Anoctamin

Overview
NameAnoctamin
Smed IDSMED30020746
Length (bp)233
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020746

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30020746h1SMcG0015379 dd_Smed_v4_19947_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30020746h1SMcG0015379 dd_Smed_v4_19189_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020746h1SMcG0015379 dd_Smed_v4_19189_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30020746h1SMcG0015379 dd_Smed_v4_19189_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30020746h1SMcG0015379 dd_Smed_v6_19947_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30020746h1SMcG0015379 dd_Smed_v6_19189_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Anoctamin vs. Ensembl Human
Match: ANO7 (anoctamin 7 [Source:HGNC Symbol;Acc:HGNC:31677])

HSP 1 Score: 68.5514 bits (166), Expect = 1.578e-15
Identity = 33/73 (45.21%), Postives = 46/73 (63.01%), Query Frame = 2
Query:   23 QNFCRKLIYKYRYDDQLRGYVNFTLSWAPN---GSLTEPCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
             +F  +  Y++     LRG++NFTL+ AP+    +    CRYRA RD+ G Y+  YW LLA+R  FVI+FEHV
Sbjct:  101 SDFLPRAYYRWTRAHDLRGFLNFTLARAPSSFAAAHNRTCRYRAFRDDDGHYSQTYWNLLAIRLAFVIVFEHV 173          
BLAST of Anoctamin vs. Ensembl Human
Match: ANO7 (anoctamin 7 [Source:HGNC Symbol;Acc:HGNC:31677])

HSP 1 Score: 68.5514 bits (166), Expect = 9.765e-15
Identity = 33/73 (45.21%), Postives = 46/73 (63.01%), Query Frame = 2
Query:   23 QNFCRKLIYKYRYDDQLRGYVNFTLSWAPN---GSLTEPCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
             +F  +  Y++     LRG++NFTL+ AP+    +    CRYRA RD+ G Y+  YW LLA+R  FVI+FEHV
Sbjct:  788 SDFLPRAYYRWTRAHDLRGFLNFTLARAPSSFAAAHNRTCRYRAFRDDDGHYSQTYWNLLAIRLAFVIVFEHV 860          
BLAST of Anoctamin vs. Ensembl Human
Match: ANO7 (anoctamin 7 [Source:HGNC Symbol;Acc:HGNC:31677])

HSP 1 Score: 63.5438 bits (153), Expect = 4.877e-13
Identity = 31/71 (43.66%), Postives = 44/71 (61.97%), Query Frame = 2
Query:   23 QNFCRKLIYKYRYDDQLRGYVNFTLSWAPN---GSLTEPCRYRALRDEYGSYTIIYWQLLALRFGFVIIFE 226
             +F  +  Y++     LRG++NFTL+ AP+    +    CRYRA RD+ G Y+  YW LLA+R  FVI+FE
Sbjct:  787 SDFLPRAYYRWTRAHDLRGFLNFTLARAPSSFAAAHNRTCRYRAFRDDDGHYSQTYWNLLAIRLAFVIVFE 857          
BLAST of Anoctamin vs. Ensembl Human
Match: ANO9 (anoctamin 9 [Source:HGNC Symbol;Acc:HGNC:20679])

HSP 1 Score: 50.447 bits (119), Expect = 2.328e-8
Identity = 33/91 (36.26%), Postives = 47/91 (51.65%), Query Frame = 2
Query:   29 FCRKLIYKYRYD----------DQLRGYVNFTLSWAPNGSLTEP-----------CRYRALRD--EYGSYTIIYWQLLALRFGFVIIFEHV 232
            F  +++YKYRY           D L+GYVN +LS        +P           CRYR  R+  +Y +++  +W LLA+R  FVI+FEHV
Sbjct:  623 FIPRVVYKYRYSPCLKEGNSTVDCLKGYVNHSLSVFHTKDFQDPDGIEGSENVTLCRYRDYRNPPDY-NFSEQFWFLLAIRLAFVILFEHV 712          
BLAST of Anoctamin vs. Ensembl Zebrafish
Match: ano11 (anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245])

HSP 1 Score: 85.8853 bits (211), Expect = 4.853e-21
Identity = 37/72 (51.39%), Postives = 54/72 (75.00%), Query Frame = 2
Query:   26 NFCRKLIYKYRYDDQLRGYVNFTLSWAP---NGSLTEPCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
            +F  +L+Y+Y++++ L GYVNFTL+++P   N S    CRY+A RDE G Y ++YW+LLA+R GF+I FEHV
Sbjct:  774 DFLPRLLYQYKFNNDLHGYVNFTLAYSPPSYNHSSHTVCRYKAFRDENGKYKLVYWELLAVRLGFIIAFEHV 845          
BLAST of Anoctamin vs. Ensembl Zebrafish
Match: ano11 (anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245])

HSP 1 Score: 85.1149 bits (209), Expect = 9.488e-21
Identity = 37/72 (51.39%), Postives = 54/72 (75.00%), Query Frame = 2
Query:   26 NFCRKLIYKYRYDDQLRGYVNFTLSWAP---NGSLTEPCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
            +F  +L+Y+Y++++ L GYVNFTL+++P   N S    CRY+A RDE G Y ++YW+LLA+R GF+I FEHV
Sbjct:  528 DFLPRLLYQYKFNNDLHGYVNFTLAYSPPSYNHSSHTVCRYKAFRDENGKYKLVYWELLAVRLGFIIAFEHV 599          
BLAST of Anoctamin vs. Ensembl Zebrafish
Match: ano11 (anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245])

HSP 1 Score: 84.3445 bits (207), Expect = 1.723e-20
Identity = 37/73 (50.68%), Postives = 54/73 (73.97%), Query Frame = 2
Query:   23 QNFCRKLIYKYRYDDQLRGYVNFTLSWAP---NGSLTEPCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
             +F  +L+Y+Y++++ L GYVNFTL+++P   N S    CRY+A RDE G Y ++YW+LLA+R GF+I FEHV
Sbjct:  773 SDFLPRLLYQYKFNNDLHGYVNFTLAYSPPSYNHSSHTVCRYKAFRDENGKYKLVYWELLAVRLGFIIAFEHV 845          
BLAST of Anoctamin vs. Ensembl Zebrafish
Match: si:dkey-83h2.5 (si:dkey-83h2.5 [Source:ZFIN;Acc:ZDB-GENE-131125-81])

HSP 1 Score: 65.4698 bits (158), Expect = 7.990e-14
Identity = 38/71 (53.52%), Postives = 46/71 (64.79%), Query Frame = 2
Query:   26 NFCRKLIYKYRYDDQLRGYVNFTLSWAP-NGSLTE-PCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
            +F  +L Y+Y     + GY+NFTLS AP N +  E  CRYR LRDE G  T  Y+ LLA+R  FVIIFEHV
Sbjct:  734 DFLPRLFYRYTAGS-MSGYINFTLSVAPANFTQNEMSCRYRGLRDEKGQNTQDYYHLLAIRLSFVIIFEHV 803          
BLAST of Anoctamin vs. Ensembl Zebrafish
Match: ano1 (anoctamin 1, calcium activated chloride channel [Source:ZFIN;Acc:ZDB-GENE-121127-3])

HSP 1 Score: 47.7506 bits (112), Expect = 1.086e-7
Identity = 32/91 (35.16%), Postives = 46/91 (50.55%), Query Frame = 2
Query:   26 NFCRKLIYKYRY--DDQLRGYVNFTLSW------APNGSLTEP---------CRYRALRDEYGS-----YTIIYWQLLALRFGFVIIFEHV 232
            +F  +L+Y+Y Y  D  L G+VN TLS+       P     EP         CRY+  RD   S     ++  +W +LA RF FVI+F++V
Sbjct:  772 DFIPRLVYQYMYSPDGTLHGFVNHTLSYFNVTHFQPGTEPLEPMHLGYQVDTCRYKDYRDPPWSDTPYEFSREFWAILAARFAFVILFQNV 862          
BLAST of Anoctamin vs. Ensembl Xenopus
Match: ANO3 (anoctamin 3 [Source:NCBI gene;Acc:100495805])

HSP 1 Score: 43.5134 bits (101), Expect = 5.518e-6
Identity = 26/69 (37.68%), Postives = 39/69 (56.52%), Query Frame = 2
Query:   53 YRYDDQLRGYVNFTLSWAPNGSLTEP----CRYRALRDEYGS-----YTIIYWQLLALRFGFVIIFEHV 232
            YR++  L+GYVN +LS      L +     CRYR  R+   S     +T+ +W +LA R  F+I+FEH+
Sbjct:  770 YRHEKCLQGYVNSSLSIFDLKELGQGYSGYCRYRDYREPPWSSNPYEFTLQFWHVLAARLAFIIVFEHL 838          
BLAST of Anoctamin vs. Ensembl Xenopus
Match: znf367 (zinc finger protein 367 [Source:Xenbase;Acc:XB-GENE-986040])

HSP 1 Score: 42.3578 bits (98), Expect = 6.652e-6
Identity = 31/91 (34.07%), Postives = 45/91 (49.45%), Query Frame = 2
Query:   26 NFCRKLIYKYRY--DDQLRGYVNFTLSW------APNGSLTEP---------CRYRALRDEYGS---YTI--IYWQLLALRFGFVIIFEHV 232
            +F  +L+Y Y Y  D  + G+VN TLS+       P    +EP         CRY+  R+   S   Y I   YW +LA R  FVI+F+++
Sbjct:  804 DFIPRLVYLYMYSPDGTMHGFVNHTLSYFNVTDFKPGTEPSEPVDLGYKVELCRYKDYREAPWSPHKYDINKDYWAVLAARLAFVIVFQNL 894          

HSP 2 Score: 24.2534 bits (51), Expect = 6.652e-6
Identity = 8/13 (61.54%), Postives = 13/13 (100.00%), Query Frame = 1
Query:    1 AFLIAFTSEFLPK 39
            AF+I+FTS+F+P+
Sbjct:  796 AFVISFTSDFIPR 808          
BLAST of Anoctamin vs. Ensembl Xenopus
Match: znf367 (zinc finger protein 367 [Source:Xenbase;Acc:XB-GENE-986040])

HSP 1 Score: 42.3578 bits (98), Expect = 6.986e-6
Identity = 31/91 (34.07%), Postives = 45/91 (49.45%), Query Frame = 2
Query:   26 NFCRKLIYKYRY--DDQLRGYVNFTLSW------APNGSLTEP---------CRYRALRDEYGS---YTI--IYWQLLALRFGFVIIFEHV 232
            +F  +L+Y Y Y  D  + G+VN TLS+       P    +EP         CRY+  R+   S   Y I   YW +LA R  FVI+F+++
Sbjct:  786 DFIPRLVYLYMYSPDGTMHGFVNHTLSYFNVTDFKPGTEPSEPVDLGYKVELCRYKDYREAPWSPHKYDINKDYWAVLAARLAFVIVFQNL 876          

HSP 2 Score: 24.2534 bits (51), Expect = 6.986e-6
Identity = 8/13 (61.54%), Postives = 13/13 (100.00%), Query Frame = 1
Query:    1 AFLIAFTSEFLPK 39
            AF+I+FTS+F+P+
Sbjct:  778 AFVISFTSDFIPR 790          
BLAST of Anoctamin vs. Ensembl Xenopus
Match: znf367 (zinc finger protein 367 [Source:Xenbase;Acc:XB-GENE-986040])

HSP 1 Score: 42.3578 bits (98), Expect = 6.990e-6
Identity = 31/91 (34.07%), Postives = 45/91 (49.45%), Query Frame = 2
Query:   26 NFCRKLIYKYRY--DDQLRGYVNFTLSW------APNGSLTEP---------CRYRALRDEYGS---YTI--IYWQLLALRFGFVIIFEHV 232
            +F  +L+Y Y Y  D  + G+VN TLS+       P    +EP         CRY+  R+   S   Y I   YW +LA R  FVI+F+++
Sbjct:  771 DFIPRLVYLYMYSPDGTMHGFVNHTLSYFNVTDFKPGTEPSEPVDLGYKVELCRYKDYREAPWSPHKYDINKDYWAVLAARLAFVIVFQNL 861          

HSP 2 Score: 24.2534 bits (51), Expect = 6.990e-6
Identity = 8/13 (61.54%), Postives = 13/13 (100.00%), Query Frame = 1
Query:    1 AFLIAFTSEFLPK 39
            AF+I+FTS+F+P+
Sbjct:  763 AFVISFTSDFIPR 775          
BLAST of Anoctamin vs. Ensembl Xenopus
Match: znf367 (zinc finger protein 367 [Source:Xenbase;Acc:XB-GENE-986040])

HSP 1 Score: 42.3578 bits (98), Expect = 8.063e-6
Identity = 31/91 (34.07%), Postives = 45/91 (49.45%), Query Frame = 2
Query:   26 NFCRKLIYKYRY--DDQLRGYVNFTLSW------APNGSLTEP---------CRYRALRDEYGS---YTI--IYWQLLALRFGFVIIFEHV 232
            +F  +L+Y Y Y  D  + G+VN TLS+       P    +EP         CRY+  R+   S   Y I   YW +LA R  FVI+F+++
Sbjct:  818 DFIPRLVYLYMYSPDGTMHGFVNHTLSYFNVTDFKPGTEPSEPVDLGYKVELCRYKDYREAPWSPHKYDINKDYWAVLAARLAFVIVFQNL 908          

HSP 2 Score: 23.8682 bits (50), Expect = 8.063e-6
Identity = 8/13 (61.54%), Postives = 13/13 (100.00%), Query Frame = 1
Query:    1 AFLIAFTSEFLPK 39
            AF+I+FTS+F+P+
Sbjct:  810 AFVISFTSDFIPR 822          
BLAST of Anoctamin vs. Ensembl Mouse
Match: Ano7 (anoctamin 7 [Source:MGI Symbol;Acc:MGI:3052714])

HSP 1 Score: 67.781 bits (164), Expect = 1.248e-14
Identity = 32/73 (43.84%), Postives = 45/73 (61.64%), Query Frame = 2
Query:   23 QNFCRKLIYKYRYDDQLRGYVNFTLSWAP---NGSLTEPCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
             +F  ++ Y + +   L G++NFTL+ AP     +    CRYRA RD+ G Y+  YW LLA+R  FVI+FEHV
Sbjct:  725 SDFLPRVYYSWTHAPDLHGFLNFTLARAPPTFTSAHNRTCRYRAFRDDDGHYSPTYWTLLAIRLAFVIVFEHV 797          
BLAST of Anoctamin vs. Ensembl Mouse
Match: Ano7 (anoctamin 7 [Source:MGI Symbol;Acc:MGI:3052714])

HSP 1 Score: 67.3958 bits (163), Expect = 1.349e-14
Identity = 32/73 (43.84%), Postives = 45/73 (61.64%), Query Frame = 2
Query:   23 QNFCRKLIYKYRYDDQLRGYVNFTLSWAP---NGSLTEPCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
             +F  ++ Y + +   L G++NFTL+ AP     +    CRYRA RD+ G Y+  YW LLA+R  FVI+FEHV
Sbjct:  725 SDFLPRVYYSWTHAPDLHGFLNFTLARAPPTFTSAHNRTCRYRAFRDDDGHYSPTYWTLLAIRLAFVIVFEHV 797          
BLAST of Anoctamin vs. Ensembl Mouse
Match: Ano7 (anoctamin 7 [Source:MGI Symbol;Acc:MGI:3052714])

HSP 1 Score: 50.0618 bits (118), Expect = 1.438e-9
Identity = 20/32 (62.50%), Postives = 24/32 (75.00%), Query Frame = 2
Query:  131 CRYRALRDEYGSYTIIYWQLLALRFGFVIIFE 226
            CRYRA RD+ G Y+  YW LLA+R  FVI+FE
Sbjct:   14 CRYRAFRDDDGHYSPTYWTLLAIRLAFVIVFE 45          
BLAST of Anoctamin vs. UniProt/SwissProt
Match: sp|Q6IWH7|ANO7_HUMAN (Anoctamin-7 OS=Homo sapiens OX=9606 GN=ANO7 PE=1 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 4.689e-14
Identity = 33/73 (45.21%), Postives = 46/73 (63.01%), Query Frame = 2
Query:   23 QNFCRKLIYKYRYDDQLRGYVNFTLSWAPN---GSLTEPCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
             +F  +  Y++     LRG++NFTL+ AP+    +    CRYRA RD+ G Y+  YW LLA+R  FVI+FEHV
Sbjct:  788 SDFLPRAYYRWTRAHDLRGFLNFTLARAPSSFAAAHNRTCRYRAFRDDDGHYSQTYWNLLAIRLAFVIVFEHV 860          
BLAST of Anoctamin vs. UniProt/SwissProt
Match: sp|Q6IFT6|ANO7_RAT (Anoctamin-7 OS=Rattus norvegicus OX=10116 GN=Ano7 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 6.147e-14
Identity = 33/73 (45.21%), Postives = 45/73 (61.64%), Query Frame = 2
Query:   23 QNFCRKLIYKYRYDDQLRGYVNFTLSWAP---NGSLTEPCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
             +F  ++ Y +     LRG++NFTL+ AP     +    CRYRA RD+ G Y+  YW LLA+R  FVI+FEHV
Sbjct:  726 SDFLPRVYYSWTRAPDLRGFLNFTLARAPPTFTSAHNRTCRYRAFRDDDGHYSPTYWTLLAIRLAFVIVFEHV 798          
BLAST of Anoctamin vs. UniProt/SwissProt
Match: sp|Q14AT5|ANO7_MOUSE (Anoctamin-7 OS=Mus musculus OX=10090 GN=Ano7 PE=1 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 8.733e-14
Identity = 32/73 (43.84%), Postives = 45/73 (61.64%), Query Frame = 2
Query:   23 QNFCRKLIYKYRYDDQLRGYVNFTLSWAP---NGSLTEPCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
             +F  ++ Y + +   L G++NFTL+ AP     +    CRYRA RD+ G Y+  YW LLA+R  FVI+FEHV
Sbjct:  725 SDFLPRVYYSWTHAPDLHGFLNFTLARAPPTFTSAHNRTCRYRAFRDDDGHYSPTYWTLLAIRLAFVIVFEHV 797          
BLAST of Anoctamin vs. UniProt/SwissProt
Match: sp|A1A5B4|ANO9_HUMAN (Anoctamin-9 OS=Homo sapiens OX=9606 GN=ANO9 PE=1 SV=3)

HSP 1 Score: 50.447 bits (119), Expect = 1.118e-7
Identity = 33/91 (36.26%), Postives = 47/91 (51.65%), Query Frame = 2
Query:   29 FCRKLIYKYRYD----------DQLRGYVNFTLSWAPNGSLTEP-----------CRYRALRD--EYGSYTIIYWQLLALRFGFVIIFEHV 232
            F  +++YKYRY           D L+GYVN +LS        +P           CRYR  R+  +Y +++  +W LLA+R  FVI+FEHV
Sbjct:  623 FIPRVVYKYRYSPCLKEGNSTVDCLKGYVNHSLSVFHTKDFQDPDGIEGSENVTLCRYRDYRNPPDY-NFSEQFWFLLAIRLAFVILFEHV 712          
BLAST of Anoctamin vs. TrEMBL
Match: T1I539 (Anoctamin OS=Rhodnius prolixus OX=13249 PE=3 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 1.829e-24
Identity = 40/68 (58.82%), Postives = 57/68 (83.82%), Query Frame = 2
Query:   29 FCRKLIYKYRYDDQLRGYVNFTLSWAPNGSLTEPCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
            F  KL+Y+Y Y+  L GY+NFTL+++PNG+L++ CRYR LRDE+G++T  +W+LLA++F FVIIFEHV
Sbjct:   18 FLPKLLYQYDYNWNLEGYINFTLAYSPNGTLSQQCRYRGLRDEFGNHTPFFWRLLAVQFAFVIIFEHV 85          
BLAST of Anoctamin vs. TrEMBL
Match: A0A1I8I418 (Anoctamin OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 2.021e-23
Identity = 39/69 (56.52%), Postives = 51/69 (73.91%), Query Frame = 2
Query:   26 NFCRKLIYKYRYDDQLRGYVNFTLSWAPNGSLTEPCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
             F  K +YKY++D +L GY NFTL+W+P  S  +PCRY+A R E G YT+ YW+LLA+R  FVI+FEHV
Sbjct:    9 EFLPKELYKYQFDSELHGYTNFTLAWSPANSTAQPCRYKAFRGEDGHYTMFYWKLLAVRLAFVIVFEHV 77          
BLAST of Anoctamin vs. TrEMBL
Match: A0A1I8FDG5 (Anoctamin OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 2.241e-23
Identity = 39/70 (55.71%), Postives = 51/70 (72.86%), Query Frame = 2
Query:   23 QNFCRKLIYKYRYDDQLRGYVNFTLSWAPNGSLTEPCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
              F  K +YKY++D +L GY NFTL+W+P  S  +PCRY+A R E G YT+ YW+LLA+R  FVI+FEHV
Sbjct:    8 SEFLPKELYKYQFDSELHGYTNFTLAWSPANSTAQPCRYKAFRGEDGHYTMFYWKLLAVRLAFVIVFEHV 77          
BLAST of Anoctamin vs. TrEMBL
Match: A0A087TSS7 (Anoctamin (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_22045 PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 3.541e-23
Identity = 41/64 (64.06%), Postives = 53/64 (82.81%), Query Frame = 2
Query:   41 LIYKYRYDDQLRGYVNFTLSWAPNGSLTEPCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
            ++Y+Y Y   L+GYVNFTL+WAPNG+LT+ CRY   RD+ G++T  YW+LLALRFGFVI+FEHV
Sbjct:    1 MLYEYEYRWDLKGYVNFTLAWAPNGTLTQACRYSDFRDQDGNHTTFYWRLLALRFGFVILFEHV 64          
BLAST of Anoctamin vs. TrEMBL
Match: A0A444TJF8 (Anoctamin OS=Armadillidium vulgare OX=13347 GN=Avbf_10739 PE=3 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.049e-22
Identity = 40/69 (57.97%), Postives = 55/69 (79.71%), Query Frame = 2
Query:   26 NFCRKLIYKYRYDDQLRGYVNFTLSWAPNGSLTEPCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
            +F  +L+YKY Y+  L GYVNFTL++AP G+++E CRYR  RD  G +T+ +W+LLA+RFGFVI+FEHV
Sbjct:   82 DFIPRLLYKYEYNWNLVGYVNFTLAYAPKGTMSEECRYRGYRDNTGKHTLFFWRLLAIRFGFVIVFEHV 150          
BLAST of Anoctamin vs. Ensembl Cavefish
Match: ano11 (anoctamin-7 [Source:NCBI gene;Acc:103029593])

HSP 1 Score: 87.0409 bits (214), Expect = 1.423e-21
Identity = 40/72 (55.56%), Postives = 55/72 (76.39%), Query Frame = 2
Query:   26 NFCRKLIYKYRYDDQLRGYVNFTLSWAP---NGSLTEPCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
            +F  +L+Y+Y+++  L GYVNFTL++AP   N S    CRY+A RDE GSYT++YW+LLA+R GF+I FEHV
Sbjct:  778 DFLPRLLYRYKFNSDLHGYVNFTLAYAPPSYNYSSHGMCRYKAFRDENGSYTLVYWELLAVRLGFIIAFEHV 849          
BLAST of Anoctamin vs. Ensembl Cavefish
Match: ano11 (anoctamin-7 [Source:NCBI gene;Acc:103029593])

HSP 1 Score: 82.8037 bits (203), Expect = 4.968e-20
Identity = 38/73 (52.05%), Postives = 53/73 (72.60%), Query Frame = 2
Query:   23 QNFCRKLIYKYRYDDQLRGYVNFTLSWAP---NGSLTEPCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
             +F  +L+Y+Y+++  L GYVNFTL++AP   N S    CRY+A RDE GSYT++YW+LLA+R GF+I FE  
Sbjct:  777 SDFLPRLLYRYKFNSDLHGYVNFTLAYAPPSYNYSSHGMCRYKAFRDENGSYTLVYWELLAVRLGFIIAFEQA 849          
BLAST of Anoctamin vs. Ensembl Cavefish
Match: si:dkey-83h2.5 (anoctamin-7-like [Source:NCBI gene;Acc:103022406])

HSP 1 Score: 72.4034 bits (176), Expect = 1.818e-16
Identity = 37/72 (51.39%), Postives = 47/72 (65.28%), Query Frame = 2
Query:   23 QNFCRKLIYKYRYDDQLRGYVNFTLSWAPNGSLTE--PCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
             +F  +L Y+Y  +  LRGY++FTLS APN        CRYR  RD+ G +T  Y+ LLA+R GFVIIFEHV
Sbjct:  727 SDFLPRLYYRYTTEGSLRGYMDFTLSVAPNNFTQSHMQCRYRGFRDDKGHHTPEYYNLLAIRLGFVIIFEHV 798          
BLAST of Anoctamin vs. Ensembl Cavefish
Match: si:dkey-83h2.5 (anoctamin-7-like [Source:NCBI gene;Acc:103022406])

HSP 1 Score: 72.0182 bits (175), Expect = 2.572e-16
Identity = 37/71 (52.11%), Postives = 47/71 (66.20%), Query Frame = 2
Query:   26 NFCRKLIYKYRYDDQLRGYVNFTLSWAPNGSLTE--PCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
            +F  +L Y+Y  +  LRGY++FTLS APN        CRYR  RD+ G +T  Y+ LLA+R GFVIIFEHV
Sbjct:  647 DFLPRLYYRYTTEGSLRGYMDFTLSVAPNNFTQSHMQCRYRGFRDDKGHHTPEYYNLLAIRLGFVIIFEHV 717          
BLAST of Anoctamin vs. Ensembl Cavefish
Match: si:dkey-83h2.5 (anoctamin-7-like [Source:NCBI gene;Acc:103022406])

HSP 1 Score: 67.3958 bits (163), Expect = 1.068e-14
Identity = 35/70 (50.00%), Postives = 45/70 (64.29%), Query Frame = 2
Query:   23 QNFCRKLIYKYRYDDQLRGYVNFTLSWAPNGSLTE--PCRYRALRDEYGSYTIIYWQLLALRFGFVIIFE 226
             +F  +L Y+Y  +  LRGY++FTLS APN        CRYR  RD+ G +T  Y+ LLA+R GFVIIFE
Sbjct:  727 SDFLPRLYYRYTTEGSLRGYMDFTLSVAPNNFTQSHMQCRYRGFRDDKGHHTPEYYNLLAIRLGFVIIFE 796          
BLAST of Anoctamin vs. Ensembl Sea Lamprey
Match: ano11 (anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245])

HSP 1 Score: 85.8853 bits (211), Expect = 6.096e-22
Identity = 39/70 (55.71%), Postives = 53/70 (75.71%), Query Frame = 2
Query:   26 NFCRKLIYKYRYDDQLRGYVNFTLSWAPNGSLTEP-CRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
            NF  KL+Y+Y YD  LRGY+NFTLS+AP+ ++ E   RY+  RD+ G +T+ YW+LLA+R GF+I FEHV
Sbjct:  292 NFLPKLLYQYTYDRNLRGYINFTLSYAPDENIAEANLRYKDYRDQDGKHTLFYWKLLAIRLGFIIAFEHV 361          
BLAST of Anoctamin vs. Ensembl Sea Lamprey
Match: ano11 (anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245])

HSP 1 Score: 84.3445 bits (207), Expect = 1.950e-21
Identity = 39/72 (54.17%), Postives = 52/72 (72.22%), Query Frame = 2
Query:   26 NFCRKLIYKYRYDDQLRGYVNFTLSWAPNGSLTEP---CRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
            NF  KL+Y+Y YD  LRGY+NFTLS+AP+  +      CRY+  RD+ G +T+ YW+LLA+R GF+I FEHV
Sbjct:  289 NFLPKLLYQYTYDRNLRGYINFTLSYAPDDYVVNNYTHCRYKDYRDQDGKHTLFYWKLLAIRLGFIIAFEHV 360          
BLAST of Anoctamin vs. Ensembl Sea Lamprey
Match: ano11 (anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245])

HSP 1 Score: 83.9593 bits (206), Expect = 2.369e-21
Identity = 39/72 (54.17%), Postives = 52/72 (72.22%), Query Frame = 2
Query:   26 NFCRKLIYKYRYDDQLRGYVNFTLSWAPNGSLTEP---CRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
            NF  KL+Y+Y YD  LRGY+NFTLS+AP+  +      CRY+  RD+ G +T+ YW+LLA+R GF+I FEHV
Sbjct:  297 NFLPKLLYQYTYDRNLRGYINFTLSYAPDDYVVNNYTHCRYKDYRDQDGKHTLFYWKLLAIRLGFIIAFEHV 368          
BLAST of Anoctamin vs. Ensembl Sea Lamprey
Match: ano11 (anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245])

HSP 1 Score: 73.1738 bits (178), Expect = 2.638e-17
Identity = 35/73 (47.95%), Postives = 49/73 (67.12%), Query Frame = 2
Query:   23 QNFCRKLIYKYRYDDQLRGYVNFTLSWAPNGSLTEP---CRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
             +F  +L+Y+Y Y   L GYV+FTL++AP   +      CRYR  RD+ G+ T+ YW+LLA+R  FVIIFEH+
Sbjct:  674 SDFLPRLLYRYTYKSSLDGYVDFTLAYAPRDYVVANHTMCRYRDFRDQDGNLTLFYWKLLAVRLSFVIIFEHL 746          
BLAST of Anoctamin vs. Ensembl Nematostella
Match: EDO49855 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7REV0])

HSP 1 Score: 83.1889 bits (204), Expect = 1.112e-20
Identity = 37/71 (52.11%), Postives = 48/71 (67.61%), Query Frame = 2
Query:   26 NFCRKLIYKYRYDDQ--LRGYVNFTLSWAPNGSLTEPCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
             F  KL+Y+Y   +   L GY N+TL+WAP  +  +PCRY+  RD  G +T+ YW LLALR GFVI+FEHV
Sbjct:  665 TFLPKLLYRYAVSENFSLEGYTNYTLAWAPRNTTLKPCRYQEFRDPEGHFTVFYWHLLALRLGFVIMFEHV 735          
BLAST of Anoctamin vs. Ensembl Nematostella
Match: EDO49854 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7REU8])

HSP 1 Score: 73.559 bits (179), Expect = 3.172e-17
Identity = 32/71 (45.07%), Postives = 46/71 (64.79%), Query Frame = 2
Query:   23 QNFCRKLIYK--YRYDDQLRGYVNFTLSWAPNGSLTEPCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEH 229
              F  KL+Y      +  L GY+N++L+WAP  + ++PCRYR  RDE G++T  +W LL +R  FVI+FEH
Sbjct:  580 SEFLPKLLYAGVVSPNQSLEGYLNYSLAWAPPNTTSQPCRYRGFRDEDGNFTRFFWHLLTMRLVFVILFEH 650          
BLAST of Anoctamin vs. Ensembl Medaka
Match: ano11 (anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245])

HSP 1 Score: 82.4185 bits (202), Expect = 6.339e-20
Identity = 36/70 (51.43%), Postives = 52/70 (74.29%), Query Frame = 2
Query:   26 NFCRKLIYKYRYDDQLRGYVNFTLSWAPNGSLTEP-CRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
            +F  +L+Y+Y+++  L GYVNF+L++AP      P CRY+A RD  G+YT+ YW+LLA+R GF+I FEHV
Sbjct:  357 DFLPRLLYQYKFERGLHGYVNFSLAFAPLNYTEHPMCRYKAFRDNDGNYTLFYWELLAVRLGFIIAFEHV 426          
BLAST of Anoctamin vs. Ensembl Medaka
Match: si:dkey-83h2.5 (anoctamin 7 [Source:NCBI gene;Acc:101162585])

HSP 1 Score: 68.9366 bits (167), Expect = 3.359e-15
Identity = 33/73 (45.21%), Postives = 44/73 (60.27%), Query Frame = 2
Query:   26 NFCRKLIYKYRYDDQLRGYVNFTLSWAPNG----SLTEPCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
            +F  +L ++Y  D  L GY NFTL+ +P+      L   CRYR  RD  G +   Y+ LLA+R GF+IIFEHV
Sbjct:  349 SFVPRLYFRYTKDSSLSGYTNFTLATSPHSFNQQHLNTSCRYRGFRDVKGDFLPEYFHLLAIRLGFIIIFEHV 421          
BLAST of Anoctamin vs. Ensembl Medaka
Match: si:dkey-83h2.5 (anoctamin 7 [Source:NCBI gene;Acc:101162585])

HSP 1 Score: 68.1662 bits (165), Expect = 6.046e-15
Identity = 33/73 (45.21%), Postives = 44/73 (60.27%), Query Frame = 2
Query:   26 NFCRKLIYKYRYDDQLRGYVNFTLSWAPNG----SLTEPCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
            +F  +L ++Y  D  L GY NFTL+ +P+      L   CRYR  RD  G +   Y+ LLA+R GF+IIFEHV
Sbjct:  716 SFVPRLYFRYTKDSSLSGYTNFTLATSPHSFNQQHLNTSCRYRGFRDVKGDFLPEYFHLLAIRLGFIIIFEHV 788          
BLAST of Anoctamin vs. Ensembl Medaka
Match: ano1 (anoctamin 1 [Source:NCBI gene;Acc:101174572])

HSP 1 Score: 48.1358 bits (113), Expect = 3.387e-8
Identity = 32/91 (35.16%), Postives = 46/91 (50.55%), Query Frame = 2
Query:   26 NFCRKLIYKYRY--DDQLRGYVNFTLS------WAPN---------GSLTEPCRYRALRDEYGSYTII-----YWQLLALRFGFVIIFEHV 232
            +F  +L+Y+Y Y  D  L G+VN TLS      + PN         G   E CRY+  R+   S T       +W +LA+R  FVI+F++V
Sbjct:  817 DFIPRLVYQYTYSPDGTLHGFVNHTLSVFNVRDFEPNTQPIYPNHLGYNVETCRYKDYREPPWSSTPYELSKEFWSILAVRLAFVIVFQNV 907          

HSP 2 Score: 25.409 bits (54), Expect = 3.387e-8
Identity = 9/13 (69.23%), Postives = 13/13 (100.00%), Query Frame = 1
Query:    1 AFLIAFTSEFLPK 39
            AF+IAFTS+F+P+
Sbjct:  809 AFVIAFTSDFIPR 821          
BLAST of Anoctamin vs. Ensembl Medaka
Match: ano1 (anoctamin 1 [Source:NCBI gene;Acc:101174572])

HSP 1 Score: 48.1358 bits (113), Expect = 3.470e-8
Identity = 32/91 (35.16%), Postives = 46/91 (50.55%), Query Frame = 2
Query:   26 NFCRKLIYKYRY--DDQLRGYVNFTLS------WAPN---------GSLTEPCRYRALRDEYGSYTII-----YWQLLALRFGFVIIFEHV 232
            +F  +L+Y+Y Y  D  L G+VN TLS      + PN         G   E CRY+  R+   S T       +W +LA+R  FVI+F++V
Sbjct:  821 DFIPRLVYQYTYSPDGTLHGFVNHTLSVFNVRDFEPNTQPIYPNHLGYNVETCRYKDYREPPWSSTPYELSKEFWSILAVRLAFVIVFQNV 911          

HSP 2 Score: 25.409 bits (54), Expect = 3.470e-8
Identity = 9/13 (69.23%), Postives = 13/13 (100.00%), Query Frame = 1
Query:    1 AFLIAFTSEFLPK 39
            AF+IAFTS+F+P+
Sbjct:  813 AFVIAFTSDFIPR 825          
BLAST of Anoctamin vs. Planmine SMEST
Match: SMESG000052528.1 (SMESG000052528.1)

HSP 1 Score: 140.198 bits (352), Expect = 2.460e-40
Identity = 66/68 (97.06%), Postives = 66/68 (97.06%), Query Frame = 2
Query:   29 FCRKLIYKYRYDDQLRGYVNFTLSWAPNGSLTEPCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
            F  KLIYKYRYDDQLRGYVNFTLSWAPNGSLTEPCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV
Sbjct:  757 FLPKLIYKYRYDDQLRGYVNFTLSWAPNGSLTEPCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 824          
BLAST of Anoctamin vs. Planmine SMEST
Match: SMESG000053932.1 (SMESG000053932.1)

HSP 1 Score: 91.2781 bits (225), Expect = 3.964e-23
Identity = 41/70 (58.57%), Postives = 51/70 (72.86%), Query Frame = 2
Query:   23 QNFCRKLIYKYRYDDQLRGYVNFTLSWAPNGSLTEPCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
             +F  K +YKY ++  L GYVNFTL+WAPN SL+EPCRYR  RD  G  T  YW+LLA+R  FVI+FEH+
Sbjct:  720 SDFIPKQVYKYSHNFLLDGYVNFTLAWAPNNSLSEPCRYRDFRDVNGKLTRFYWRLLAIRLTFVIVFEHI 789          
BLAST of Anoctamin vs. Planmine SMEST
Match: SMESG000006381.1 (SMESG000006381.1)

HSP 1 Score: 73.1738 bits (178), Expect = 8.677e-17
Identity = 35/70 (50.00%), Postives = 43/70 (61.43%), Query Frame = 2
Query:   23 QNFCRKLIYKYRYDDQLRGYVNFTLSWAPNGSLTEPCRYRALRDEYGSYTIIYWQLLALRFGFVIIFEHV 232
              F  KL Y+YR+D  L GY N +LSW+P  S   PCRY   RD  G     +W+LLA+R GFVI+FEH 
Sbjct:  715 SEFLPKLYYRYRFDS-LDGYTNHSLSWSPKNSTVIPCRYPGYRDNDGILKQYFWELLAVRLGFVIVFEHT 783          
BLAST of Anoctamin vs. Planmine SMEST
Match: SMESG000027271.1 (SMESG000027271.1)

HSP 1 Score: 51.2174 bits (121), Expect = 4.140e-9
Identity = 36/89 (40.45%), Postives = 47/89 (52.81%), Query Frame = 2
Query:   38 KLIYKYRYDDQ---LRGYVNFTLS------WAPNGSLTEP---------CRYRALRD------EYGSYTIIYWQLLALRFGFVIIFEHV 232
            +L+Y+Y Y+ +   L GYVNFTLS      + P      P         CRYR  R+      EY S +IIYW +LA R  FVI++EHV
Sbjct:  365 QLVYRYYYNHKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEY-SVSIIYWHVLAARLAFVIVYEHV 452          
The following BLAST results are available for this feature:
BLAST of Anoctamin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ANO71.578e-1545.21anoctamin 7 [Source:HGNC Symbol;Acc:HGNC:31677][more]
ANO79.765e-1545.21anoctamin 7 [Source:HGNC Symbol;Acc:HGNC:31677][more]
ANO74.877e-1343.66anoctamin 7 [Source:HGNC Symbol;Acc:HGNC:31677][more]
ANO92.328e-836.26anoctamin 9 [Source:HGNC Symbol;Acc:HGNC:20679][more]
back to top
BLAST of Anoctamin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Anoctamin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Anoctamin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ano114.853e-2151.39anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245][more]
ano119.488e-2151.39anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245][more]
ano111.723e-2050.68anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245][more]
si:dkey-83h2.57.990e-1453.52si:dkey-83h2.5 [Source:ZFIN;Acc:ZDB-GENE-131125-81... [more]
ano11.086e-735.16anoctamin 1, calcium activated chloride channel [S... [more]
back to top
BLAST of Anoctamin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANO35.518e-637.68anoctamin 3 [Source:NCBI gene;Acc:100495805][more]
znf3676.652e-634.07zinc finger protein 367 [Source:Xenbase;Acc:XB-GEN... [more]
znf3676.986e-634.07zinc finger protein 367 [Source:Xenbase;Acc:XB-GEN... [more]
znf3676.990e-634.07zinc finger protein 367 [Source:Xenbase;Acc:XB-GEN... [more]
znf3678.063e-634.07zinc finger protein 367 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Anoctamin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ano71.248e-1443.84anoctamin 7 [Source:MGI Symbol;Acc:MGI:3052714][more]
Ano71.349e-1443.84anoctamin 7 [Source:MGI Symbol;Acc:MGI:3052714][more]
Ano71.438e-962.50anoctamin 7 [Source:MGI Symbol;Acc:MGI:3052714][more]
back to top
BLAST of Anoctamin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q6IWH7|ANO7_HUMAN4.689e-1445.21Anoctamin-7 OS=Homo sapiens OX=9606 GN=ANO7 PE=1 S... [more]
sp|Q6IFT6|ANO7_RAT6.147e-1445.21Anoctamin-7 OS=Rattus norvegicus OX=10116 GN=Ano7 ... [more]
sp|Q14AT5|ANO7_MOUSE8.733e-1443.84Anoctamin-7 OS=Mus musculus OX=10090 GN=Ano7 PE=1 ... [more]
sp|A1A5B4|ANO9_HUMAN1.118e-736.26Anoctamin-9 OS=Homo sapiens OX=9606 GN=ANO9 PE=1 S... [more]
back to top
BLAST of Anoctamin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1I5391.829e-2458.82Anoctamin OS=Rhodnius prolixus OX=13249 PE=3 SV=1[more]
A0A1I8I4182.021e-2356.52Anoctamin OS=Macrostomum lignano OX=282301 PE=3 SV... [more]
A0A1I8FDG52.241e-2355.71Anoctamin OS=Macrostomum lignano OX=282301 PE=3 SV... [more]
A0A087TSS73.541e-2364.06Anoctamin (Fragment) OS=Stegodyphus mimosarum OX=4... [more]
A0A444TJF81.049e-2257.97Anoctamin OS=Armadillidium vulgare OX=13347 GN=Avb... [more]
back to top
BLAST of Anoctamin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ano111.423e-2155.56anoctamin-7 [Source:NCBI gene;Acc:103029593][more]
ano114.968e-2052.05anoctamin-7 [Source:NCBI gene;Acc:103029593][more]
si:dkey-83h2.51.818e-1651.39anoctamin-7-like [Source:NCBI gene;Acc:103022406][more]
si:dkey-83h2.52.572e-1652.11anoctamin-7-like [Source:NCBI gene;Acc:103022406][more]
si:dkey-83h2.51.068e-1450.00anoctamin-7-like [Source:NCBI gene;Acc:103022406][more]
back to top
BLAST of Anoctamin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ano116.096e-2255.71anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245][more]
ano111.950e-2154.17anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245][more]
ano112.369e-2154.17anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245][more]
ano112.638e-1747.95anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245][more]
back to top
BLAST of Anoctamin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Anoctamin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO498551.112e-2052.11Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7REV0][more]
EDO498543.172e-1745.07Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7REU8][more]
back to top
BLAST of Anoctamin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ano116.339e-2051.43anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245][more]
si:dkey-83h2.53.359e-1545.21anoctamin 7 [Source:NCBI gene;Acc:101162585][more]
si:dkey-83h2.56.046e-1545.21anoctamin 7 [Source:NCBI gene;Acc:101162585][more]
ano13.387e-835.16anoctamin 1 [Source:NCBI gene;Acc:101174572][more]
ano13.470e-835.16anoctamin 1 [Source:NCBI gene;Acc:101174572][more]
back to top
BLAST of Anoctamin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000052528.12.460e-4097.06SMESG000052528.1[more]
SMESG000053932.13.964e-2358.57SMESG000053932.1[more]
SMESG000006381.18.677e-1750.00SMESG000006381.1[more]
SMESG000027271.14.140e-940.45SMESG000027271.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020746 ID=SMED30020746|Name=Anoctamin|organism=Schmidtea mediterranea sexual|type=transcript|length=233bp
GCATTTCTGATAGCATTTACTTCAGAATTTTTGCCGAAAACTCATTTATA
AATATAGATATGATGACCAGCTACGAGGATATGTCAATTTTACATTGTCT
TGGGCGCCAAATGGCTCTTTGACAGAACCGTGCCGGTACAGAGCATTGAG
GGACGAGTATGGTAGCTACACTATTATTTATTGGCAGCTCTTGGCCTTAC
GGTTTGGATTTGTCATTATTTTTGAGCACGTTG
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0061588calcium activated phospholipid scrambling
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity