SKL
Sbjct:    1 MRYVAAYLLAALGGNTSPSAKDIKDILGSVGIEADDERLNKVIGELNGKNINEVVNSGLSKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Medaka
Match: rplp2 (60S acidic ribosomal protein P2 [Source:NCBI gene;Acc:101170669])

HSP 1 Score: 53.9138 bits (128), Expect = 5.478e-10
Identity = 25/62 (40.32%), Postives = 41/62 (66.13%), Query Frame = 2
Query:   56 MRYIAAYMLCLLNEKT-PKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKL 238
            MRY+AAY+L  L   T P   DI++IL SVG+E D   + ++   +  K+I+ ++++G+SKL
Sbjct:    1 MRYVAAYLLAALGGNTSPSAKDIKDILGSVGIEADDERLNKVIGELNGKNINEVVNSGLSKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Planmine SMEST
Match: SMESG000057890.1 (SMESG000057890.1)

HSP 1 Score: 132.109 bits (331), Expect = 1.143e-40
Identity = 111/111 (100.00%), Postives = 111/111 (100.00%), Query Frame = 2
Query:   56 MRYIAAYMLCLLNEKTPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKLXXXXXXXXXXXXXXXXXXXXXXXXTKVXXXXXXXXXXXXXXXDMGFGLFD 388
            MRYIAAYMLCLLNEKTPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKLATVPAGGAAVAPSAAPLAAGAAQVTKVEEAKAEKESSSESEADMGFGLFD
Sbjct:    1 MRYIAAYMLCLLNEKTPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKLATVPAGGAAVAPSAAPLAAGAAQVTKVEEAKAEKESSSESEADMGFGLFD 111          
BLAST of 60S acidic ribosomal protein P2 vs. Planmine SMEST
Match: SMESG000057890.1 (SMESG000057890.1)

HSP 1 Score: 114.39 bits (285), Expect = 8.611e-34
Identity = 104/104 (100.00%), Postives = 104/104 (100.00%), Query Frame = 2
Query:   77 MLCLLNEKTPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKLXXXXXXXXXXXXXXXXXXXXXXXXTKVXXXXXXXXXXXXXXXDMGFGLFD 388
            MLCLLNEKTPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKLATVPAGGAAVAPSAAPLAAGAAQVTKVEEAKAEKESSSESEADMGFGLFD
Sbjct:    1 MLCLLNEKTPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKLATVPAGGAAVAPSAAPLAAGAAQVTKVEEAKAEKESSSESEADMGFGLFD 104          
BLAST of 60S acidic ribosomal protein P2 vs. Planmine SMEST
Match: SMESG000009232.1 (SMESG000009232.1)

HSP 1 Score: 54.299 bits (129), Expect = 3.273e-10
Identity = 49/112 (43.75%), Postives = 71/112 (63.39%), Query Frame = 2
Query:   56 MRYIAAYMLCLLNEKT-PKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKLXXXXXXXXXXXXXXXXXXXXXXXXTKVXXXXXXXXXXXXXXXDMGFGLFD 388
            MRY+++Y+L +L     P+  DI  IL++VG+ECD N   E   AI  + ++ LIS G+ K+++VP GGA  AP+AA  +A A    +  +A A++ SS   E DMGFGLFD
Sbjct:    1 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKISSVPTGGAGAAPTAATSSAPAPAAKEEVKAAAKESSSESEEGDMGFGLFD 112          
The following BLAST results are available for this feature:
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RPLP21.564e-838.71ribosomal protein lateral stalk subunit P2 [Source... [more]
RPLP21.564e-838.71ribosomal protein lateral stalk subunit P2 [Source... [more]
back to top
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rla-22.013e-737.10Ribosomal protein, Large subunit, Acidic (P1) [So... [more]
rla-22.013e-737.10Ribosomal protein, Large subunit, Acidic (P1) [So... [more]
back to top
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RpLP21.402e-1251.61gene:FBgn0003274 transcript:FBtr0087105[more]
back to top
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rplp25.538e-1143.55ribosomal protein, large P2 [Source:ZFIN;Acc:ZDB-G... [more]
rplp2l8.589e-940.32ribosomal protein, large P2, like [Source:ZFIN;Acc... [more]
rplp2l8.589e-940.32ribosomal protein, large P2, like [Source:ZFIN;Acc... [more]
back to top
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rplp22.886e-1043.55ribosomal protein lateral stalk subunit P2 [Source... [more]
RPLP21.387e-938.71uncharacterized loc100135138 [Source:NCBI gene;Acc... [more]
back to top
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
AC124742.11.231e-837.10ribosomal protein, large P2 (Rplp2), retrogene[more]
Rplp21.689e-837.10ribosomal protein, large P2 [Source:MGI Symbol;Acc... [more]
Rplp21.689e-837.10ribosomal protein, large P2 [Source:MGI Symbol;Acc... [more]
Rplp21.689e-837.10ribosomal protein, large P2 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of 60S acidic ribosomal protein P2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P05389|RLA2_DROME1.405e-1151.6160S acidic ribosomal protein P2 OS=Drosophila mela... [more]
sp|O61463|RLA2_CRYST3.860e-1149.2160S acidic ribosomal protein P2 OS=Cryptochiton st... [more]
sp|P02399|RLA2_ARTSA9.785e-1145.1660S acidic ribosomal protein P2 OS=Artemia salina ... [more]
sp|Q06383|RLA2_LEIIN2.567e-1039.3460S acidic ribosomal protein P2-1 OS=Leishmania in... [more]
sp|P08094|RLA2_SCHPO6.111e-1045.1660S acidic ribosomal protein P2-alpha OS=Schizosac... [more]
back to top
BLAST of 60S acidic ribosomal protein P2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A182Q3T58.852e-1254.84Uncharacterized protein OS=Anopheles farauti OX=69... [more]
A0A024US919.544e-1250.82Uncharacterized protein OS=Aphanomyces invadans OX... [more]
A2I3Z61.878e-1147.54Ribosomal protein P2-like protein OS=Maconellicocc... [more]
A0A0K8TQF02.670e-1153.23Putative 60s acidic ribosomal protein p2 OS=Tabanu... [more]
A0A182U0883.240e-1146.43Uncharacterized protein OS=Anopheles melas OX=3469... [more]
back to top
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rplp27.181e-1041.9460S acidic ribosomal protein P2-like [Source:NCBI ... [more]
rplp2l2.319e-644.64ribosomal protein, large P2, like [Source:ZFIN;Acc... [more]
back to top
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rplp24.538e-1142.19ribosomal protein, large P2 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO475037.539e-1246.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin7c3.363e-1041.9460S acidic ribosomal protein P2 [Source:NCBI gene;... [more]
lin7c3.621e-1040.6360S acidic ribosomal protein P2 [Source:NCBI gene;... [more]
lin7c4.053e-1042.1960S acidic ribosomal protein P2 [Source:NCBI gene;... [more]
rplp25.478e-1040.3260S acidic ribosomal protein P2 [Source:NCBI gene;... [more]
rplp25.478e-1040.3260S acidic ribosomal protein P2 [Source:NCBI gene;... [more]
back to top
BLAST of 60S acidic ribosomal protein P2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000057890.11.143e-40100.00SMESG000057890.1[more]
SMESG000057890.18.611e-34100.00SMESG000057890.1[more]
SMESG000009232.13.273e-1043.75SMESG000009232.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020749 ID=SMED30020749|Name=60S acidic ribosomal protein P2|organism=Schmidtea mediterranea sexual|type=transcript|length=415bp
AATATTTAAAACGGTATTAGTTAATTTTTTTCAAATTTTTATTTATTAAA
TAAAAATGAGATATATTGCTGCTTATATGTTATGTCTTTTAAATGAAAAG
ACACCAAAACCCAGTGACATTGAAAATATTTTAAGCAGTGTCGGTGTTGA
ATGCGACAAAAATGCTGTTACTGAACTCTTTAATGCCATTAAAGAAAAAT
CAATTGATAGTTTAATCAGTGCAGGTATTTCTAAATTAGCAACTGTTCCC
GCTGGTGGTGCCGCAGTCGCTCCATCTGCTGCTCCTTTAGCCGCAGGTGC
TGCTCAAGTCACAAAAGTTGAGGAAGCTAAAGCTGAAAAGGAATCATCAT
CAGAAAGCGAAGCTGATATGGGCTTCGGTCTCTTTGATTAAGCTTGAAAA
TATAATTTTTGGAAA
back to top

protein sequence of SMED30020749-orf-1

>SMED30020749-orf-1 ID=SMED30020749-orf-1|Name=SMED30020749-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=112bp
MRYIAAYMLCLLNEKTPKPSDIENILSSVGVECDKNAVTELFNAIKEKSI
DSLISAGISKLATVPAGGAAVAPSAAPLAAGAAQVTKVEEAKAEKESSSE
SEADMGFGLFD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005622intracellular
GO:0005840ribosome
GO:0030529intracellular ribonucleoprotein complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000120progenitor cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR038716P1/P2_N_sf
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: biological process
TermDefinition
GO:0006414translational elongation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR038716Ribosomal protein P1/P2, N-terminal domainGENE3DG3DSA:1.10.10.1410coord: 1..59
e-value: 2.4E-17
score: 64.8
NoneNo IPR availablePFAMPF00428Ribosomal_60scoord: 17..110
e-value: 7.8E-19
score: 68.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 90..111
NoneNo IPR availablePANTHERPTHR2114160S ACIDIC RIBOSOMAL PROTEIN FAMILY MEMBERcoord: 1..111
NoneNo IPR availablePANTHERPTHR21141:SF560S ACIDIC RIBOSOMAL PROTEIN P2coord: 1..111
NoneNo IPR availableCDDcd05833Ribosomal_P2coord: 1..65
e-value: 2.69507E-22
score: 81.926