Dopey_N domain-containing protein

Overview
NameDopey_N domain-containing protein
Smed IDSMED30020730
Length (bp)7221
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020730

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30020730SMESG000074794.1 SMESG000074793.1 dd_Smed_v4_6117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020730SMESG000074794.1 SMESG000074793.1 dd_Smed_v4_6117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30020730SMESG000074794.1 SMESG000074793.1 dd_Smed_v4_6117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30020730SMESG000074794.1 SMESG000074793.1 dd_Smed_v4_6117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020730SMESG000074794.1 SMESG000074793.1 dd_Smed_v4_6117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30020730SMESG000074794.1 SMESG000074793.1 dd_Smed_v4_6117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020730SMESG000074794.1 SMESG000074793.1 dd_Smed_v4_6117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30020730SMESG000074794.1 SMESG000074793.1 dd_Smed_v6_6117_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020730SMESG000074794.1 SMESG000074793.1 dd_Smed_v4_6117_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dopey_N domain-containing protein vs. Ensembl Human
Match: DOP1A (DOP1 leucine zipper like protein A [Source:HGNC Symbol;Acc:HGNC:21194])

HSP 1 Score: 395.201 bits (1014), Expect = 6.161e-110
Identity = 310/1153 (26.89%), Postives = 553/1153 (47.96%), Query Frame = 3
Query: 3498 SNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQI---GYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEK-------TTNILS-------DSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEI---NTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILW---EKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPLT-EKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCD----------IKSIKQN-----------DINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFL 6818
            S ++ IHPL+ H+LLY  +YDS+  LY+ S ++ I ++ P          I+  +   +   N+      +  QN    +L+RH  ++ G +FY +  ++   +F+S   +EI++ +C ++M S YP   T  KV+ +D+  N+ +Q+++ EIL  +  E+  +++    G+ +   D ++                 +C V K  LHC+ +SI   +K         N+++       DS++  +E   D       Q  L++++  ++ L++ + T       I  ++  G     +D +   P  ++ + S  Y  + P   ++ Q + L +++  +       +H      I S+L   GK    V++ +  +LC+N+    NL +   Q    T   DS  +   + +P D  L+ L  + A+ H+ LLD   + +QL            L ++  K               H+ +AR+ ++ ++   + S+ +LW    ++  SEK+ +       +  +G    +RQ IL ++ P+   H    + ++A VW    Q                   N+ +T    + +     + ++EL R +      T +I T ++++++   +  +K+   ++V +L+F   ++       L      L  LLK+SI  SLP    F++L +L++FI K    + K++QR++QD+  K+++ +  IAGSSLEQ +W RR  ++K           S +I  DG                                          +L +  ++  +  M T NI  TPS    ++ AL LL+  LA ++D+ + S+EKE+V P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D   +  W+ I+DNLMT DK TF++  T++ V Q   LNLF +++ E +Q AM +K+LAF I+SSE+DQY K +P+IQE+L ESLRL  +P + +Q+FL FRVLL+R+S QHLTSLW   I  L  V   +  +L  D          +  ++             +  + LN+YLSACK LD+   +  +++PQF  Y+WAF+    +++          Q  F+P++
Sbjct: 1348 SPNFNIHPLYQHVLLYLQLYDSSRTLYAFSAIKAILKTNP----------IAFVNAISTTSVNNAYTPQLSLLQN----LLARHRISVMGKDFYSHIPVDSNHNFRSSMYIEILISLCLYYMRSHYP---THVKVTAQDLIGNRNMQMMSIEILTLLFTELAKVIESSAKGFPSFISDMLS-----------------KCKVQKVILHCLLSSIFSAQKWHSEKMAGKNLVAVEEGFSEDSLINFSEDEFDNG--STLQSQLLKVLQRLIVLEHRVMT-------IPEENETGFDFVVSDLEHISP--HQPMTSLQYLHAQP---ITCQGMFLCAVIRALHQHCACKMHPQWIGLITSTLPYMGKVLQRVVVSVTLQLCRNLD---NLIQ---QYKYETGLSDSRPLWMASIIPPDMILTLLEGITAIIHYCLLDPTTQYHQL------------LVSVDQK---------------HLFEARSGILSILHMIMSSVTLLWSILHQADSSEKMTIAASASLTTINLGATKNLRQQILELLGPISMNHGVHFMAAIAFVWNERRQ-------------------NKTTTRTKVIPAASEEQLLLVELVRSISVMRAET-VIQTVKEVLKQPPAIAKDKKHLSLEVCMLQFFYAYIQRIPVPNLVDSWASLLILLKDSIQLSLPAPGQFLILGVLNEFIMKNPSLENKKDQRDLQDVTHKIVDAIGAIAGSSLEQTTWLRRNLEVK----------PSPKIMVDG-----------------------------------------TNLESDVEDMLSPAMETANI--TPS--VYSVHALTLLSEVLAHLLDMVFYSDEKERVIPLLVNIMH-YVVPYLRNHSAHNAPSYRACVQLLSSLSGYQYTRRAWKKEAFDLFMDPSFFQMDASCVNHWRAIMDNLMTHDKTTFRDLMTRVAVAQSSSLNLFANRDVELEQRAMLLKRLAFAIFSSEIDQYQKYLPDIQERLVESLRLPQVPTLHSQVFLFFRVLLLRMSPQHLTSLWPTMITELVQVFLLMEQELTADEDISRTSGPSVAGLETTYTGGNGFSTSYNSQRWLNLYLSACKFLDLALALPSENLPQFQMYRWAFIPEASDDSGLEVRRQGIHQREFKPYV 2343          

HSP 2 Score: 348.206 bits (892), Expect = 1.708e-95
Identity = 213/558 (38.17%), Postives = 329/558 (58.96%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIID-NPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQ------EVTPSQF-PSFQMTIDRICELVKFIL--IRLPI--------ETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  +D+K+RN+   +DK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++P+K  +GKRL+QCLHPALP GVH KALE +++IF IIGP++LA DLF+Y +G+FPLL+ +AM +K  L +LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +V+   FY+ LW  +L +P+VR  G  ++L H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G    R +                   +  E    YF  +S+++L+ A+  I+  N     +  +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L  +      L +E   + +    +   S +RE+ K+      E +KTANL F + +  + W+Y+ R F +  ++      ++ P     S ++ +   C LV F+L  + LP         ETY ++ + HLP LL  +   L  H+  L +  +   L++   I  K+
Sbjct:    4 EELELLSDSKYRNYVAAIDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPKKLTIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLANAAMSVKPTLLSLYEIYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYERTNMLLEKVAAAVDQSAFYSALWGSLLTSPAVRLPGITYVLAHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALHVVLRRDMSLNRRLYAWLLGPRSTRHS-------------------NPEEHATYYFTTFSKELLVQAMVGILQVNGFGEENTLMQDLKPFRILISLLDKPELGPVILEDVLIEVFRTLYSQCKAELDLQTEPPFSKDHAQLS---SKLRENKKTA-----ELIKTANLLFNSFEPYYMWDYVARWFEECCRRTLHVRLQIGPGDSNDSSELQLTNFCLLVDFLLDIVSLPTRSMRVLCQETYIEIQTEHLPQLLLRMISALTSHLQTLHLSELTDSLRLCSKILSKV 534          

HSP 3 Score: 100.908 bits (250), Expect = 3.244e-20
Identity = 82/297 (27.61%), Postives = 148/297 (49.83%), Query Frame = 3
Query: 2007 CQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2897
            CQL +E +S+P+Y      + S   S++      +   PQWL  L+ +    ++FS++S+A+S ++DL+  T+ V         +  +N+     ++ +SPN           ++QG+              +  +  KT+FF    L+LWD L    PQ HQ +V L  +LH   PS+SICE++I Q++   + +  +++H +F +LW L     +   N +S+      +R+FD+ + ++LDSL+    S        ++  +WL +  Q     +++ PLLL LL P T R+S+
Sbjct:  742 CQLFLECSSFPVYI-AEGNHTSELRSEKLETDCEHVQPPQWLQTLMNACSQASDFSVQSVAISLVMDLVGLTQSV-------AMVTGENINSVEPAQPLSPNQGRVAVVIRPPLTQGN--------------LRYIAEKTEFFKHVALTLWDQLGDGTPQHHQKSVELFYQLHNLVPSSSICEDVISQQLTHKDKKIRMEAHAKFAVLWHLTRDLHI---NKSSSF-----VRSFDRSLFIMLDSLNSLDGST------SSVGQAWLNQVLQRHDIARVLEPLLLLLLHPKTQRVSV 1002          
BLAST of Dopey_N domain-containing protein vs. Ensembl Human
Match: DOP1A (DOP1 leucine zipper like protein A [Source:HGNC Symbol;Acc:HGNC:21194])

HSP 1 Score: 395.201 bits (1014), Expect = 6.161e-110
Identity = 310/1153 (26.89%), Postives = 553/1153 (47.96%), Query Frame = 3
Query: 3498 SNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQI---GYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEK-------TTNILS-------DSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEI---NTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILW---EKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPLT-EKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCD----------IKSIKQN-----------DINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFL 6818
            S ++ IHPL+ H+LLY  +YDS+  LY+ S ++ I ++ P          I+  +   +   N+      +  QN    +L+RH  ++ G +FY +  ++   +F+S   +EI++ +C ++M S YP   T  KV+ +D+  N+ +Q+++ EIL  +  E+  +++    G+ +   D ++                 +C V K  LHC+ +SI   +K         N+++       DS++  +E   D       Q  L++++  ++ L++ + T       I  ++  G     +D +   P  ++ + S  Y  + P   ++ Q + L +++  +       +H      I S+L   GK    V++ +  +LC+N+    NL +   Q    T   DS  +   + +P D  L+ L  + A+ H+ LLD   + +QL            L ++  K               H+ +AR+ ++ ++   + S+ +LW    ++  SEK+ +       +  +G    +RQ IL ++ P+   H    + ++A VW    Q                   N+ +T    + +     + ++EL R +      T +I T ++++++   +  +K+   ++V +L+F   ++       L      L  LLK+SI  SLP    F++L +L++FI K    + K++QR++QD+  K+++ +  IAGSSLEQ +W RR  ++K           S +I  DG                                          +L +  ++  +  M T NI  TPS    ++ AL LL+  LA ++D+ + S+EKE+V P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D   +  W+ I+DNLMT DK TF++  T++ V Q   LNLF +++ E +Q AM +K+LAF I+SSE+DQY K +P+IQE+L ESLRL  +P + +Q+FL FRVLL+R+S QHLTSLW   I  L  V   +  +L  D          +  ++             +  + LN+YLSACK LD+   +  +++PQF  Y+WAF+    +++          Q  F+P++
Sbjct: 1348 SPNFNIHPLYQHVLLYLQLYDSSRTLYAFSAIKAILKTNP----------IAFVNAISTTSVNNAYTPQLSLLQN----LLARHRISVMGKDFYSHIPVDSNHNFRSSMYIEILISLCLYYMRSHYP---THVKVTAQDLIGNRNMQMMSIEILTLLFTELAKVIESSAKGFPSFISDMLS-----------------KCKVQKVILHCLLSSIFSAQKWHSEKMAGKNLVAVEEGFSEDSLINFSEDEFDNG--STLQSQLLKVLQRLIVLEHRVMT-------IPEENETGFDFVVSDLEHISP--HQPMTSLQYLHAQP---ITCQGMFLCAVIRALHQHCACKMHPQWIGLITSTLPYMGKVLQRVVVSVTLQLCRNLD---NLIQ---QYKYETGLSDSRPLWMASIIPPDMILTLLEGITAIIHYCLLDPTTQYHQL------------LVSVDQK---------------HLFEARSGILSILHMIMSSVTLLWSILHQADSSEKMTIAASASLTTINLGATKNLRQQILELLGPISMNHGVHFMAAIAFVWNERRQ-------------------NKTTTRTKVIPAASEEQLLLVELVRSISVMRAET-VIQTVKEVLKQPPAIAKDKKHLSLEVCMLQFFYAYIQRIPVPNLVDSWASLLILLKDSIQLSLPAPGQFLILGVLNEFIMKNPSLENKKDQRDLQDVTHKIVDAIGAIAGSSLEQTTWLRRNLEVK----------PSPKIMVDG-----------------------------------------TNLESDVEDMLSPAMETANI--TPS--VYSVHALTLLSEVLAHLLDMVFYSDEKERVIPLLVNIMH-YVVPYLRNHSAHNAPSYRACVQLLSSLSGYQYTRRAWKKEAFDLFMDPSFFQMDASCVNHWRAIMDNLMTHDKTTFRDLMTRVAVAQSSSLNLFANRDVELEQRAMLLKRLAFAIFSSEIDQYQKYLPDIQERLVESLRLPQVPTLHSQVFLFFRVLLLRMSPQHLTSLWPTMITELVQVFLLMEQELTADEDISRTSGPSVAGLETTYTGGNGFSTSYNSQRWLNLYLSACKFLDLALALPSENLPQFQMYRWAFIPEASDDSGLEVRRQGIHQREFKPYV 2343          

HSP 2 Score: 348.206 bits (892), Expect = 1.708e-95
Identity = 213/558 (38.17%), Postives = 329/558 (58.96%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIID-NPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQ------EVTPSQF-PSFQMTIDRICELVKFIL--IRLPI--------ETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  +D+K+RN+   +DK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++P+K  +GKRL+QCLHPALP GVH KALE +++IF IIGP++LA DLF+Y +G+FPLL+ +AM +K  L +LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +V+   FY+ LW  +L +P+VR  G  ++L H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G    R +                   +  E    YF  +S+++L+ A+  I+  N     +  +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L  +      L +E   + +    +   S +RE+ K+      E +KTANL F + +  + W+Y+ R F +  ++      ++ P     S ++ +   C LV F+L  + LP         ETY ++ + HLP LL  +   L  H+  L +  +   L++   I  K+
Sbjct:    4 EELELLSDSKYRNYVAAIDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPKKLTIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLANAAMSVKPTLLSLYEIYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYERTNMLLEKVAAAVDQSAFYSALWGSLLTSPAVRLPGITYVLAHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALHVVLRRDMSLNRRLYAWLLGPRSTRHS-------------------NPEEHATYYFTTFSKELLVQAMVGILQVNGFGEENTLMQDLKPFRILISLLDKPELGPVILEDVLIEVFRTLYSQCKAELDLQTEPPFSKDHAQLS---SKLRENKKTA-----ELIKTANLLFNSFEPYYMWDYVARWFEECCRRTLHVRLQIGPGDSNDSSELQLTNFCLLVDFLLDIVSLPTRSMRVLCQETYIEIQTEHLPQLLLRMISALTSHLQTLHLSELTDSLRLCSKILSKV 534          

HSP 3 Score: 100.908 bits (250), Expect = 3.244e-20
Identity = 82/297 (27.61%), Postives = 148/297 (49.83%), Query Frame = 3
Query: 2007 CQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2897
            CQL +E +S+P+Y      + S   S++      +   PQWL  L+ +    ++FS++S+A+S ++DL+  T+ V         +  +N+     ++ +SPN           ++QG+              +  +  KT+FF    L+LWD L    PQ HQ +V L  +LH   PS+SICE++I Q++   + +  +++H +F +LW L     +   N +S+      +R+FD+ + ++LDSL+    S        ++  +WL +  Q     +++ PLLL LL P T R+S+
Sbjct:  742 CQLFLECSSFPVYI-AEGNHTSELRSEKLETDCEHVQPPQWLQTLMNACSQASDFSVQSVAISLVMDLVGLTQSV-------AMVTGENINSVEPAQPLSPNQGRVAVVIRPPLTQGN--------------LRYIAEKTEFFKHVALTLWDQLGDGTPQHHQKSVELFYQLHNLVPSSSICEDVISQQLTHKDKKIRMEAHAKFAVLWHLTRDLHI---NKSSSF-----VRSFDRSLFIMLDSLNSLDGST------SSVGQAWLNQVLQRHDIARVLEPLLLLLLHPKTQRVSV 1002          
BLAST of Dopey_N domain-containing protein vs. Ensembl Human
Match: DOP1A (DOP1 leucine zipper like protein A [Source:HGNC Symbol;Acc:HGNC:21194])

HSP 1 Score: 394.43 bits (1012), Expect = 1.174e-109
Identity = 310/1153 (26.89%), Postives = 553/1153 (47.96%), Query Frame = 3
Query: 3498 SNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQI---GYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEK-------TTNILS-------DSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEI---NTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILW---EKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPLT-EKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCD----------IKSIKQN-----------DINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFL 6818
            S ++ IHPL+ H+LLY  +YDS+  LY+ S ++ I ++ P          I+  +   +   N+      +  QN    +L+RH  ++ G +FY +  ++   +F+S   +EI++ +C ++M S YP   T  KV+ +D+  N+ +Q+++ EIL  +  E+  +++    G+ +   D ++                 +C V K  LHC+ +SI   +K         N+++       DS++  +E   D       Q  L++++  ++ L++ + T       I  ++  G     +D +   P  ++ + S  Y  + P   ++ Q + L +++  +       +H      I S+L   GK    V++ +  +LC+N+    NL +   Q    T   DS  +   + +P D  L+ L  + A+ H+ LLD   + +QL            L ++  K               H+ +AR+ ++ ++   + S+ +LW    ++  SEK+ +       +  +G    +RQ IL ++ P+   H    + ++A VW    Q                   N+ +T    + +     + ++EL R +      T +I T ++++++   +  +K+   ++V +L+F   ++       L      L  LLK+SI  SLP    F++L +L++FI K    + K++QR++QD+  K+++ +  IAGSSLEQ +W RR  ++K           S +I  DG                                          +L +  ++  +  M T NI  TPS    ++ AL LL+  LA ++D+ + S+EKE+V P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D   +  W+ I+DNLMT DK TF++  T++ V Q   LNLF +++ E +Q AM +K+LAF I+SSE+DQY K +P+IQE+L ESLRL  +P + +Q+FL FRVLL+R+S QHLTSLW   I  L  V   +  +L  D          +  ++             +  + LN+YLSACK LD+   +  +++PQF  Y+WAF+    +++          Q  F+P++
Sbjct: 1357 SPNFNIHPLYQHVLLYLQLYDSSRTLYAFSAIKAILKTNP----------IAFVNAISTTSVNNAYTPQLSLLQN----LLARHRISVMGKDFYSHIPVDSNHNFRSSMYIEILISLCLYYMRSHYP---THVKVTAQDLIGNRNMQMMSIEILTLLFTELAKVIESSAKGFPSFISDMLS-----------------KCKVQKVILHCLLSSIFSAQKWHSEKMAGKNLVAVEEGFSEDSLINFSEDEFDNG--STLQSQLLKVLQRLIVLEHRVMT-------IPEENETGFDFVVSDLEHISP--HQPMTSLQYLHAQP---ITCQGMFLCAVIRALHQHCACKMHPQWIGLITSTLPYMGKVLQRVVVSVTLQLCRNLD---NLIQ---QYKYETGLSDSRPLWMASIIPPDMILTLLEGITAIIHYCLLDPTTQYHQL------------LVSVDQK---------------HLFEARSGILSILHMIMSSVTLLWSILHQADSSEKMTIAASASLTTINLGATKNLRQQILELLGPISMNHGVHFMAAIAFVWNERRQ-------------------NKTTTRTKVIPAASEEQLLLVELVRSISVMRAET-VIQTVKEVLKQPPAIAKDKKHLSLEVCMLQFFYAYIQRIPVPNLVDSWASLLILLKDSIQLSLPAPGQFLILGVLNEFIMKNPSLENKKDQRDLQDVTHKIVDAIGAIAGSSLEQTTWLRRNLEVK----------PSPKIMVDGT-----------------------------------------NLESDVEDMLSPAMETANI--TPS--VYSVHALTLLSEVLAHLLDMVFYSDEKERVIPLLVNIMH-YVVPYLRNHSAHNAPSYRACVQLLSSLSGYQYTRRAWKKEAFDLFMDPSFFQMDASCVNHWRAIMDNLMTHDKTTFRDLMTRVAVAQSSSLNLFANRDVELEQRAMLLKRLAFAIFSSEIDQYQKYLPDIQERLVESLRLPQVPTLHSQVFLFFRVLLLRMSPQHLTSLWPTMITELVQVFLLMEQELTADEDISRTSGPSVAGLETTYTGGNGFSTSYNSQRWLNLYLSACKFLDLALALPSENLPQFQMYRWAFIPEASDDSGLEVRRQGIHQREFKPYV 2352          

HSP 2 Score: 348.591 bits (893), Expect = 1.491e-95
Identity = 214/558 (38.35%), Postives = 334/558 (59.86%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIID-NPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQ------EVTPSQF-PSFQMTIDRICELVKFIL--IRLPI--------ETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  +D+K+RN+   +DK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++P+K  +GKRL+QCLHPALP GVH KALE +++IF IIGP++LA DLF+Y +G+FPLL+ +AM +K  L +LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +V+   FY+ LW  +L +P+VR  G  ++L H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G + + A     ++   +    + E     E    YF  +S+++L+ A+  I+  N     +  +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L  +      L +E   + +    +   S +RE+ K+      E +KTANL F + +  + W+Y+ R F +  ++      ++ P     S ++ +   C LV F+L  + LP         ETY ++ + HLP LL  +   L  H+  L +  +   L++   I  K+
Sbjct:    4 EELELLSDSKYRNYVAAIDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPKKLTIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLANAAMSVKPTLLSLYEIYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYERTNMLLEKVAAAVDQSAFYSALWGSLLTSPAVRLPGITYVLAHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALHVVLRRDMSLNRRLYAWLLGFDNNGA-----IIGPRSTRHSNPE-----EHATYYFTTFSKELLVQAMVGILQVNGFGEENTLMQDLKPFRILISLLDKPELGPVILEDVLIEVFRTLYSQCKAELDLQTEPPFSKDHAQLS---SKLRENKKTA-----ELIKTANLLFNSFEPYYMWDYVARWFEECCRRTLHVRLQIGPGDSNDSSELQLTNFCLLVDFLLDIVSLPTRSMRVLCQETYIEIQTEHLPQLLLRMISALTSHLQTLHLSELTDSLRLCSKILSKV 543          

HSP 3 Score: 100.908 bits (250), Expect = 3.615e-20
Identity = 82/297 (27.61%), Postives = 148/297 (49.83%), Query Frame = 3
Query: 2007 CQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2897
            CQL +E +S+P+Y      + S   S++      +   PQWL  L+ +    ++FS++S+A+S ++DL+  T+ V         +  +N+     ++ +SPN           ++QG+              +  +  KT+FF    L+LWD L    PQ HQ +V L  +LH   PS+SICE++I Q++   + +  +++H +F +LW L     +   N +S+      +R+FD+ + ++LDSL+    S        ++  +WL +  Q     +++ PLLL LL P T R+S+
Sbjct:  751 CQLFLECSSFPVYI-AEGNHTSELRSEKLETDCEHVQPPQWLQTLMNACSQASDFSVQSVAISLVMDLVGLTQSV-------AMVTGENINSVEPAQPLSPNQGRVAVVIRPPLTQGN--------------LRYIAEKTEFFKHVALTLWDQLGDGTPQHHQKSVELFYQLHNLVPSSSICEDVISQQLTHKDKKIRMEAHAKFAVLWHLTRDLHI---NKSSSF-----VRSFDRSLFIMLDSLNSLDGST------SSVGQAWLNQVLQRHDIARVLEPLLLLLLHPKTQRVSV 1011          
BLAST of Dopey_N domain-containing protein vs. Ensembl Human
Match: DOP1B (DOP1 leucine zipper like protein B [Source:HGNC Symbol;Acc:HGNC:1291])

HSP 1 Score: 299.671 bits (766), Expect = 9.840e-81
Identity = 190/516 (36.82%), Postives = 302/516 (58.53%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRS--------QLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNP--TSSASERISS-IKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLF---VKALKQEVTPSQFPSFQMTIDRICELVKFILIRLPIETYSDVHSRH 1532
            E+Q+  ND ++R++++ ++K L+ FE SSEWADLI++LGKL K LQ+N+R+ ++PR+ L+ KRL+QCLHPALP+GVH+KALE +++IF I+G + LA DLF+Y  G+FPLL+ +A+ ++  L  LYEKYF+ L   + P+    + GLLPGLEEG+E   R + +L + +  V    FYT LW  +L +PS+R   + F++ H NR     +Q Y LG +  L + SL   L D  VLVQR  L+ VLF    +           L  SD  ++ +A    LLRRDMSLNRR Y+WL+G+++ + N +    E  N ++ D  S         +F+KYS+D+L+  +  I+      +   ER  + +KPFR++ +L+D+ EIG  ++ ++   +I       +  + L S+  K +     N   S I+E+  +      E +KT NL   +L + F W+Y+ R F    + +KQ  +     S   T+  +C L+ F+L  +P+E YS+V +++
Sbjct:    4 EEQELLNDYRYRSYSSVIEKALRNFESSSEWADLISSLGKLNKALQSNLRYSLLPRRLLISKRLAQCLHPALPSGVHLKALETYEIIFKIVGTKWLAKDLFLYSCGLFPLLAHAAVSVRPVLLTLYEKYFLPLQKLLLPSLQAFIVGLLPGLEEGSEISDRTDALLLRLSLVVGKEVFYTALWGSVLASPSIRLPASVFVVGHINRDAPGREQKYMLGTNHQLTVKSLRASLLDSNVLVQRNNLEIVLFFFPFYTCLDSNERAIPLLRSDIVRILSAATQTLLRRDMSLNRRLYAWLLGSDI-KGNTVVPESEISNSYE-DQSSY--------FFEKYSKDLLVEGLAEILHQKFIDADVEERHHAYLKPFRVLISLLDKPEIGPQVVGNLFLEVIRAFYS--YCRDALGSDL-KLSYTQSGNSLISAIKENRNAS-----EIVKTVNLLITSLSTDFLWDYMTRCFEECFRPVKQRYSVRNSVSPPPTVSELCALLVFLLDVIPLELYSEVQTQY 501          

HSP 2 Score: 221.476 bits (563), Expect = 7.167e-57
Identity = 134/371 (36.12%), Postives = 207/371 (55.80%), Query Frame = 3
Query: 5922 TLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQ-NDINK-------------------RLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFT 6974
            ++QAL+LL   LAS++D+ Y+S+EKEK  P ++ +++  V PYLR  S+ N  +FR  +QL++SLS Y +T+R+WRK++ +L  +  FFQ D  S   WK IID+L+T +K  FK+     + +            + ++Q AM +K+ AF ++S ELDQY   +P IQE+L+++LR+G    +  Q+FL FRVLL+RIS QHLTSLW I +  L      L +DLK + +S++  N +N+                    L +YLSACK LD       D +P F  Y+WAF+  +D E   F S+        +P    +++      L  G   +S E+    + +E PL+ + S+ S+  L PFF T
Sbjct: 1895 SVQALSLLAEVLASLLDMVYRSDEKEKAVPLISRLLY-YVFPYLRNHSAYNAPSFRAGAQLLSSLSGYAYTKRAWRKEVLELFLDPAFFQMDT-SCVHWKSIIDHLLTHEKTMFKDLMNMQSSS--------LKLFSSFEQKAMLLKRQAFAVFSGELDQYHLYLPLIQERLTDNLRVGQTSIVAAQMFLFFRVLLLRISPQHLTSLWPIMVSELIQTFTQLEEDLKDEDESLRSTNKVNRTKVSVPDANGPSVGEIPQSELILYLSACKFLDTALSFPPDKMPLFQIYRWAFIPEVDTEGPAFLSDVEENHQECKPHTVRILE---LLKLKFGEISSSDEI---TMKSEFPLLRQHSVSSIRQLMPFFMT 2249          

HSP 3 Score: 139.043 bits (349), Expect = 8.038e-32
Identity = 173/758 (22.82%), Postives = 327/758 (43.14%), Query Frame = 3
Query: 3513 IHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVS--FDRCNVAKYALHCMSTSITQPEKTTNILS---------DSIMLLNES----GLDQRVRDAA-QVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILW----EKSSLSEKINLNQECIPPSWTMGRPDK-VRQMILSIIKPLMRQHPSIILISLARVWP------HLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPLTEKEEGQ--VKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNE 5696
            +  L  H+LLY   YDS  VLY+ S L  + ++ P   +  +                +++  S   + N I  +L+RH  AL G +FY     +          LE++  +C  F+ S YP      KVS  DI  N+ VQ+ + E+L  I+ +++++ +                  E KN+  +     RC V ++ L  +S S+   +K   + +         DS  L  ES    G DQ   +   Q+ L++L+  ++ L++ L  ++        ++++ + +   +++  L +  + + +  Y    P   ++ Q +L++++V  +       +H      +  SL  +GKS    + P V ++CKN+      YES  + +  +    S   N  P DY L+ L  L  + HF LL++A                       N++K   +  D      ++ +ARN +++ + R ++++ +LW    ++ +    ++L       S    +  K +RQ IL  + PL       +  ++A VW       H    ++   + SQ  L+  VC      + S L ++                  T+ H++   ++++++   +   +E    V + +L+F   FL       L      L G+LKES+  +L P   F+LL +L+DF+++    + K++Q+++Q++ QK+LE V  IAGSSLEQ SW  R  ++K       E   + E
Sbjct: 1221 VEALFKHILLYLQPYDSRRVLYAFSVLEAVLKTNPKEFIEAVSR--------------TSMDTSSTAHLNLISNLLARHQEALIGQSFYGKLQTQVPNVCPHSLLLELLTYLCLSFLRSYYP---CYLKVSHRDILGNRDVQVKSVEVLIRIMMQLVSVAKSS----------------EGKNVEFIHSLLQRCKVQEFVLLSLSASMYTSQKRYGLATAHHGRALPEDS--LFEESLINLGQDQIWSEHPLQIELLKLLQVLIVLEHHLGRAH--------EEAENQPDLSREWQRAL-NFQQAISALQYVQPHP---LTSQGLLVSAVVRGLQPAYGYGMHPAWVSLVTHSLPYFGKSLGWTVTPFVVQICKNLDDLVKQYES--ESVKLSVSTTSKRENISP-DYPLTLLEGLTTISHFCLLEQA-----------------------NQNKKTMAAGDP----ANLRNARNAILEELPRTVNTMALLWNVLRKEETQKRPVDLLGATKGSSSVYFKTTKTIRQKILDFLNPLTAHLGVQLTAAVAAVWSRKKAQRHSKMKIIPTASASQLTLVDLVC------ALSTLQTD------------------TLLHLV---KEVVKRPPQVKGGDEKSPLVDIPVLQFCYAFLQRLPVPALQENFSSLLGVLKESVQLNLAPPGYFLLLSMLNDFVTRTPNLENKKDQKDLQEITQKILEAVGNIAGSSLEQTSWLSRNLEVKAQPQASLEESDAEE 1874          

HSP 4 Score: 77.7962 bits (190), Expect = 3.245e-13
Identity = 73/313 (23.32%), Postives = 136/313 (43.45%), Query Frame = 3
Query: 1989 EVYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCIS----------WLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2897
            E +   C L+++  ++P+Y +  E+ E +  +   +    +   P WL  L+T  C + +  ++++A+S LL++I        H      +    MK++ +S          NP   K          V +  ++  +++ +  KT F+      LW+ L+    + H   V L  RLH  AP+A+ICE++I   +L  +    L++  RF ++W L  + + S    ++        R+FD+ +                 VVL +L  +          WL +A   G   +I+ P+LL LL+P T R S+
Sbjct:  748 EAFAAACHLLLDCATFPVYLS-EEETEQLCATLFQLPGAGDSSFPSWLKSLMTICCCVTDCYLQNVAISTLLEVI-------NHSQSLALVIEDKMKRYKSS--------GHNPFFGK-------LQMVTVPPIAPGILKVIAEKTDFYQRVARVLWNQLNKETREHHVTCVELFYRLHCLAPTANICEDIICHALLDPDKGTRLEALFRFSVIWHLTREIQGSRVTSHN--------RSFDRSL----------------FVVLDSLACTDGAIGAAAQGWLVRALSLGDVARILEPVLLLLLQPKTQRTSI 1013          
BLAST of Dopey_N domain-containing protein vs. Ensembl Human
Match: DOP1B (DOP1 leucine zipper like protein B [Source:HGNC Symbol;Acc:HGNC:1291])

HSP 1 Score: 167.548 bits (423), Expect = 5.313e-47
Identity = 72/141 (51.06%), Postives = 110/141 (78.01%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAF 449
            E+Q+  ND ++R++++ ++K L+ FE SSEWADLI++LGKL K LQ+N+R+ ++PR+ L+ KRL+QCLHPALP+GVH+KALE +++IF I+G + LA DLF+Y  G+FPLL+ +A+ ++  L  LYEKYF+ L   + P+ 
Sbjct:    4 EEQELLNDYRYRSYSSVIEKALRNFESSSEWADLISSLGKLNKALQSNLRYSLLPRRLLISKRLAQCLHPALPSGVHLKALETYEIIFKIVGTKWLAKDLFLYSCGLFPLLAHAAVSVRPVLLTLYEKYFLPLQKLLLPSL 144          
BLAST of Dopey_N domain-containing protein vs. Ensembl Celegans
Match: pad-1 (pep chromosome:WBcel235:I:12878595:12902806:1 gene:WBGene00003905.1 transcript:Y18D10A.13.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:pad-1)

HSP 1 Score: 275.018 bits (702), Expect = 1.672e-73
Identity = 309/1269 (24.35%), Postives = 551/1269 (43.42%), Query Frame = 3
Query: 3510 LIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQ-PEKTTNI---------LSDSIMLLNESGLDQRVR-----DAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTS-IVACIGAMKLR-HLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANL-YESCNQIIPYTKDV--DS-----NEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSY----------------------QLQEEKGSSSEQSF----------------------LGALFNKSKDN---TSKEDS-MSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNL--NSEQFRVICILELARGLKKSFTITHIINTCRD------------IIRKSFPLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKES-ISSLPPTAAFILLKILSDFISKVS---ISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTG--------DERP-------GSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQ-NESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQN------DINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKP-LIYRQSIHSLTDLAPFFFT 6974
            L   +H+HMLLY      +G +  L++  T FR L  ++ P                S+     S +  ++ ++E+++RH  A+ G +F+  P  +E +  K    LE+++ +   F+ S +  +     V+  D+    K +I A E L  + +E+  +L      H      Q           +   +R  + K  LH + T++   P ++++          LS SI   NE  L +  R      A   +L+    + ++L+  +   +          SD  S+++        S+ +++ +  +   +  +     ++ L + ++  + A+K + H H    QF++  L    +S + ++  +V++LCKN+  A ++ YE+     P T DV  DS     +E +  P +Y   T+  L  + HF ++D    S                       Q+  E  + +  S                       LG +F+ S D+    SK DS    G     A++ M+  +   + ++  +W          + +   PP   +G   ++R+++L ++ P+ + H    L SLA VW             ++S     V L +     +    +S Q  +  +L   + +     I+ + +T R+            I + +FP  E         LLE +   +     T+L L    L  L  E+ +S+L   A F+L  ILSDF+  V    I ++K   R +Q++C ++ E V  I G  LE  +W +R   +K D  +         D+ P        SN     G +   + +      + IN        GS   ST ++ +     +   +  N  A    T N R  P+  T   QAL LL   L  ++D   KS+EK+KV P L +V + NV+PYL+ +++ N   F  SSQL+AS+SSY + R  W+K   DLL +S FF+ D  +LK W V+ D+LMT D+ +FK+    ++ +     ++ TSKE EY+  A  +K+L F+++ S+LDQY   M +IQE+LS++LR+   P I + +FLC RVLL+R+    L  +W    PI+ + L + +  L+  ++S +Q+        ++ + +Y++ACKLL+ +  +    +  F  + WAFV ++  +             +F+PF   + D   + Y  L  P        E + N    L   + + S  +L PFF+T
Sbjct: 1196 LFEEMHTHMLLY----GESGKVVDLARAETAFRILTALLAP--RGATGNRMLLNCLVSSGTTTTSDSSAEHSLVELMNRHVRAILGQHFWSAPASDE-EKHKHITLLELLITISLHFLRSYFLNSPIS-PVTEADLTSLWKCKISALEFLCELFRELSAMLN----EHESKQFVQ---------FVQTILNRSKLQKCILHLLLTAVDHNPMESSSSKKTGGGGGPLSVSISKFNEGLLGESRRLSPLLAAYHRSLLTFTSHAIRLECDIKRGFATF-------SDANSSHRF-------SIIQSVMNQSFNNRTSRVDNHASTVELRAFLLILLNALKKQPHRHEMWLQFVVQILPWVERSLATIVCRVVEQLCKNMENAMSVAYEN-----PPTSDVVVDSPGDVRDEPDCYPANYLAMTMELLTTLVHFCVIDSVPTSAVAGGAPGVGGAGGVTSSSGGVQQVIHENATPTPSSTSMVGHAMSVIPGSKVATELFSQLGKVFSMSGDSGGVISKLDSSRQHGNGWRQAQSDMLSSLPHSLATICNVW---------TVVRRAQPPIVPIGTNSQLRRLVLHLLSPIAQYHKHAFLTSLALVW------------LTRSTAKPTVTLRKQDPDRATFEYSSAQLDITNLLLSLQVIPFEDLISSVNSTLREASFKANKVGITTIDKANFPTEEP--------LLELVHSCVSAVLQTQLRLCWSSLLSLFSEAPLSALSARAVFLLFVILSDFVKCVGGAYIVEDKAMYRNVQEVCSRLAEAVNAIVGWQLETTTWLKRTLVVKQDHGSSISSSIRSVDQSPIIEIQSSMSNVSGGGGSLDNPSGSTRNSTLSLINKPGGSIGTGSSVTSTLVDSKSENMKIEKKSSSNLRASIKDTNNNRRDPAHST---QALFLLAERLTDLLDSVSKSDEKDKVLPTLQAV-WANVVPYLKAKNARNARFFLASSQLLASMSSYSYMRPVWKKTTLDLLLDSGFFKMDHSALKQWLVVTDHLMTHDRTSFKDLLKSISYSPNTSFSIMTSKEQEYEARAQALKRLTFVVFGSQLDQYHGQMNDIQERLSDNLRVSQSPVIRSAVFLCIRVLLLRLRPHSLIGVW----PIMVTELVHALSQLEQQLQSGEQDSGATAASSDQWMQLYVAACKLLETLCTLPAGYLSHFQMFHWAFVSSVSADKT----------EIFKPFAERINDLLAKKYGELLTP--------ETMSNHTASLGAVKILTSFEELRPFFYT 2369          

HSP 2 Score: 240.35 bits (612), Expect = 5.985e-63
Identity = 150/396 (37.88%), Postives = 234/396 (59.09%), Query Frame = 3
Query:   48 DNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQ-QVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKW-----IIDNPTSS----------ASERI--SSIKPFRIITTLMDRSEIGGDIIEDILFNLI 1181
            D+K+R +A  +D+ LK FE  +EWADLI+ LGKL K+ Q+N +F  IP +  V KRLSQCLHPALP GVH+KALE +  IF I+GP KL + L+++  G+FPL+    + +K+ LF ++E Y V LG ++RPA  G L G+L  LEEG EFY R   +L++  E V P  FY CLWQ +L +P VR     ++   F++  S DDQ++ +G+ ++ M+ +L  + +D    LVQR  LDF++ A  +  + LT  D  +L   CL V+LRRDMSLNRR Y+WL    ++R+       E+  V    L    ++ ++L +FK+    ++  A+        I+ P ++           +E++  + ++  R++  L DR++IG  I+E +  + +
Sbjct:   16 DSKYRAYAKAIDQALKTFETPNEWADLISALGKLAKVFQSNAKFCAIPNRVTVAKRLSQCLHPALPMGVHLKALETYRQIFEILGPNKLPECLYLFAVGLFPLMDHCGIKVKSELFTIFENYLVPLGANLRPALPGFLGGVLLALEEGTEFYERSFILLDRVCEKVGPRAFYACLWQAILGSPPVRLPAMIYVNAKFDKLKSLDDQIHLVGDHVNHMVAALCAVADDTGSPLVQRYLLDFLVAAFPLDSTNLTNEDFVQLLRRCLFVVLRRDMSLNRRLYTWL----INRSG------ETKGVSGLSLGG-PDDGIELTFFKERVLGLVHGALGEYLALDTIETPFANHQNSMWGDRKEAEQVQFAEVRVCRLLLYLQDRADIGRTILETVFADFL 400          
BLAST of Dopey_N domain-containing protein vs. Ensembl Celegans
Match: pad-1 (pep chromosome:WBcel235:I:12878639:12902806:1 gene:WBGene00003905.1 transcript:Y18D10A.13.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:pad-1)

HSP 1 Score: 275.018 bits (702), Expect = 1.672e-73
Identity = 309/1269 (24.35%), Postives = 551/1269 (43.42%), Query Frame = 3
Query: 3510 LIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQ-PEKTTNI---------LSDSIMLLNESGLDQRVR-----DAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTS-IVACIGAMKLR-HLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANL-YESCNQIIPYTKDV--DS-----NEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSY----------------------QLQEEKGSSSEQSF----------------------LGALFNKSKDN---TSKEDS-MSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNL--NSEQFRVICILELARGLKKSFTITHIINTCRD------------IIRKSFPLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKES-ISSLPPTAAFILLKILSDFISKVS---ISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTG--------DERP-------GSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQ-NESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQN------DINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKP-LIYRQSIHSLTDLAPFFFT 6974
            L   +H+HMLLY      +G +  L++  T FR L  ++ P                S+     S +  ++ ++E+++RH  A+ G +F+  P  +E +  K    LE+++ +   F+ S +  +     V+  D+    K +I A E L  + +E+  +L      H      Q           +   +R  + K  LH + T++   P ++++          LS SI   NE  L +  R      A   +L+    + ++L+  +   +          SD  S+++        S+ +++ +  +   +  +     ++ L + ++  + A+K + H H    QF++  L    +S + ++  +V++LCKN+  A ++ YE+     P T DV  DS     +E +  P +Y   T+  L  + HF ++D    S                       Q+  E  + +  S                       LG +F+ S D+    SK DS    G     A++ M+  +   + ++  +W          + +   PP   +G   ++R+++L ++ P+ + H    L SLA VW             ++S     V L +     +    +S Q  +  +L   + +     I+ + +T R+            I + +FP  E         LLE +   +     T+L L    L  L  E+ +S+L   A F+L  ILSDF+  V    I ++K   R +Q++C ++ E V  I G  LE  +W +R   +K D  +         D+ P        SN     G +   + +      + IN        GS   ST ++ +     +   +  N  A    T N R  P+  T   QAL LL   L  ++D   KS+EK+KV P L +V + NV+PYL+ +++ N   F  SSQL+AS+SSY + R  W+K   DLL +S FF+ D  +LK W V+ D+LMT D+ +FK+    ++ +     ++ TSKE EY+  A  +K+L F+++ S+LDQY   M +IQE+LS++LR+   P I + +FLC RVLL+R+    L  +W    PI+ + L + +  L+  ++S +Q+        ++ + +Y++ACKLL+ +  +    +  F  + WAFV ++  +             +F+PF   + D   + Y  L  P        E + N    L   + + S  +L PFF+T
Sbjct: 1196 LFEEMHTHMLLY----GESGKVVDLARAETAFRILTALLAP--RGATGNRMLLNCLVSSGTTTTSDSSAEHSLVELMNRHVRAILGQHFWSAPASDE-EKHKHITLLELLITISLHFLRSYFLNSPIS-PVTEADLTSLWKCKISALEFLCELFRELSAMLN----EHESKQFVQ---------FVQTILNRSKLQKCILHLLLTAVDHNPMESSSSKKTGGGGGPLSVSISKFNEGLLGESRRLSPLLAAYHRSLLTFTSHAIRLECDIKRGFATF-------SDANSSHRF-------SIIQSVMNQSFNNRTSRVDNHASTVELRAFLLILLNALKKQPHRHEMWLQFVVQILPWVERSLATIVCRVVEQLCKNMENAMSVAYEN-----PPTSDVVVDSPGDVRDEPDCYPANYLAMTMELLTTLVHFCVIDSVPTSAVAGGAPGVGGAGGVTSSSGGVQQVIHENATPTPSSTSMVGHAMSVIPGSKVATELFSQLGKVFSMSGDSGGVISKLDSSRQHGNGWRQAQSDMLSSLPHSLATICNVW---------TVVRRAQPPIVPIGTNSQLRRLVLHLLSPIAQYHKHAFLTSLALVW------------LTRSTAKPTVTLRKQDPDRATFEYSSAQLDITNLLLSLQVIPFEDLISSVNSTLREASFKANKVGITTIDKANFPTEEP--------LLELVHSCVSAVLQTQLRLCWSSLLSLFSEAPLSALSARAVFLLFVILSDFVKCVGGAYIVEDKAMYRNVQEVCSRLAEAVNAIVGWQLETTTWLKRTLVVKQDHGSSISSSIRSVDQSPIIEIQSSMSNVSGGGGSLDNPSGSTRNSTLSLINKPGGSIGTGSSVTSTLVDSKSENMKIEKKSSSNLRASIKDTNNNRRDPAHST---QALFLLAERLTDLLDSVSKSDEKDKVLPTLQAV-WANVVPYLKAKNARNARFFLASSQLLASMSSYSYMRPVWKKTTLDLLLDSGFFKMDHSALKQWLVVTDHLMTHDRTSFKDLLKSISYSPNTSFSIMTSKEQEYEARAQALKRLTFVVFGSQLDQYHGQMNDIQERLSDNLRVSQSPVIRSAVFLCIRVLLLRLRPHSLIGVW----PIMVTELVHALSQLEQQLQSGEQDSGATAASSDQWMQLYVAACKLLETLCTLPAGYLSHFQMFHWAFVSSVSADKT----------EIFKPFAERINDLLAKKYGELLTP--------ETMSNHTASLGAVKILTSFEELRPFFYT 2369          

HSP 2 Score: 240.35 bits (612), Expect = 5.985e-63
Identity = 150/396 (37.88%), Postives = 234/396 (59.09%), Query Frame = 3
Query:   48 DNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQ-QVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKW-----IIDNPTSS----------ASERI--SSIKPFRIITTLMDRSEIGGDIIEDILFNLI 1181
            D+K+R +A  +D+ LK FE  +EWADLI+ LGKL K+ Q+N +F  IP +  V KRLSQCLHPALP GVH+KALE +  IF I+GP KL + L+++  G+FPL+    + +K+ LF ++E Y V LG ++RPA  G L G+L  LEEG EFY R   +L++  E V P  FY CLWQ +L +P VR     ++   F++  S DDQ++ +G+ ++ M+ +L  + +D    LVQR  LDF++ A  +  + LT  D  +L   CL V+LRRDMSLNRR Y+WL    ++R+       E+  V    L    ++ ++L +FK+    ++  A+        I+ P ++           +E++  + ++  R++  L DR++IG  I+E +  + +
Sbjct:   16 DSKYRAYAKAIDQALKTFETPNEWADLISALGKLAKVFQSNAKFCAIPNRVTVAKRLSQCLHPALPMGVHLKALETYRQIFEILGPNKLPECLYLFAVGLFPLMDHCGIKVKSELFTIFENYLVPLGANLRPALPGFLGGVLLALEEGTEFYERSFILLDRVCEKVGPRAFYACLWQAILGSPPVRLPAMIYVNAKFDKLKSLDDQIHLVGDHVNHMVAALCAVADDTGSPLVQRYLLDFLVAAFPLDSTNLTNEDFVQLLRRCLFVVLRRDMSLNRRLYTWL----INRSG------ETKGVSGLSLGG-PDDGIELTFFKERVLGLVHGALGEYLALDTIETPFANHQNSMWGDRKEAEQVQFAEVRVCRLLLYLQDRADIGRTILETVFADFL 400          
BLAST of Dopey_N domain-containing protein vs. Ensembl Fly
Match: CG15099 (gene:FBgn0034400 transcript:FBtr0086628)

HSP 1 Score: 312.383 bits (799), Expect = 8.590e-85
Identity = 188/514 (36.58%), Postives = 289/514 (56.23%), Query Frame = 3
Query:   21 MIEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALK-----QEVTPSQFPSFQMTID---------RICELVKFILIRLPIETYSDV 1520
            ++E+Q    + K+R +   +DK L+ FEYSSEWADLI+ LGKL K + +N ++ +IPR+  + KRL+QC+HPALP+GVH+KALE + VIFS  GP +LA + FIY  G+FPLL  +AM+++  L  +YE YFV LG  +RPA  G L G+LPG + G + + R + +L+Q   +V P++FYT LW+ +    ++R     +LL HFN+RL   +Q+Y +G++  +M+++L   LND  +LVQR  L+F+L    MH   L+  D  KL    L  +LRRDMSLNRR +SWL+G+ + + N   +   S +     LE   E      YF K+SR ILI A+   +      A      +KP+RI+ +L+D++EIG  +++ +L ++I    +  +I     S  N                           E LK+ANL FA  D ++ W+Y+  +F KA +     QE + +   S +   D          IC L +F+L  + +E Y++ 
Sbjct:    7 LVEEQKLMAEAKYRTYMTNIDKALRNFEYSSEWADLISALGKLSKAISSNTQYQVIPRRLKIAKRLAQCMHPALPSGVHLKALETYSVIFSKTGPERLATE-FIYSAGLFPLLGYAAMNVRPALLAIYETYFVPLGDKLRPALSGFLNGVLPGYDCGLDHFERISALLKQVCNAVNPMHFYTVLWESVANNAAIRLPAITYLLEHFNKRLDMQEQIYIMGHNREIMMSALCVCLNDSLILVQRNTLEFLLLGFPMHTVLLSEDDLVKLVTNGLNTILRRDMSLNRRLFSWLLGSEVAK-NSPTYDTLSLDTSNAPLEEEPEP-----YFVKHSRHILIKALITTLRLSLECAP---MDLKPYRIMLSLLDKAEIGSAVLDYVLHDII----RAMYI-----SSGNA--------------------------EALKSANLLFATFDPAYIWSYMTNMFEKACQQANSMQEKSQAGETSGKYACDVGSGDPCVLEICVLTEFLLETVSLEMYTET 475          

HSP 2 Score: 243.817 bits (621), Expect = 6.052e-64
Identity = 153/444 (34.46%), Postives = 242/444 (54.50%), Query Frame = 3
Query: 5922 TLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRL-GMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQ-------------------NDINKRLNM------YLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRP------FLTLVIDSYIQYYLSLG----IPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFTASLRNDLNQEARATQYGITVVNEKDINADCNNNSCGRFFNFENEVEMILDNEFVEPI 7145
            +LQA ++L   L++++DV Y S+EK+KV   +T +++ N+ PYL+  ++ N+  F   S L+ASLS YQ+TR++WRKD+ DLL ++ FFQ  +  L  W++I+D+LMT D  TF+E  T+++++Q G LN+FTS++ EY+Q AM +K+LAF+IY SE DQ+ K MP+IQE+L+ SLRL  M P ++  +FLCFRVLL+R+S  H+TSLW I I  +  V   +  +LK + +   Q                   N  N +  M       L ACKLL++  ++    +P F  Y+WAFVG     T +    D++ + V  P        TL    Y+ +   +     +   S   + +   N   +++ Q + SL +L  FF               T  GI+    ++  AD  N+      N   E+E +L N+F+E +
Sbjct: 2179 SLQAQSVLAAILSNLLDVAYGSQEKDKVVNIVTPLLY-NITPYLKNHTARNVPFFYACSALLASLSGYQYTRKAWRKDMLDLLLDNAFFQMHLSCLPFWRMIMDSLMTYDNTTFRELMTRVSLSQAGSLNIFTSRDQEYEQRAMLLKRLAFVIYCSEFDQHNKYMPDIQEQLANSLRLVPMGPSVQAAVFLCFRVLLLRMSPDHVTSLWPIIIAEMVQVFLQMEQELKSESEERNQQLRLPSGIDVSWSAASGASNGYNSQTPMQHWRSVQLEACKLLELGCVLPATKLPHFQMYRWAFVG-----TEF----DVHEEEVCLPNGSLENLATLPSALYVPHVRRVARLMDMKYTSQSPILQRPSNRHLMLHFQQLQSLQELYAFF---------------TTLGISCPQPRNF-ADTENDVA----NCLKEIEEVLANDFLEKL 2592          

HSP 3 Score: 136.346 bits (342), Expect = 2.710e-31
Identity = 162/754 (21.49%), Postives = 325/754 (43.10%), Query Frame = 3
Query: 3516 HPLHSHMLLYCSIYDSNGVLYSLSKLRTIF----RSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQN-PTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFK---VSFEDIFENKKVQILASEILDFIVQEMLTILQ---IGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSIT----QPEKTTNILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWG-KSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSY------QLQEEKGSSSEQSFLGALFN--------KSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNS--EQFRVICILELARGLK-KSFTIT--HIINTCRDIIRKSFPLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSIS--DEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSD 5666
            H  H+H+L+Y +IYD+   LY+L  LR I     R+   + +                        + +F    + ++L RH  ++ G  F  +    E  Q ++    LE+++ +C ++    +       +    + +DI  N+++Q+ + E+L  I  E++ I++    G  N+  D +                  R  + K  LHC+++S+     +    +   ++ ++  N+   DQ   D  Q+ L+RL+L V++L++ ++     +     +DS G ++       P         +  Y    P   +S+Q + L +++  +   +LRHLH      + SSL  +   S + +++ +V +LC N+   + +       +P  +          P DY +S L  L  +CH+ LLD   ++       Q   +  SS++ S  G L N         S+ +TS     +P   +  ARN ++  + R + S+  +W+                    +G+   VRQ +L  + P+   H S  L ++A  W        ++G          + + E    NS L +   Q  ++ ++   R +   SF +T  H++ +   I R    L+      ++V+ LE    ++ +  + +L+     L  L+++ ++  PP A F LL +L++F+ +       +K+E RE+ D+  +++++++ +AGS LEQ +W RR   +K D+D
Sbjct: 1511 HLYHNHLLIYLAIYDTRQTLYALQTLRNIICCDKRTFLCLSI------------------------TTSFSSASLKQLLVRHRKSISGKGFDGSVGNSEYAQGYRGCMQLELLVTLCLFYARGYFQKESLDAQRQSPTLQDIVNNRRIQLESIELLTLICSELIEIVKGMGRGLANYIADLLA-----------------RAKLQKVMLHCLNSSVCSYGLKGNTNSGSYAEQVLSFNDPQDDQLHADCFQLQLLRLLLAVIRLEHEVHQLRQDTPPAAGEDSAGNAS-------PTRLAEGATANVKYL---PNCLISQQPMFLAAVLGALQQERLRHLHRNWTDLVTSSLNCFSFGSLTNIVISVVHQLCSNLDRISKMG------LPQQRH--------FPPDYVVSQLEALTILCHYCLLDNTQQTALSHLFNQAYPQTSSSAQSSSTGQLLNSIVHSFLSASESSTSAPAPRNP--QLQAARNAVLSHLPRIMSSVAAIWDSE------------------LGQLRPVRQQLLEFLSPVSLHHGSNFLAAVAVTWQQRGIATNMNG----------LSIAEQFQRNSVLQACPAQLSLVSLVSSIRVMPMDSFVMTLHHVVRSPPPIHRPPAQLS------IEVSALELFYFYMKSAPAPQLADAWSSLLALIRDGLNLTPP-AQFALLMLLNEFVQRCPQMPFQDKKEVRELHDVTSRLVDSLSSVAGSCLEQTTWLRRNLAVKEDTD 2162          
BLAST of Dopey_N domain-containing protein vs. Ensembl Fly
Match: CG15099 (gene:FBgn0034400 transcript:FBtr0330054)

HSP 1 Score: 311.997 bits (798), Expect = 1.005e-84
Identity = 188/514 (36.58%), Postives = 289/514 (56.23%), Query Frame = 3
Query:   21 MIEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALK-----QEVTPSQFPSFQMTID---------RICELVKFILIRLPIETYSDV 1520
            ++E+Q    + K+R +   +DK L+ FEYSSEWADLI+ LGKL K + +N ++ +IPR+  + KRL+QC+HPALP+GVH+KALE + VIFS  GP +LA + FIY  G+FPLL  +AM+++  L  +YE YFV LG  +RPA  G L G+LPG + G + + R + +L+Q   +V P++FYT LW+ +    ++R     +LL HFN+RL   +Q+Y +G++  +M+++L   LND  +LVQR  L+F+L    MH   L+  D  KL    L  +LRRDMSLNRR +SWL+G+ + + N   +   S +     LE   E      YF K+SR ILI A+   +      A      +KP+RI+ +L+D++EIG  +++ +L ++I    +  +I     S  N                           E LK+ANL FA  D ++ W+Y+  +F KA +     QE + +   S +   D          IC L +F+L  + +E Y++ 
Sbjct:    7 LVEEQKLMAEAKYRTYMTNIDKALRNFEYSSEWADLISALGKLSKAISSNTQYQVIPRRLKIAKRLAQCMHPALPSGVHLKALETYSVIFSKTGPERLATE-FIYSAGLFPLLGYAAMNVRPALLAIYETYFVPLGDKLRPALSGFLNGVLPGYDCGLDHFERISALLKQVCNAVNPMHFYTVLWESVANNAAIRLPAITYLLEHFNKRLDMQEQIYIMGHNREIMMSALCVCLNDSLILVQRNTLEFLLLGFPMHTVLLSEDDLVKLVTNGLNTILRRDMSLNRRLFSWLLGSEVAK-NSPTYDTLSLDTSNAPLEEEPEP-----YFVKHSRHILIKALITTLRLSLECAP---MDLKPYRIMLSLLDKAEIGSAVLDYVLHDII----RAMYI-----SSGNA--------------------------EALKSANLLFATFDPAYIWSYMTNMFEKACQQANSMQEKSQAGETSGKYACDVGSGDPCVLEICVLTEFLLETVSLEMYTET 475          

HSP 2 Score: 244.202 bits (622), Expect = 5.281e-64
Identity = 153/444 (34.46%), Postives = 242/444 (54.50%), Query Frame = 3
Query: 5922 TLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRL-GMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQ-------------------NDINKRLNM------YLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRP------FLTLVIDSYIQYYLSLG----IPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFTASLRNDLNQEARATQYGITVVNEKDINADCNNNSCGRFFNFENEVEMILDNEFVEPI 7145
            +LQA ++L   L++++DV Y S+EK+KV   +T +++ N+ PYL+  ++ N+  F   S L+ASLS YQ+TR++WRKD+ DLL ++ FFQ  +  L  W++I+D+LMT D  TF+E  T+++++Q G LN+FTS++ EY+Q AM +K+LAF+IY SE DQ+ K MP+IQE+L+ SLRL  M P ++  +FLCFRVLL+R+S  H+TSLW I I  +  V   +  +LK + +   Q                   N  N +  M       L ACKLL++  ++    +P F  Y+WAFVG     T +    D++ + V  P        TL    Y+ +   +     +   S   + +   N   +++ Q + SL +L  FF               T  GI+    ++  AD  N+      N   E+E +L N+F+E +
Sbjct: 2179 SLQAQSVLAAILSNLLDVAYGSQEKDKVVNIVTPLLY-NITPYLKNHTARNVPFFYACSALLASLSGYQYTRKAWRKDMLDLLLDNAFFQMHLSCLPFWRMIMDSLMTYDNTTFRELMTRVSLSQAGSLNIFTSRDQEYEQRAMLLKRLAFVIYCSEFDQHNKYMPDIQEQLANSLRLVPMGPSVQAAVFLCFRVLLLRMSPDHVTSLWPIIIAEMVQVFLQMEQELKSESEERNQQLRLPSGIDVSWSAASGASNGYNSQTPMQHWRSVQLEACKLLELGCVLPATKLPHFQMYRWAFVG-----TEF----DVHEEEVCLPNGSLENLATLPSALYVPHVRRVARLMDMKYTSQSPILQRPSNRHLMLHFQQLQSLQELYAFF---------------TTLGISCPQPRNF-ADTENDVA----NCLKEIEEVLANDFLEKL 2592          

HSP 3 Score: 136.346 bits (342), Expect = 2.782e-31
Identity = 162/754 (21.49%), Postives = 325/754 (43.10%), Query Frame = 3
Query: 3516 HPLHSHMLLYCSIYDSNGVLYSLSKLRTIF----RSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQN-PTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFK---VSFEDIFENKKVQILASEILDFIVQEMLTILQ---IGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSIT----QPEKTTNILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWG-KSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSY------QLQEEKGSSSEQSFLGALFN--------KSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNS--EQFRVICILELARGLK-KSFTIT--HIINTCRDIIRKSFPLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSIS--DEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSD 5666
            H  H+H+L+Y +IYD+   LY+L  LR I     R+   + +                        + +F    + ++L RH  ++ G  F  +    E  Q ++    LE+++ +C ++    +       +    + +DI  N+++Q+ + E+L  I  E++ I++    G  N+  D +                  R  + K  LHC+++S+     +    +   ++ ++  N+   DQ   D  Q+ L+RL+L V++L++ ++     +     +DS G ++       P         +  Y    P   +S+Q + L +++  +   +LRHLH      + SSL  +   S + +++ +V +LC N+   + +       +P  +          P DY +S L  L  +CH+ LLD   ++       Q   +  SS++ S  G L N         S+ +TS     +P   +  ARN ++  + R + S+  +W+                    +G+   VRQ +L  + P+   H S  L ++A  W        ++G          + + E    NS L +   Q  ++ ++   R +   SF +T  H++ +   I R    L+      ++V+ LE    ++ +  + +L+     L  L+++ ++  PP A F LL +L++F+ +       +K+E RE+ D+  +++++++ +AGS LEQ +W RR   +K D+D
Sbjct: 1511 HLYHNHLLIYLAIYDTRQTLYALQTLRNIICCDKRTFLCLSI------------------------TTSFSSASLKQLLVRHRKSISGKGFDGSVGNSEYAQGYRGCMQLELLVTLCLFYARGYFQKESLDAQRQSPTLQDIVNNRRIQLESIELLTLICSELIEIVKGMGRGLANYIADLLA-----------------RAKLQKVMLHCLNSSVCSYGLKGNTNSGSYAEQVLSFNDPQDDQLHADCFQLQLLRLLLAVIRLEHEVHQLRQDTPPAAGEDSAGNAS-------PTRLAEGATANVKYL---PNCLISQQPMFLAAVLGALQQERLRHLHRNWTDLVTSSLNCFSFGSLTNIVISVVHQLCSNLDRISKMG------LPQQRH--------FPPDYVVSQLEALTILCHYCLLDNTQQTALSHLFNQAYPQTSSSAQSSSTGQLLNSIVHSFLSASESSTSAPAPRNP--QLQAARNAVLSHLPRIMSSVAAIWDSE------------------LGQLRPVRQQLLEFLSPVSLHHGSNFLAAVAVTWQQRGIATNMNG----------LSIAEQFQRNSVLQACPAQLSLVSLVSSIRVMPMDSFVMTLHHVVRSPPPIHRPPAQLS------IEVSALELFYFYMKSAPAPQLADAWSSLLALIRDGLNLTPP-AQFALLMLLNEFVQRCPQMPFQDKKEVRELHDVTSRLVDSLSSVAGSCLEQTTWLRRNLAVKEDTD 2162          
BLAST of Dopey_N domain-containing protein vs. Ensembl Zebrafish
Match: dop1a (DOP1 leucine zipper like protein A [Source:ZFIN;Acc:ZDB-GENE-050309-65])

HSP 1 Score: 364.77 bits (935), Expect = 1.102e-100
Identity = 235/592 (39.70%), Postives = 341/592 (57.60%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSASER---ISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLE---KEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLF---VKALKQEVTPSQFPSFQMTIDRI---CELVKFIL--IRLPI--------ETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKIFQNASQTFDVSTLHNPVSIPTSNSTARKPS 1736
            E+ +   D+K+RN+   VDK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++P+K  +GKRL+QCLHPALP+GVH KALE +++IF IIGP++LA DLF+Y +G+FPLLS +AM +K  L  LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +VE   FY+ LW  +L +P+VR  G  F+L H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G +    N +K    S  +   +       E    YF  YS+++LI A+  I+        E    +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L    +    L+     +   T         S +RE+ K+      E +KTANL F + +  + W+Y+ R F    +  +   TP Q  S + +   +   CELV F+L  + LP         ETY ++ + HLP LL  +   L  H+  LG+  +   L++   I  K+     Q   VS L  P   P  +S A  PS
Sbjct:    4 EELELLGDSKYRNYVAAVDKALKNFEYSSEWADLISALGKLNKVLQNNGKYQVVPKKLTIGKRLAQCLHPALPSGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLSNAAMSVKPVLLGLYETYYLPLGKTLKPGLQGLLTGVLPGLEEGSEYYDRTNTLLEKVAAAVEQPAFYSALWGSILTSPAVRLPGVTFVLLHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALHVVLRRDMSLNRRLYAWLLGFD---NNGVKAGPRSTRLSNPE-------EHVTHYFNTYSKEMLILAMVGILQGKARGGEEESILMHDLKPFRILISLLDKPELGPAILEDVLIEVFRTLHTQCRAELDLQNQNPFSKDQTQL------SSKLRENKKTA-----ELIKTANLLFNSFEPYYMWDYIARWFEECCRWTQSSHTPGQTLSSETSARSLVEFCELVDFLLDIVSLPTRSMRVICQETYIEIQTEHLPQLLLRMVSALTTHLQALGLRELTHCLRLCSKILSKV-----QPPLVSPLTLP---PGPSSAATTPS 566          

HSP 2 Score: 257.684 bits (657), Expect = 4.976e-68
Identity = 136/327 (41.59%), Postives = 199/327 (60.86%), Query Frame = 3
Query: 5901 TPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQN---------------------DINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFL 6818
            TPS    ++ AL LL   LA ++D+ + S+EKE+V P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D   +  W+ IID+LMT DK TF++  T++ V Q   L+LFT+++AE +Q AM +K+LAF IYSSE+DQY K +P+IQE+L ESLRL  +P +  Q+FL FRVLL+R+S QHLTSLW   I  L  V   +  +L  D    + +                     +  + LN+YLSACKLLD+   +  +S+PQF  Y+WAFV    +++          Q  F+P++
Sbjct: 2042 TPS--VYSVHALTLLAEVLAHLLDMVFYSDEKERVIPLLVNLMH-YVVPYLRNHSAHNAPSYRACIQLLSSLSGYQYTRRAWKKEAFDLFMDHTFFQMDSSCVSHWRAIIDHLMTHDKTTFRDLMTRVAVAQSSSLSLFTNRDAELEQRAMLLKRLAFTIYSSEVDQYQKYLPDIQERLVESLRLPQVPILHAQVFLFFRVLLLRMSPQHLTSLWPTMITELVQVFLLMEQELTADEDITRTSGPSVAGLETTYSGGNGFSTSYNSQRWLNLYLSACKLLDLALALPSESLPQFQMYRWAFVPEASDDSGLEVRRQGTHQREFKPYV 2365          

HSP 3 Score: 89.3521 bits (220), Expect = 6.739e-17
Identity = 78/303 (25.74%), Postives = 134/303 (44.22%), Query Frame = 3
Query: 2007 CQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQL---LAKQEVSIFN---DNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2897
            CQL +E +S+P+Y        S T  ++    +       WL  L+ + C   +FSI+++A+S ++DL+  T+ V         + ++ +    +S+ +SP+           ++ G              +++ +  KT FF    L LW  L    PQ H+ +V L  +LH  APS SICE++I Q+++  +    L++H +F +LW L   L   + S FN   D S    L S+  +D                         +  +WL +  Q     +++ PLLL LL P T R+S+
Sbjct:  725 CQLFLECSSFPVYIAEGNMKSSPTREEQAGDSIQP---AVWLQTLMDACCSDTDFSIQAVAVSLVMDLVGLTQSV-------AMVTAERVASPDSSQPMSPSQGRVAVVIRPPLTPG--------------ILKYIAEKTDFFKNVALILWHQLGEETPQHHKRSVELFYQLHNLAPSPSICEDVISQQLMHRDRRIRLEAHVKFSVLWHLTRDLNITKSSPFNRSFDRSLFIMLDSLSYWDGSSS--------------------AVGRAWLNQVLQRHDIARVLEPLLLLLLHPKTHRVSI 983          

HSP 4 Score: 67.781 bits (164), Expect = 2.504e-10
Identity = 62/244 (25.41%), Postives = 105/244 (43.03%), Query Frame = 3
Query: 3513 IHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFY-QNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEK-------TTNILS-------DSIMLLNESGLD 4199
            IHPL+ H+LLY  +YDS+  L++LS +  + R+ P   V  +               N+      +  QN    +L+RH  ++ G +FY   P      SF+S   LEII+ +C +F+ S Y         + +D+  N  +Q+ + E+L  +  E+  +   G       F+                  +C V K  LHC+ ++I   +K        TN+ +       DS++ L+E  LD
Sbjct: 1357 IHPLYQHVLLYLQLYDSSRTLHALSAIAAMLRASPTGFVSAIST----------TSINNTYTPQLSLLQN----LLARHRISVMGKDFYCPIPQDSHSHSFRSAMFLEIIISLCLYFLRSYY---SAHVAATSQDLSGNHAMQLTSVEVLTLLFSELAKVTG-GSAKGFASFICD-------------VLSKCKVQKVVLHCLLSTIFSVQKWHEHRVRGTNVAAVEEGLSEDSVINLSEDQLD 1569          
BLAST of Dopey_N domain-containing protein vs. Ensembl Zebrafish
Match: dop1b (DOP1 leucine zipper like protein B [Source:ZFIN;Acc:ZDB-GENE-040426-1195])

HSP 1 Score: 294.664 bits (753), Expect = 3.537e-86
Identity = 193/555 (34.77%), Postives = 313/555 (56.40%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQ--------LTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSASER--ISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEVTPSQ-----FPSFQMTIDRICELVKFILIRLPIETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  ND ++R++A  ++K L+ FE SSEWADLI++LGKL K LQ+N+++ ++PR+ ++GKRL+QCLHPALP+GVH+KALE ++VIF IIG + LA DLFIY +G+FPLL  +AM +K  L  LYE+YF+ L  ++ P+    + GLLPGLEEGAE Y R + +L + +  V    FY  LW  +L  P VR   + F++ HF+  ++  +Q + LG    L++ ++   L D  VLVQR  L+ +L+       Q        L   +   + +A    LLRRDMSLNRR Y+W++G ++        +  +D+ H   +E     E    YF  +SR++L+ A+  I+      A+    I  ++PFRII +L+D+SEIG  ++ D+L   +V     Y I       A    N + T++  S +   +K   N   E +KT N+  + + S+F W+Y+ R F   L     P +       S   ++  +  L+ F+L  +P+E Y+++ +++LP +L ++   L  H+ +L +  +   ++    +  KI
Sbjct:    4 EEAELQNDYRYRSYAAVIEKALRNFESSSEWADLISSLGKLNKALQSNLKYSLLPRRLIIGKRLAQCLHPALPSGVHLKALETYEVIFKIIGTKWLAKDLFIYSSGLFPLLGHAAMSVKPVLLTLYERYFLPLQRALLPSLQAFIMGLLPGLEEGAEVYDRTDALLVKLSVLVGQSVFYGALWGSVLICPLVRLPASLFIVAHFDHSITAKEQKFMLGTDHRLVVKAVCLALQDSNVLVQRNTLEILLYFFPFTTFQDPGECAIPLKQDEMISVVSAASLTLLRRDMSLNRRLYAWMLGLDIKGG-----MGAADSSHYSTVE-----EYTAFYFNTHSRELLVQALVNILKQKDIEANPDNLIDYLRPFRIIISLLDKSEIGPLVLSDVLLE-VVRAFYSYCI-------AMLGDNGNNTSLTGSQLNSKIKENKN-SSEIIKTVNMLVSAMSSNFLWDYMTRHFQICLSSLRDPVEKSPSKSWSSPPSVTELSTLIIFLLDVIPLELYAEIQTQYLPQMLGNMLQSLQSHMTSLSLSELTQAMRACFKVLSKI 539          
BLAST of Dopey_N domain-containing protein vs. Ensembl Zebrafish
Match: dop1b (DOP1 leucine zipper like protein B [Source:ZFIN;Acc:ZDB-GENE-040426-1195])

HSP 1 Score: 293.123 bits (749), Expect = 1.896e-79
Identity = 310/1209 (25.64%), Postives = 528/1209 (43.67%), Query Frame = 3
Query: 3522 LHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFY---QNPTLE---------------EIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLE-IKNIFKVSFDRCNVAKYALHCMSTS------ITQPEKTTNILSDSI---MLLNESGLDQRVRDAAQV-NLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSD-GKSNNKNDFKLPLPSVYK----------NLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRF---IDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPLTEKEEGQ-VKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVL----QNLIDDLKCDIKSIK-QNDIN-------KRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSND-MNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFT 6974
            L  H+LLY   Y+S+ +LY+ + L TI R+  G  V  L +              ++L  S   + N I  +L RH  A  G +FY   QN T                    S      LE++  +C  ++ S YP   +   V    +  N++VQ+ + E+L  ++ +++ + Q       GD  T+    LE ++N+         V +Y L  +S S      + +P++ T    D       ++E  L    RD     + +++ L  L     +   +V     K ++ D G+SN +   + P  ++ +          ++ +  Y +S P  A   Q + +++    +       +H      +   L   G+S + ++ PI+ ++C+N+      +E  +  I  + +      N  P DY L+ L  L  + H+ LLD                            K  T+       G  + D RN    ++  F   I S+ +LW      +  +      P S        +RQ +L  + PL +Q    ++ S+A VW         +   S+    ++  L +AS S           + +++L + L    T T I+   R++++K   +   ++   V + +L+F   ++ + ++  L      L  LL+ES+  +L P   F+LL IL+D ++++   D KR+ +E+Q++ Q++LE V  +AGSSLEQ SW  R  ++K                                           L G      A EF             E A + +T+     PS    ++QAL LL   LA ++D+ Y+S+EKEK  P ++ +++  V PYL+  S+ N+ +F   +QL++SLS Y +T+R+W+K++ +L  +  FF  +      W+ IID+L+T +K  FK+    L   Q   L LF S E    Q  M +K+ AF ++S E DQY   +P IQE+L+E+LR+G  P +  Q+FL FRVLL+RIS QHLTSLW I +  L  +     + L+DD +     ++  +D N         L+MYLSACK LD       D +P F  Y+WAF+  +D +      N  +  +   +P +  ++D   + Y      LN           E PL+  +S++S+ DL PFF T
Sbjct:  384 LFRHVLLYKQKYESSQILYAFTILETILRTSAGPFVEALSS--------------TSLDCSSIAHLNLIQNLLQRHRQAQDGGSFYGQLQNSTPPSGGTPDASQPASSPLHSPSCPPTLLLELLTSLCMRYLRSHYPSYAS---VPTRQLQANREVQVKSVEVLTELMIQLVRVAQ-----QNGD--TKGTAGLEAVRNLLW----GYKVQQYVLLTLSASMYVCQRVDRPDQHTLPEEDQGEDGGEISEESLINFGRDGTWAEHPLQIALLKLLKVLIVLEHHVCPPHTKPQEHDQGQSNPQRRAEPPSSALAREWQTAVMFQQSIKAVRYVSSQPITA---QGMFVSAAARALHPQYGCAMHPAWVTLLCDVLPYLGRSLAIIVSPIIAQICRNLDELVKQHE--HDGIKGSHNGTLKRENIAP-DYPLTLLEGLTTITHYCLLDH---------------------------KKATA-------GCDVPDLRNASNAILEEFPHMISSMALLWGVVKGCDSTH-GSRATPTSVYFKSTKILRQKVLEFLMPLTQQFGVQVMASVAAVW---------NSRKSRKRRSRNKILPDASDSQ----------MTLVDLVKALNTLRTDT-ILQLIREVVKKPHQIKGDQKSTLVDIPMLQFSYVYIQSLTAQALQENINPLLCLLRESVQLNLAPPGHFLLLGILNDCVNRLPNIDNKRDTKELQEVSQRILEAVGAVAGSSLEQTSWLSRNLEVKAQPQVC-------------------------------------LQGDEDDHDANEF------------EEYAGQGSTMVSSSAPS--VFSVQALVLLAEVLAPLLDMVYRSDEKEKAVPLISRLMY-YVFPYLKNHSAYNMPSFCAGAQLLSSLSGYAYTKRAWKKEVLELFMDPLFFTMESSCSYHWRSIIDHLLTHEKTMFKD----LMSMQSSSLKLFNSAE----QKPMLLKRQAFAMFSGENDQYHFYLPLIQERLTENLRVGQSPSVSAQMFLMFRVLLLRISPQHLTSLWPIMVTELIRIFNRLEKALLDDKEVTKSKLRGGHDKNGLLCFPQAELDMYLSACKFLDTAVSFPPDHMPLFQMYRWAFIPEVDVDHYDGPGNTLLEGEQECKPHIVRILDGINRRYGE----LNGTAAESSTDRVEFPLLTLRSLYSIVDLVPFFNT 1439          

HSP 2 Score: 61.6178 bits (148), Expect = 1.636e-8
Identity = 50/169 (29.59%), Postives = 78/169 (46.15%), Query Frame = 3
Query: 2400 VIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISLPSL 2906
            V++ L++ T F+      LW  L +   + H   V L  RLH  APSASICE++I   +L+ +   CL++  RF +LW L  + + S         S    R+FD+               N+    +R    +WL +A       +I+ P+LL LL P T R  + S+
Sbjct:   54 VLKTLEDSTDFYLRVSQVLWAQLDTERKEHHVSCVELFYRLHCLAPSASICEDIICLGLLSGDKVVCLEALHRFSVLWHLTREIQTS--------RSTSLNRSFDR------SLFVVLDSLNNQDGSVRAAAQNWLVRALSLSDVVRILEPVLLLLLDPKTQRSPIQSI 208          
BLAST of Dopey_N domain-containing protein vs. Ensembl Zebrafish
Match: dop1b (DOP1 leucine zipper like protein B [Source:ZFIN;Acc:ZDB-GENE-040426-1195])

HSP 1 Score: 172.17 bits (435), Expect = 1.549e-48
Identity = 75/141 (53.19%), Postives = 110/141 (78.01%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAF 449
            E+ +  ND ++R++A  ++K L+ FE SSEWADLI++LGKL K LQ+N+++ ++PR+ ++GKRL+QCLHPALP+GVH+KALE ++VIF IIG + LA DLFIY +G+FPLL  +AM +K  L  LYE+YF+ L  ++ P+ 
Sbjct:    4 EEAELQNDYRYRSYAAVIEKALRNFESSSEWADLISSLGKLNKALQSNLKYSLLPRRLIIGKRLAQCLHPALPSGVHLKALETYEVIFKIIGTKWLAKDLFIYSSGLFPLLGHAAMSVKPVLLTLYERYFLPLQRALLPSL 144          
BLAST of Dopey_N domain-containing protein vs. Ensembl Zebrafish
Match: dop1a (DOP1 leucine zipper like protein A [Source:ZFIN;Acc:ZDB-GENE-050309-65])

HSP 1 Score: 168.318 bits (425), Expect = 1.515e-44
Identity = 83/176 (47.16%), Postives = 122/176 (69.32%), Query Frame = 3
Query: 5901 TPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQ 6428
            TPS    ++ AL LL   LA ++D+ + S+EKE+V P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D   +  W+ IID+LMT DK TF++  T++ V Q   L+LFT+++AE +Q AM +K+LAF IYSSE+DQY K +P+IQ
Sbjct:  200 TPS--VYSVHALTLLAEVLAHLLDMVFYSDEKERVIPLLVNLMH-YVVPYLRNHSAHNAPSYRACIQLLSSLSGYQYTRRAWKKEAFDLFMDHTFFQMDSSCVSHWRAIIDHLMTHDKTTFRDLMTRVAVAQSSSLSLFTNRDAELEQRAMLLKRLAFTIYSSEVDQYQKYLPDIQ 372          

HSP 2 Score: 81.6481 bits (200), Expect = 2.465e-15
Identity = 48/144 (33.33%), Postives = 86/144 (59.72%), Query Frame = 3
Query: 5229 ICILELARGLKKSFTITHIINTCRDIIRKSFPLT-EKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLK 5654
            + ++EL R +    T T +I T ++++++   +  EK+   ++V +L+F   ++   S + L      L  LLK+S+  SLP    F++L +L++FI K    + K++QRE+QD+  K++E +  IAGSSLEQ +W RR  ++K
Sbjct:   28 LLLVELVRSVSAMRTET-VIQTVKEVLKQPPAIAKEKKHLSLEVCMLQFFYAYVQRISVSSLVDSWPSLLALLKDSVQLSLPAPGQFLILGVLNEFILKNPTLESKKDQRELQDVTHKIVEAIGTIAGSSLEQTTWLRRNLEVK 170          
BLAST of Dopey_N domain-containing protein vs. Ensembl Xenopus
Match: DOP1A (DOP1 leucine zipper like protein A [Source:HGNC Symbol;Acc:HGNC:21194])

HSP 1 Score: 360.147 bits (923), Expect = 3.654e-99
Identity = 216/547 (39.49%), Postives = 330/547 (60.33%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNP-TSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEV-----TPSQFPSF-QMTIDRICELVKFILIRLPIETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  +D+K+RN+   VDK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++PRK  +GKRL+QCLHPALP GVH KALE +++IF IIGP++LA DLF+Y +G+FPLL+ +AM +K  L +LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +VE   FY  LW  +L +P+VR  G  ++L+H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G          F      V  +     +  E    YF  +S+++L+ A+  I+     S  S  +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L  +     +L  +A    +  P  +  S +RE+ ++      E +KTANL F + +  + W+Y+ R F +  ++ +     TP    S  ++ +   C LV F+L  + +E Y ++ + HLP LL  +   L  H+  L +  ++  L++   I  K+
Sbjct:    4 EEVELLSDSKYRNYVAAVDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPRKITIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLTNAAMSVKPVLLSLYEMYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYDRTNTLLEKVASAVEQSAFYGALWGSLLTSPAVRLPGITYVLSHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALRVVLRRDMSLNRRLYAWLLG----------FDNNGTAVGPRSSRQSNPEEHATHYFNTFSKELLVQAMVGILQGKEMSRESAPVQDLKPFRILISLLDKPELGPAILEDVLIEVFRTLYTQ--CKAELDLQAQTPFSKDPVQL-SSKLRENKRTA-----ELIKTANLLFNSFEPYYMWDYIARWFEECCRRTLHSRIQTPGGDSSKPELPLINFCLLVDFLLDIVSLEAYIEIQTEHLPQLLLRMISALTSHLQALDLKELEDSLRLCSKILSKV 532          

HSP 2 Score: 251.906 bits (642), Expect = 3.949e-66
Identity = 133/327 (40.67%), Postives = 197/327 (60.24%), Query Frame = 3
Query: 5901 TPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCD--IKSIKQNDI-------------------NKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFL 6818
            TPS    ++ AL LL   LA ++D+ + S+EKE+V P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D   +  W+ I+D+LMT DK TF++  T++ V Q   L LFT+++AE +Q AM +K+LAF I+SSE+DQY K +P+IQE+L ESLRL  +P + +Q+FL FRVLL+R+S QHLTSLW   I  L  V   +  +L  D  I  I    +                    + LN+YLSACK LD+   +  +++PQF  Y+WAF+    ++           Q  F+P++
Sbjct: 2006 TPS--VYSVHALTLLAEVLAHLLDMVFYSDEKERVIPLLVNIMH-YVVPYLRNHSAHNASSYRACVQLLSSLSGYQYTRRTWKKEAFDLFMDPNFFQMDGSCVSHWRSIMDHLMTHDKTTFRDLMTRVAVAQSSSLGLFTNRDAELEQRAMLLKRLAFAIFSSEIDQYQKFLPDIQERLVESLRLPQVPTLHSQVFLFFRVLLLRMSPQHLTSLWPTMITELVQVFLLMEQELTADEDITRISGPSVAGLETTYTGGNGFSTSYNSQRWLNLYLSACKFLDLALALPSENLPQFQMYRWAFIPEASDDAGLEVRRQGTHQREFKPYV 2329          

HSP 3 Score: 177.948 bits (450), Expect = 1.216e-43
Identity = 171/749 (22.83%), Postives = 334/749 (44.59%), Query Frame = 3
Query: 3498 SNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQI---GYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEK-------TTNILS-------DSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSV-----YKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEI---NTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILW---EKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPLT-EKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLK 5654
            S H+ IHPL+ H+LLY  +YDS+  LY+L+ ++ I ++ P + V  +               ++      +  QN    +L+RH  ++ G +FY N  L+   +F+S   +EI++ +C +FM S YP   T  KV+ +D+  N+ +Q+++ EIL  +  E+  +++    G+ +   D ++                 +C V K  LHC+ +SI   +K         NI++       DS++  +E   D       Q  L++++ +++ L++ + T                 +N+  F   +  +      + + S  Y  S P   ++ Q + L +++  +       +H      + S+L   GK    V++ +  +LC+N+      Y+    I       DS  +   + +P D  L+ L  +  + H+ LLD + + +QL      S +Q                        H+L+AR+ M+ ++   + S+ +LW    ++  SEK          +  +G    +RQ IL ++ P+   H    + ++A VW    Q                   N+ ST    + S     + ++EL R +    T T +I T ++++++   +  +K+   ++V +L+F   ++     + L         LLK+SI  ++P    F++L +L++FI K    + K++QR++QD+  K+++ +  IAGSSLEQ +W RR  ++K
Sbjct: 1333 SPHFNIHPLYQHVLLYLQLYDSSRTLYALTAIKAILKTSPTVFVKAIST----------TNVSNAYTPQLSLLQN----LLARHRISVMGKDFYSNIPLDSNHNFRSSMYIEILISLCLYFMRSHYP---THVKVTQQDLMGNRNMQMMSIEILTLLFTELAKVIESSAKGFASFISDMLS-----------------KCKVQKVILHCLLSSIFSAQKWHSERMAEKNIMAIEEGFSEDSLINFSEDEFDN--GSTLQSQLLKVLQSLIILEHRVLTV--------------PEDNEAGFDFVITDLENINPQQPMTSLQYLHSQP---ITCQGMFLCAVIRALHQHYTCKMHPQWICLMTSTLPYMGKVLQKVVVSVTLQLCRNLDNLIQQYKYETGI------TDSRPLWMASFIPPDMILTVLEGITTIIHYCLLDPSAQYHQLM----VSVDQK-----------------------HLLEARSGMLSILHLIMSSVTLLWSVLHQADSSEKNFTAASATVTTVNLGSTKNLRQQILELLGPISMNHGVYFMAAIAFVWNERRQ-------------------NKNSTRTKVIPSASDEQLLLVELVRSISVMRTET-VIQTVKEVLKQPPAIAKDKKHLSLEVCMLQFFYAYVQRIPVSNLVDSWASFLVLLKDSIQLNIPAPGQFLILGVLNEFIMKNPTLENKKDQRDLQDVTHKIVDAIGAIAGSSLEQTTWLRRNLEVK 1975          

HSP 4 Score: 98.5969 bits (244), Expect = 1.341e-19
Identity = 81/307 (26.38%), Postives = 138/307 (44.95%), Query Frame = 3
Query: 2007 CQLVVEMTSYPLYF----NVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQL---LAKQEVSIFN---DNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2897
            CQL +E +S+P+Y       SE + S+ N+            P WL  L+ +     +FSI+S+A+S ++DL+  T+ V         +  +N      S+ +SPN    +      +++G+              +  +  KT FF    L+LW+ L    P+ HQ +V L  +LH   PS+SICE++I Q++   + +  +++H RF +LW L   L   + S +    D S    L S+ + D C                      ++  +WL +  Q     +++ PLLL LL P T R+S+
Sbjct:  735 CQLFLECSSFPVYIAEGSQASEIHASMANTD-----CEQVQPPLWLQTLMNACNMAQDFSIQSVAISLVMDLVGLTQSV-------AVVAGENSSSLEPSQPLSPNQGRVSVVIRPPLTEGN--------------LRYIAEKTDFFKHVALTLWEQLGDQTPKHHQRSVELFYQLHSLVPSSSICEDVISQQLTHKDKKIRMEAHGRFAVLWHLTRDLHINKTSSYGRTFDRSLFIMLDSLNSLDGCTS--------------------SVAQAWLNQVLQRHDIARVLEPLLLLLLHPKTQRVSV 995          
BLAST of Dopey_N domain-containing protein vs. Ensembl Xenopus
Match: DOP1A (DOP1 leucine zipper like protein A [Source:HGNC Symbol;Acc:HGNC:21194])

HSP 1 Score: 354.755 bits (909), Expect = 1.472e-97
Identity = 218/557 (39.14%), Postives = 331/557 (59.43%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNP-TSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEV-----TPSQFPSF-QMTIDRICELVKFIL--IRLPI--------ETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  +D+K+RN+   VDK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++PRK  +GKRL+QCLHPALP GVH KALE +++IF IIGP++LA DLF+Y +G+FPLL+ +AM +K  L +LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +VE   FY  LW  +L +P+VR  G  ++L+H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G          F      V  +     +  E    YF  +S+++L+ A+  I+     S  S  +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L  +     +L  +A    +  P  +  S +RE+ ++      E +KTANL F + +  + W+Y+ R F +  ++ +     TP    S  ++ +   C LV F+L  + LP         E Y ++ + HLP LL  +   L  H+  L +  ++  L++   I  K+
Sbjct:    4 EEVELLSDSKYRNYVAAVDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPRKITIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLTNAAMSVKPVLLSLYEMYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYDRTNTLLEKVASAVEQSAFYGALWGSLLTSPAVRLPGITYVLSHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALRVVLRRDMSLNRRLYAWLLG----------FDNNGTAVGPRSSRQSNPEEHATHYFNTFSKELLVQAMVGILQGKEMSRESAPVQDLKPFRILISLLDKPELGPAILEDVLIEVFRTLYTQ--CKAELDLQAQTPFSKDPVQL-SSKLRENKRTA-----ELIKTANLLFNSFEPYYMWDYIARWFEECCRRTLHSRIQTPGGDSSKPELPLINFCLLVDFLLDIVSLPTRSMRVICQEAYIEIQTEHLPQLLLRMISALTSHLQALDLKELEDSLRLCSKILSKV 542          

HSP 2 Score: 251.906 bits (642), Expect = 4.205e-66
Identity = 133/327 (40.67%), Postives = 197/327 (60.24%), Query Frame = 3
Query: 5901 TPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCD--IKSIKQNDI-------------------NKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFL 6818
            TPS    ++ AL LL   LA ++D+ + S+EKE+V P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D   +  W+ I+D+LMT DK TF++  T++ V Q   L LFT+++AE +Q AM +K+LAF I+SSE+DQY K +P+IQE+L ESLRL  +P + +Q+FL FRVLL+R+S QHLTSLW   I  L  V   +  +L  D  I  I    +                    + LN+YLSACK LD+   +  +++PQF  Y+WAF+    ++           Q  F+P++
Sbjct: 2016 TPS--VYSVHALTLLAEVLAHLLDMVFYSDEKERVIPLLVNIMH-YVVPYLRNHSAHNASSYRACVQLLSSLSGYQYTRRTWKKEAFDLFMDPNFFQMDGSCVSHWRSIMDHLMTHDKTTFRDLMTRVAVAQSSSLGLFTNRDAELEQRAMLLKRLAFAIFSSEIDQYQKFLPDIQERLVESLRLPQVPTLHSQVFLFFRVLLLRMSPQHLTSLWPTMITELVQVFLLMEQELTADEDITRISGPSVAGLETTYTGGNGFSTSYNSQRWLNLYLSACKFLDLALALPSENLPQFQMYRWAFIPEASDDAGLEVRRQGTHQREFKPYV 2339          

HSP 3 Score: 177.563 bits (449), Expect = 1.568e-43
Identity = 171/749 (22.83%), Postives = 334/749 (44.59%), Query Frame = 3
Query: 3498 SNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQI---GYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEK-------TTNILS-------DSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSV-----YKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEI---NTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILW---EKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPLT-EKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLK 5654
            S H+ IHPL+ H+LLY  +YDS+  LY+L+ ++ I ++ P + V  +               ++      +  QN    +L+RH  ++ G +FY N  L+   +F+S   +EI++ +C +FM S YP   T  KV+ +D+  N+ +Q+++ EIL  +  E+  +++    G+ +   D ++                 +C V K  LHC+ +SI   +K         NI++       DS++  +E   D       Q  L++++ +++ L++ + T                 +N+  F   +  +      + + S  Y  S P   ++ Q + L +++  +       +H      + S+L   GK    V++ +  +LC+N+      Y+    I       DS  +   + +P D  L+ L  +  + H+ LLD + + +QL      S +Q                        H+L+AR+ M+ ++   + S+ +LW    ++  SEK          +  +G    +RQ IL ++ P+   H    + ++A VW    Q                   N+ ST    + S     + ++EL R +    T T +I T ++++++   +  +K+   ++V +L+F   ++     + L         LLK+SI  ++P    F++L +L++FI K    + K++QR++QD+  K+++ +  IAGSSLEQ +W RR  ++K
Sbjct: 1343 SPHFNIHPLYQHVLLYLQLYDSSRTLYALTAIKAILKTSPTVFVKAIST----------TNVSNAYTPQLSLLQN----LLARHRISVMGKDFYSNIPLDSNHNFRSSMYIEILISLCLYFMRSHYP---THVKVTQQDLMGNRNMQMMSIEILTLLFTELAKVIESSAKGFASFISDMLS-----------------KCKVQKVILHCLLSSIFSAQKWHSERMAEKNIMAIEEGFSEDSLINFSEDEFDN--GSTLQSQLLKVLQSLIILEHRVLTV--------------PEDNEAGFDFVITDLENINPQQPMTSLQYLHSQP---ITCQGMFLCAVIRALHQHYTCKMHPQWICLMTSTLPYMGKVLQKVVVSVTLQLCRNLDNLIQQYKYETGI------TDSRPLWMASFIPPDMILTVLEGITTIIHYCLLDPSAQYHQLM----VSVDQK-----------------------HLLEARSGMLSILHLIMSSVTLLWSVLHQADSSEKNFTAASATVTTVNLGSTKNLRQQILELLGPISMNHGVYFMAAIAFVWNERRQ-------------------NKNSTRTKVIPSASDEQLLLVELVRSISVMRTET-VIQTVKEVLKQPPAIAKDKKHLSLEVCMLQFFYAYVQRIPVSNLVDSWASFLVLLKDSIQLNIPAPGQFLILGVLNEFIMKNPTLENKKDQRDLQDVTHKIVDAIGAIAGSSLEQTTWLRRNLEVK 1985          

HSP 4 Score: 98.5969 bits (244), Expect = 1.320e-19
Identity = 81/307 (26.38%), Postives = 138/307 (44.95%), Query Frame = 3
Query: 2007 CQLVVEMTSYPLYF----NVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQL---LAKQEVSIFN---DNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2897
            CQL +E +S+P+Y       SE + S+ N+            P WL  L+ +     +FSI+S+A+S ++DL+  T+ V         +  +N      S+ +SPN    +      +++G+              +  +  KT FF    L+LW+ L    P+ HQ +V L  +LH   PS+SICE++I Q++   + +  +++H RF +LW L   L   + S +    D S    L S+ + D C                      ++  +WL +  Q     +++ PLLL LL P T R+S+
Sbjct:  745 CQLFLECSSFPVYIAEGSQASEIHASMANTD-----CEQVQPPLWLQTLMNACNMAQDFSIQSVAISLVMDLVGLTQSV-------AVVAGENSSSLEPSQPLSPNQGRVSVVIRPPLTEGN--------------LRYIAEKTDFFKHVALTLWEQLGDQTPKHHQRSVELFYQLHSLVPSSSICEDVISQQLTHKDKKIRMEAHGRFAVLWHLTRDLHINKTSSYGRTFDRSLFIMLDSLNSLDGCTS--------------------SVAQAWLNQVLQRHDIARVLEPLLLLLLHPKTQRVSV 1005          
BLAST of Dopey_N domain-containing protein vs. Ensembl Xenopus
Match: DOP1A (DOP1 leucine zipper like protein A [Source:HGNC Symbol;Acc:HGNC:21194])

HSP 1 Score: 354.755 bits (909), Expect = 1.558e-97
Identity = 218/557 (39.14%), Postives = 331/557 (59.43%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNP-TSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEV-----TPSQFPSF-QMTIDRICELVKFIL--IRLPI--------ETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  +D+K+RN+   VDK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++PRK  +GKRL+QCLHPALP GVH KALE +++IF IIGP++LA DLF+Y +G+FPLL+ +AM +K  L +LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +VE   FY  LW  +L +P+VR  G  ++L+H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G          F      V  +     +  E    YF  +S+++L+ A+  I+     S  S  +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L  +     +L  +A    +  P  +  S +RE+ ++      E +KTANL F + +  + W+Y+ R F +  ++ +     TP    S  ++ +   C LV F+L  + LP         E Y ++ + HLP LL  +   L  H+  L +  ++  L++   I  K+
Sbjct:    4 EEVELLSDSKYRNYVAAVDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPRKITIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLTNAAMSVKPVLLSLYEMYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYDRTNTLLEKVASAVEQSAFYGALWGSLLTSPAVRLPGITYVLSHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALRVVLRRDMSLNRRLYAWLLG----------FDNNGTAVGPRSSRQSNPEEHATHYFNTFSKELLVQAMVGILQGKEMSRESAPVQDLKPFRILISLLDKPELGPAILEDVLIEVFRTLYTQ--CKAELDLQAQTPFSKDPVQL-SSKLRENKRTA-----ELIKTANLLFNSFEPYYMWDYIARWFEECCRRTLHSRIQTPGGDSSKPELPLINFCLLVDFLLDIVSLPTRSMRVICQEAYIEIQTEHLPQLLLRMISALTSHLQALDLKELEDSLRLCSKILSKV 542          

HSP 2 Score: 214.542 bits (545), Expect = 8.966e-55
Identity = 124/327 (37.92%), Postives = 184/327 (56.27%), Query Frame = 3
Query: 5901 TPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCD--IKSIKQNDI-------------------NKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFL 6818
            TPS    ++ AL LL   LA ++D+ + S+EKE+V P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D        VI+   +            ++ V Q   L LFT+++AE +Q AM +K+LAF I+SSE+DQY K +P+IQE+L ESLRL  +P + +Q+FL FRVLL+R+S QHLTSLW   I  L  V   +  +L  D  I  I    +                    + LN+YLSACK LD+   +  +++PQF  Y+WAF+    ++           Q  F+P++
Sbjct: 1999 TPS--VYSVHALTLLAEVLAHLLDMVFYSDEKERVIPLLVNIMH-YVVPYLRNHSAHNASSYRACVQLLSSLSGYQYTRRTWKKEAFDLFMDPNFFQMD-----GSCVIMPCFLA-----------RVAVAQSSSLGLFTNRDAELEQRAMLLKRLAFAIFSSEIDQYQKFLPDIQERLVESLRLPQVPTLHSQVFLFFRVLLLRMSPQHLTSLWPTMITELVQVFLLMEQELTADEDITRISGPSVAGLETTYTGGNGFSTSYNSQRWLNLYLSACKFLDLALALPSENLPQFQMYRWAFIPEASDDAGLEVRRQGTHQREFKPYV 2306          

HSP 3 Score: 177.563 bits (449), Expect = 1.782e-43
Identity = 171/749 (22.83%), Postives = 334/749 (44.59%), Query Frame = 3
Query: 3498 SNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQI---GYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEK-------TTNILS-------DSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSV-----YKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEI---NTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILW---EKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPLT-EKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLK 5654
            S H+ IHPL+ H+LLY  +YDS+  LY+L+ ++ I ++ P + V  +               ++      +  QN    +L+RH  ++ G +FY N  L+   +F+S   +EI++ +C +FM S YP   T  KV+ +D+  N+ +Q+++ EIL  +  E+  +++    G+ +   D ++                 +C V K  LHC+ +SI   +K         NI++       DS++  +E   D       Q  L++++ +++ L++ + T                 +N+  F   +  +      + + S  Y  S P   ++ Q + L +++  +       +H      + S+L   GK    V++ +  +LC+N+      Y+    I       DS  +   + +P D  L+ L  +  + H+ LLD + + +QL      S +Q                        H+L+AR+ M+ ++   + S+ +LW    ++  SEK          +  +G    +RQ IL ++ P+   H    + ++A VW    Q                   N+ ST    + S     + ++EL R +    T T +I T ++++++   +  +K+   ++V +L+F   ++     + L         LLK+SI  ++P    F++L +L++FI K    + K++QR++QD+  K+++ +  IAGSSLEQ +W RR  ++K
Sbjct: 1326 SPHFNIHPLYQHVLLYLQLYDSSRTLYALTAIKAILKTSPTVFVKAIST----------TNVSNAYTPQLSLLQN----LLARHRISVMGKDFYSNIPLDSNHNFRSSMYIEILISLCLYFMRSHYP---THVKVTQQDLMGNRNMQMMSIEILTLLFTELAKVIESSAKGFASFISDMLS-----------------KCKVQKVILHCLLSSIFSAQKWHSERMAEKNIMAIEEGFSEDSLINFSEDEFDN--GSTLQSQLLKVLQSLIILEHRVLTV--------------PEDNEAGFDFVITDLENINPQQPMTSLQYLHSQP---ITCQGMFLCAVIRALHQHYTCKMHPQWICLMTSTLPYMGKVLQKVVVSVTLQLCRNLDNLIQQYKYETGI------TDSRPLWMASFIPPDMILTVLEGITTIIHYCLLDPSAQYHQLM----VSVDQK-----------------------HLLEARSGMLSILHLIMSSVTLLWSVLHQADSSEKNFTAASATVTTVNLGSTKNLRQQILELLGPISMNHGVYFMAAIAFVWNERRQ-------------------NKNSTRTKVIPSASDEQLLLVELVRSISVMRTET-VIQTVKEVLKQPPAIAKDKKHLSLEVCMLQFFYAYVQRIPVSNLVDSWASFLVLLKDSIQLNIPAPGQFLILGVLNEFIMKNPTLENKKDQRDLQDVTHKIVDAIGAIAGSSLEQTTWLRRNLEVK 1968          

HSP 4 Score: 98.5969 bits (244), Expect = 1.519e-19
Identity = 81/307 (26.38%), Postives = 138/307 (44.95%), Query Frame = 3
Query: 2007 CQLVVEMTSYPLYF----NVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQL---LAKQEVSIFN---DNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2897
            CQL +E +S+P+Y       SE + S+ N+            P WL  L+ +     +FSI+S+A+S ++DL+  T+ V         +  +N      S+ +SPN    +      +++G+              +  +  KT FF    L+LW+ L    P+ HQ +V L  +LH   PS+SICE++I Q++   + +  +++H RF +LW L   L   + S +    D S    L S+ + D C                      ++  +WL +  Q     +++ PLLL LL P T R+S+
Sbjct:  745 CQLFLECSSFPVYIAEGSQASEIHASMANTD-----CEQVQPPLWLQTLMNACNMAQDFSIQSVAISLVMDLVGLTQSV-------AVVAGENSSSLEPSQPLSPNQGRVSVVIRPPLTEGN--------------LRYIAEKTDFFKHVALTLWEQLGDQTPKHHQRSVELFYQLHSLVPSSSICEDVISQQLTHKDKKIRMEAHGRFAVLWHLTRDLHINKTSSYGRTFDRSLFIMLDSLNSLDGCTS--------------------SVAQAWLNQVLQRHDIARVLEPLLLLLLHPKTQRVSV 1005          
BLAST of Dopey_N domain-containing protein vs. Ensembl Xenopus
Match: DOP1A (DOP1 leucine zipper like protein A [Source:HGNC Symbol;Acc:HGNC:21194])

HSP 1 Score: 353.599 bits (906), Expect = 3.108e-97
Identity = 216/554 (38.99%), Postives = 328/554 (59.21%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNP-TSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKAL------------KQEVTPSQFPSF-QMTIDRICELVKFILIRLPIETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  +D+K+RN+   VDK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++PRK  +GKRL+QCLHPALP GVH KALE +++IF IIGP++LA DLF+Y +G+FPLL+ +AM +K  L +LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +VE   FY  LW  +L +P+VR  G  ++L+H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G          F      V  +     +  E    YF  +S+++L+ A+  I+     S  S  +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L  +     +L  +A    +  P  +  S +RE+ ++      E +KTANL F + +  + W+Y++  F   L             +  TP    S  ++ +   C LV F+L  + +E Y ++ + HLP LL  +   L  H+  L +  ++  L++   I  K+
Sbjct:    4 EEVELLSDSKYRNYVAAVDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPRKITIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLTNAAMSVKPVLLSLYEMYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYDRTNTLLEKVASAVEQSAFYGALWGSLLTSPAVRLPGITYVLSHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALRVVLRRDMSLNRRLYAWLLG----------FDNNGTAVGPRSSRQSNPEEHATHYFNTFSKELLVQAMVGILQGKEMSRESAPVQDLKPFRILISLLDKPELGPAILEDVLIEVFRTLYTQ--CKAELDLQAQTPFSKDPVQL-SSKLRENKRTA-----ELIKTANLLFNSFEPYYMWDYISFYFTSVLFSYLLNLRRTLHSRIQTPGGDSSKPELPLINFCLLVDFLLDIVSLEAYIEIQTEHLPQLLLRMISALTSHLQALDLKELEDSLRLCSKILSKV 539          

HSP 2 Score: 127.487 bits (319), Expect = 2.488e-28
Identity = 72/176 (40.91%), Postives = 108/176 (61.36%), Query Frame = 3
Query: 5901 TPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQ 6428
            TPS    ++ AL LL   LA ++D+ + S+EKE+V P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D        VI+   +            ++ V Q   L LFT+++AE +Q AM +K+LAF I+SSE+DQY K +P+IQ
Sbjct: 1954 TPS--VYSVHALTLLAEVLAHLLDMVFYSDEKERVIPLLVNIMH-YVVPYLRNHSAHNASSYRACVQLLSSLSGYQYTRRTWKKEAFDLFMDPNFFQMD-----GSCVIMPCFL-----------ARVAVAQSSSLGLFTNRDAELEQRAMLLKRLAFAIFSSEIDQYQKFLPDIQ 2110          

HSP 3 Score: 108.227 bits (269), Expect = 1.566e-22
Identity = 111/506 (21.94%), Postives = 219/506 (43.28%), Query Frame = 3
Query: 3498 SNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQI---GYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEK-------TTNILS-------DSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSV-----YKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEI---NTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILW 4940
            S H+ IHPL+ H+LLY  +YDS+  LY+L+ ++ I ++ P + V  +               ++      +  QN    +L+RH  ++ G +FY N  L+   +F+S   +EI++ +C +FM S YP   T  KV+ +D+  N+ +Q+++ EIL  +  E+  +++    G+ +   D ++                 +C V K  LHC+ +SI   +K         NI++       DS++  +E   D       Q  L++++ +++ L++ + T                 +N+  F   +  +      + + S  Y  S P   ++ Q + L +++  +       +H      + S+L   GK    V++ +  +LC+N+      Y+    I       DS  +   + +P D  L+ L  +  + H+ LLD + + +QL      S +Q                        H+L+AR+ M+ ++   + S+ +LW
Sbjct: 1323 SPHFNIHPLYQHVLLYLQLYDSSRTLYALTAIKAILKTSPTVFVKAIST----------TNVSNAYTPQLSLLQN----LLARHRISVMGKDFYSNIPLDSNHNFRSSMYIEILISLCLYFMRSHYP---THVKVTQQDLMGNRNMQMMSIEILTLLFTELAKVIESSAKGFASFISDMLS-----------------KCKVQKVILHCLLSSIFSAQKWHSERMAEKNIMAIEEGFSEDSLINFSEDEFDN--GSTLQSQLLKVLQSLIILEHRVLTV--------------PEDNEAGFDFVITDLENINPQQPMTSLQYLHSQP---ITCQGMFLCAVIRALHQHYTCKMHPQWICLMTSTLPYMGKVLQKVVVSVTLQLCRNLDNLIQQYKYETGI------TDSRPLWMASFIPPDMILTVLEGITTIIHYCLLDPSAQYHQLM----VSVDQK-----------------------HLLEARSGMLSILHLIMSSVTLLW 1742          

HSP 4 Score: 98.5969 bits (244), Expect = 1.608e-19
Identity = 81/307 (26.38%), Postives = 138/307 (44.95%), Query Frame = 3
Query: 2007 CQLVVEMTSYPLYF----NVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQL---LAKQEVSIFN---DNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2897
            CQL +E +S+P+Y       SE + S+ N+            P WL  L+ +     +FSI+S+A+S ++DL+  T+ V         +  +N      S+ +SPN    +      +++G+              +  +  KT FF    L+LW+ L    P+ HQ +V L  +LH   PS+SICE++I Q++   + +  +++H RF +LW L   L   + S +    D S    L S+ + D C                      ++  +WL +  Q     +++ PLLL LL P T R+S+
Sbjct:  742 CQLFLECSSFPVYIAEGSQASEIHASMANTD-----CEQVQPPLWLQTLMNACNMAQDFSIQSVAISLVMDLVGLTQSV-------AVVAGENSSSLEPSQPLSPNQGRVSVVIRPPLTEGN--------------LRYIAEKTDFFKHVALTLWEQLGDQTPKHHQRSVELFYQLHSLVPSSSICEDVISQQLTHKDKKIRMEAHGRFAVLWHLTRDLHINKTSSYGRTFDRSLFIMLDSLNSLDGCTS--------------------SVAQAWLNQVLQRHDIARVLEPLLLLLLHPKTQRVSV 1002          

HSP 5 Score: 65.4698 bits (158), Expect = 1.774e-9
Identity = 53/205 (25.85%), Postives = 105/205 (51.22%), Query Frame = 3
Query: 5076 IILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQF------RVICILELARGLKKSFTITHIINTCRDIIRKSFPLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLIS-----GCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLK 5654
            +I+ S+  +W  L Q    + NF+ +          A+ +  NL S +         + ++EL R +    T T +I T ++++++  P   K++    +N+L   +  +   S  ++ + +          LLK+SI  ++P    F++L +L++FI K    + K++QR++QD+  K+++ +  IAGSSLEQ +W RR  ++K
Sbjct: 1733 LIMSSVTLLWSVLHQADSSEKNFTAAS---------ATVTTVNLGSTKVIPSASDEQLLLVELVRSISVMRTET-VIQTVKEVLKQP-PAIAKDK---VLNVLILRKAAVTCISHLRIPVSNLVDSWASFLVLLKDSIQLNIPAPGQFLILGVLNEFIMKNPTLENKKDQRDLQDVTHKIVDAIGAIAGSSLEQTTWLRRNLEVK 1923          
BLAST of Dopey_N domain-containing protein vs. Ensembl Xenopus
Match: DOP1A (DOP1 leucine zipper like protein A [Source:HGNC Symbol;Acc:HGNC:21194])

HSP 1 Score: 348.977 bits (894), Expect = 1.732e-96
Identity = 217/564 (38.48%), Postives = 328/564 (58.16%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNP-TSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKAL------------KQEVTPSQFPSF-QMTIDRICELVKFIL--IRLPI--------ETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  +D+K+RN+   VDK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++PRK  +GKRL+QCLHPALP GVH KALE +++IF IIGP++LA DLF+Y +G+FPLL+ +AM +K  L +LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +VE   FY  LW  +L +P+VR  G  ++L+H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G    R +                   +  E    YF  +S+++L+ A+  I+     S  S  +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L  +     +L  +A    +  P  +  S +RE+ ++      E +KTANL F + +  + W+Y++  F   L             +  TP    S  ++ +   C LV F+L  + LP         E Y ++ + HLP LL  +   L  H+  L +  ++  L++   I  K+
Sbjct:    4 EEVELLSDSKYRNYVAAVDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPRKITIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLTNAAMSVKPVLLSLYEMYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYDRTNTLLEKVASAVEQSAFYGALWGSLLTSPAVRLPGITYVLSHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALRVVLRRDMSLNRRLYAWLLGPRSSRQS-------------------NPEEHATHYFNTFSKELLVQAMVGILQGKEMSRESAPVQDLKPFRILISLLDKPELGPAILEDVLIEVFRTLYTQ--CKAELDLQAQTPFSKDPVQL-SSKLRENKRTA-----ELIKTANLLFNSFEPYYMWDYISFYFTSVLFSYLLNLRRTLHSRIQTPGGDSSKPELPLINFCLLVDFLLDIVSLPTRSMRVICQEAYIEIQTEHLPQLLLRMISALTSHLQALDLKELEDSLRLCSKILSKV 540          

HSP 2 Score: 98.2117 bits (243), Expect = 1.829e-19
Identity = 81/307 (26.38%), Postives = 138/307 (44.95%), Query Frame = 3
Query: 2007 CQLVVEMTSYPLYF----NVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQL---LAKQEVSIFN---DNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2897
            CQL +E +S+P+Y       SE + S+ N+            P WL  L+ +     +FSI+S+A+S ++DL+  T+ V         +  +N      S+ +SPN    +      +++G+              +  +  KT FF    L+LW+ L    P+ HQ +V L  +LH   PS+SICE++I Q++   + +  +++H RF +LW L   L   + S +    D S    L S+ + D C                      ++  +WL +  Q     +++ PLLL LL P T R+S+
Sbjct:  743 CQLFLECSSFPVYIAEGSQASEIHASMANTD-----CEQVQPPLWLQTLMNACNMAQDFSIQSVAISLVMDLVGLTQSV-------AVVAGENSSSLEPSQPLSPNQGRVSVVIRPPLTEGN--------------LRYIAEKTDFFKHVALTLWEQLGDQTPKHHQRSVELFYQLHSLVPSSSICEDVISQQLTHKDKKIRMEAHGRFAVLWHLTRDLHINKTSSYGRTFDRSLFIMLDSLNSLDGCTS--------------------SVAQAWLNQVLQRHDIARVLEPLLLLLLHPKTQRVSV 1003          

HSP 3 Score: 97.0561 bits (240), Expect = 3.497e-19
Identity = 87/387 (22.48%), Postives = 174/387 (44.96%), Query Frame = 3
Query: 3498 SNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQI---GYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEK-------TTNILS-------DSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSV-----YKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNI 4592
            S H+ IHPL+ H+LLY  +YDS+  LY+L+ ++ I ++ P + V  +               ++      +  QN    +L+RH  ++ G +FY N  L+   +F+S   +EI++ +C +FM S YP   T  KV+ +D+  N+ +Q+++ EIL  +  E+  +++    G+ +   D ++                 +C V K  LHC+ +SI   +K         NI++       DS++  +E   D       Q  L++++ +++ L++ + T                 +N+  F   +  +      + + S  Y  S P   ++ Q + L +++  +       +H      + S+L   GK    V++ +  +LC+N+
Sbjct: 1324 SPHFNIHPLYQHVLLYLQLYDSSRTLYALTAIKAILKTSPTVFVKAIST----------TNVSNAYTPQLSLLQN----LLARHRISVMGKDFYSNIPLDSNHNFRSSMYIEILISLCLYFMRSHYP---THVKVTQQDLMGNRNMQMMSIEILTLLFTELAKVIESSAKGFASFISDMLS-----------------KCKVQKVILHCLLSSIFSAQKWHSERMAEKNIMAIEEGFSEDSLINFSEDEFDN--GSTLQSQLLKVLQSLIILEHRVLTV--------------PEDNEAGFDFVITDLENINPQQPMTSLQYLHSQP---ITCQGMFLCAVIRALHQHYTCKMHPQWICLMTSTLPYMGKVLQKVVVSVTLQLCRNL 1657          
BLAST of Dopey_N domain-containing protein vs. Ensembl Mouse
Match: Dop1a (DOP1 leucine zipper like protein A [Source:MGI Symbol;Acc:MGI:1289294])

HSP 1 Score: 389.423 bits (999), Expect = 2.435e-108
Identity = 311/1154 (26.95%), Postives = 549/1154 (47.57%), Query Frame = 3
Query: 3498 SNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQI---GYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSI-----TQPEKTTN---------ILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEI---NTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILW---EKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPLT-EKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQN----------------------DINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFL 6818
            S ++ IHPL+ H+LLY  +YDS+  LY+ S +++I ++ P          I+  +   +   N+      +  QN    +L+RH  ++ G +FY +  ++   +F+S   +EI++ +C ++M S YP   T  KV+ +D+  N+ +Q+++ EIL  +  E+  +++    G+ +   D ++                 +C V K  LHC+ +SI        EKT              DS++  +E  LD       Q  L+R++  ++ L++ + T       I  ++  G     +D +   P  ++ + S  Y  + P   ++ Q + L +++  +       +H      I S+L   GK    V++ +  +LC+N+    NL +   Q    T   DS  +   + +P D  L+ L  + A+ H+ LLD   + +QL               L N  +             H+++AR+ ++ ++   + S+ +LW    ++  SEK+ +       +  +G    +RQ IL ++ P+   H    + ++A VW    Q                   N+  +    + +     + ++EL R +      T +I T ++++++   +  +K+   ++V +L+F   ++       +      L  LLK+SI  SLP    F++L +L++FI K    + K++QR++QD+  K+++ +  IAGSSLEQ +W RR  ++K           S +I  DG                                          +L +  ++  +  M T NI  TPS    ++ AL LL+  LA ++D+ + S+EKE+V P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D   +  W+ I+DNLMT DK TF++  T++ V Q   LNLF +++ E +Q AM +K+LAF + SSE DQY K +P+IQE+L ESLRL  +P + +Q+FL FRVLL+R+S QHLTSLW   I  L  V   +  +L  D + I +                       +  + LN+YLSACK LD+   +  +++PQF  Y+WAF+    +++          Q  F+P++
Sbjct: 1354 SPNFNIHPLYQHVLLYLQLYDSSRTLYAFSAIKSILKTNP----------IAFVNAISTTSVNNAYTPQLSLLQN----LLARHRISVMGKDFYSHIPVDSNHNFRSSMYIEILISLCLYYMRSHYP---THVKVTTQDLIGNRNMQMMSIEILTLLFTELAKVIESSAKGFPSFISDMLS-----------------KCKVQKVILHCLLSSIFSVQKWHSEKTAGKSMVAVEEGFSEDSLINFSEDELDNG--STLQSQLLRVLQRLIVLEHHVMT-------IPEENEAGFDFVVSDLEHISP--HQPMTSLQYLHAQP---ITCQGMFLCAVIRALHQHCACKMHPQWIGLITSTLPYMGKVLQRVVVSVTLQLCRNLD---NLIQ---QYKYETGLSDSRPLWVASIIPPDMILTLLEGITAIIHYCLLDPTTQYHQL---------------LVNVDQK------------HLVEARSGILSILHMIMSSVTLLWSILHQADASEKMAVAASASVTTINLGATKNLRQQILELLGPISMNHGVHFMAAIAFVWNERRQ-------------------NKTPSRTKVIPAASEEQLLLVELVRSISVMRAET-VIQTVKEVLKQPPAIAKDKKHLSLEVCMLQFFYAYIQRIPVPNIVDSWTSLLVLLKDSIQLSLPAPGQFLILGVLNEFIMKNPSLENKKDQRDLQDVTHKIVDAIGAIAGSSLEQTTWLRRNLEVK----------PSPKIMVDGT-----------------------------------------NLESDVEDMLSPAMETSNI--TPS--VYSVHALTLLSEVLAHLLDMVFYSDEKERVIPLLVNIMH-YVVPYLRNHSAHNAPSYRACVQLLSSLSGYQYTRRAWKKEAFDLFMDPSFFQMDASCVSHWRAIMDNLMTHDKTTFRDLMTRVAVAQSSSLNLFANRDVELEQRAMLLKRLAFAVLSSESDQYQKYLPDIQERLVESLRLPQVPTLHSQVFLFFRVLLLRMSPQHLTSLWPTMITELVQVFLLMEQELTAD-EDISRTSGPSAAGLETTYTGGNGFSTSYNSQRWLNLYLSACKFLDLALALPSENLPQFQMYRWAFIPEASDDSGLEVRRQGIHQREFKPYV 2349          

HSP 2 Score: 353.599 bits (906), Expect = 3.144e-97
Identity = 218/563 (38.72%), Postives = 332/563 (58.97%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIID-NPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRD-----STIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQ------EVTPSQFP-SFQMTIDRICELVKFIL--IRLPI--------ETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  +D+K+RN+   +DK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++P+K  +GKRL+QCLHPALP GVH KALE +++IF IIGP++LA DLF+Y +G+FPLL+ +AM +K  L  LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +VE   FY+ LW  +L +P+VR  G  ++L H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G + + A     ++   +    + E     E    YF  +S+++L+ A+  I+  N     S  +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L  +         +A       P   +D     S +RE+ K+      E +KTANL F + +  + W+Y+ R F +  ++      +V P     S ++ +   C LV F+L  + LP         ETY ++ + HLP LL  +   L  H+  L +  +   L++   I  K+
Sbjct:    4 EELELLSDSKYRNYVAAIDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPKKLTIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLANAAMSVKPALLGLYEMYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYERTNTLLEKVAAAVEQSAFYSALWGSLLTSPAVRLPGITYVLAHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALHVVLRRDMSLNRRLYAWLLGFDNNGA-----IIGPRSTRHSNPE-----EHATYYFTTFSKELLVQAMVGILQVNGFGEESTLMQDLKPFRILISLLDKPELGPVILEDVLIEVFRTLYSQ--------CKAELDLQMEPPFSKDHAQLSSKLRENKKTA-----ELIKTANLLFNSFEPYYMWDYIARWFEECCRRTLHARLQVGPGDSSDSSELQLTNFCLLVDFLLDIVSLPTRSMRVLCQETYIEIQTEHLPQLLLRMISALTSHLQTLRLSELTDSLRLCSKILSKV 543          

HSP 3 Score: 100.138 bits (248), Expect = 3.274e-20
Identity = 81/297 (27.27%), Postives = 146/297 (49.16%), Query Frame = 3
Query: 2007 CQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2897
            CQL +E +S+P+Y      + S ++S++      +   PQWL  L+++     +F ++S A+S ++DL+  T+ V         +  +N+     ++ +SPN           ++QG+              ++ +  KT+FF    L+LWD L    PQ HQ +V L  +LH   PS+SICE+++ Q++   + +  +++H +F +LW L     +       N SS    R+FD+ + ++LDSL     S        ++  +WL +  Q     +++ PLLL LL P T R+S+
Sbjct:  750 CQLFLECSSFPVYI-AEGNHTSESHSEKPDTDCEHAHPPQWLRTLMSACSQARDFRVQSAAVSLVMDLVGLTQSV-------AMVTGENINSMEPAQPLSPNQGRVAVVIRPPLTQGN--------------LKYIAEKTEFFKHVALTLWDQLGDGTPQHHQKSVELFYQLHNLVPSSSICEDVVSQQLTHKDKKIRMEAHAKFAVLWHLTRDLHI-------NKSSFA--RSFDRSLFIMLDSLTSLDGST------SSVGQAWLNQVLQRHDIARVLEPLLLLLLHPKTQRVSV 1009          
BLAST of Dopey_N domain-containing protein vs. Ensembl Mouse
Match: Dop1a (DOP1 leucine zipper like protein A [Source:MGI Symbol;Acc:MGI:1289294])

HSP 1 Score: 389.423 bits (999), Expect = 2.435e-108
Identity = 311/1154 (26.95%), Postives = 549/1154 (47.57%), Query Frame = 3
Query: 3498 SNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQI---GYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSI-----TQPEKTTN---------ILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEI---NTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILW---EKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPLT-EKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQN----------------------DINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFL 6818
            S ++ IHPL+ H+LLY  +YDS+  LY+ S +++I ++ P          I+  +   +   N+      +  QN    +L+RH  ++ G +FY +  ++   +F+S   +EI++ +C ++M S YP   T  KV+ +D+  N+ +Q+++ EIL  +  E+  +++    G+ +   D ++                 +C V K  LHC+ +SI        EKT              DS++  +E  LD       Q  L+R++  ++ L++ + T       I  ++  G     +D +   P  ++ + S  Y  + P   ++ Q + L +++  +       +H      I S+L   GK    V++ +  +LC+N+    NL +   Q    T   DS  +   + +P D  L+ L  + A+ H+ LLD   + +QL               L N  +             H+++AR+ ++ ++   + S+ +LW    ++  SEK+ +       +  +G    +RQ IL ++ P+   H    + ++A VW    Q                   N+  +    + +     + ++EL R +      T +I T ++++++   +  +K+   ++V +L+F   ++       +      L  LLK+SI  SLP    F++L +L++FI K    + K++QR++QD+  K+++ +  IAGSSLEQ +W RR  ++K           S +I  DG                                          +L +  ++  +  M T NI  TPS    ++ AL LL+  LA ++D+ + S+EKE+V P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D   +  W+ I+DNLMT DK TF++  T++ V Q   LNLF +++ E +Q AM +K+LAF + SSE DQY K +P+IQE+L ESLRL  +P + +Q+FL FRVLL+R+S QHLTSLW   I  L  V   +  +L  D + I +                       +  + LN+YLSACK LD+   +  +++PQF  Y+WAF+    +++          Q  F+P++
Sbjct: 1354 SPNFNIHPLYQHVLLYLQLYDSSRTLYAFSAIKSILKTNP----------IAFVNAISTTSVNNAYTPQLSLLQN----LLARHRISVMGKDFYSHIPVDSNHNFRSSMYIEILISLCLYYMRSHYP---THVKVTTQDLIGNRNMQMMSIEILTLLFTELAKVIESSAKGFPSFISDMLS-----------------KCKVQKVILHCLLSSIFSVQKWHSEKTAGKSMVAVEEGFSEDSLINFSEDELDNG--STLQSQLLRVLQRLIVLEHHVMT-------IPEENEAGFDFVVSDLEHISP--HQPMTSLQYLHAQP---ITCQGMFLCAVIRALHQHCACKMHPQWIGLITSTLPYMGKVLQRVVVSVTLQLCRNLD---NLIQ---QYKYETGLSDSRPLWVASIIPPDMILTLLEGITAIIHYCLLDPTTQYHQL---------------LVNVDQK------------HLVEARSGILSILHMIMSSVTLLWSILHQADASEKMAVAASASVTTINLGATKNLRQQILELLGPISMNHGVHFMAAIAFVWNERRQ-------------------NKTPSRTKVIPAASEEQLLLVELVRSISVMRAET-VIQTVKEVLKQPPAIAKDKKHLSLEVCMLQFFYAYIQRIPVPNIVDSWTSLLVLLKDSIQLSLPAPGQFLILGVLNEFIMKNPSLENKKDQRDLQDVTHKIVDAIGAIAGSSLEQTTWLRRNLEVK----------PSPKIMVDGT-----------------------------------------NLESDVEDMLSPAMETSNI--TPS--VYSVHALTLLSEVLAHLLDMVFYSDEKERVIPLLVNIMH-YVVPYLRNHSAHNAPSYRACVQLLSSLSGYQYTRRAWKKEAFDLFMDPSFFQMDASCVSHWRAIMDNLMTHDKTTFRDLMTRVAVAQSSSLNLFANRDVELEQRAMLLKRLAFAVLSSESDQYQKYLPDIQERLVESLRLPQVPTLHSQVFLFFRVLLLRMSPQHLTSLWPTMITELVQVFLLMEQELTAD-EDISRTSGPSAAGLETTYTGGNGFSTSYNSQRWLNLYLSACKFLDLALALPSENLPQFQMYRWAFIPEASDDSGLEVRRQGIHQREFKPYV 2349          

HSP 2 Score: 353.599 bits (906), Expect = 3.144e-97
Identity = 218/563 (38.72%), Postives = 332/563 (58.97%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIID-NPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRD-----STIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQ------EVTPSQFP-SFQMTIDRICELVKFIL--IRLPI--------ETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  +D+K+RN+   +DK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++P+K  +GKRL+QCLHPALP GVH KALE +++IF IIGP++LA DLF+Y +G+FPLL+ +AM +K  L  LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +VE   FY+ LW  +L +P+VR  G  ++L H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G + + A     ++   +    + E     E    YF  +S+++L+ A+  I+  N     S  +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L  +         +A       P   +D     S +RE+ K+      E +KTANL F + +  + W+Y+ R F +  ++      +V P     S ++ +   C LV F+L  + LP         ETY ++ + HLP LL  +   L  H+  L +  +   L++   I  K+
Sbjct:    4 EELELLSDSKYRNYVAAIDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPKKLTIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLANAAMSVKPALLGLYEMYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYERTNTLLEKVAAAVEQSAFYSALWGSLLTSPAVRLPGITYVLAHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALHVVLRRDMSLNRRLYAWLLGFDNNGA-----IIGPRSTRHSNPE-----EHATYYFTTFSKELLVQAMVGILQVNGFGEESTLMQDLKPFRILISLLDKPELGPVILEDVLIEVFRTLYSQ--------CKAELDLQMEPPFSKDHAQLSSKLRENKKTA-----ELIKTANLLFNSFEPYYMWDYIARWFEECCRRTLHARLQVGPGDSSDSSELQLTNFCLLVDFLLDIVSLPTRSMRVLCQETYIEIQTEHLPQLLLRMISALTSHLQTLRLSELTDSLRLCSKILSKV 543          

HSP 3 Score: 100.138 bits (248), Expect = 3.274e-20
Identity = 81/297 (27.27%), Postives = 146/297 (49.16%), Query Frame = 3
Query: 2007 CQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2897
            CQL +E +S+P+Y      + S ++S++      +   PQWL  L+++     +F ++S A+S ++DL+  T+ V         +  +N+     ++ +SPN           ++QG+              ++ +  KT+FF    L+LWD L    PQ HQ +V L  +LH   PS+SICE+++ Q++   + +  +++H +F +LW L     +       N SS    R+FD+ + ++LDSL     S        ++  +WL +  Q     +++ PLLL LL P T R+S+
Sbjct:  750 CQLFLECSSFPVYI-AEGNHTSESHSEKPDTDCEHAHPPQWLRTLMSACSQARDFRVQSAAVSLVMDLVGLTQSV-------AMVTGENINSMEPAQPLSPNQGRVAVVIRPPLTQGN--------------LKYIAEKTEFFKHVALTLWDQLGDGTPQHHQKSVELFYQLHNLVPSSSICEDVVSQQLTHKDKKIRMEAHAKFAVLWHLTRDLHI-------NKSSFA--RSFDRSLFIMLDSLTSLDGST------SSVGQAWLNQVLQRHDIARVLEPLLLLLLHPKTQRVSV 1009          
BLAST of Dopey_N domain-containing protein vs. Ensembl Mouse
Match: Dop1a (DOP1 leucine zipper like protein A [Source:MGI Symbol;Acc:MGI:1289294])

HSP 1 Score: 358.607 bits (919), Expect = 4.896e-106
Identity = 216/553 (39.06%), Postives = 331/553 (59.86%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIID-NPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRD-----STIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQ------EVTPSQFP-SFQMTIDRICELVKFILIRLPIETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  +D+K+RN+   +DK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++P+K  +GKRL+QCLHPALP GVH KALE +++IF IIGP++LA DLF+Y +G+FPLL+ +AM +K  L  LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +VE   FY+ LW  +L +P+VR  G  ++L H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G + + A     ++   +    + E     E    YF  +S+++L+ A+  I+  N     S  +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L  +         +A       P   +D     S +RE+ K+      E +KTANL F + +  + W+Y+ R F +  ++      +V P     S ++ +   C LV F+L  + +ETY ++ + HLP LL  +   L  H+  L +  +   L++   I  K+
Sbjct:    4 EELELLSDSKYRNYVAAIDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPKKLTIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLANAAMSVKPALLGLYEMYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYERTNTLLEKVAAAVEQSAFYSALWGSLLTSPAVRLPGITYVLAHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALHVVLRRDMSLNRRLYAWLLGFDNNGA-----IIGPRSTRHSNPE-----EHATYYFTTFSKELLVQAMVGILQVNGFGEESTLMQDLKPFRILISLLDKPELGPVILEDVLIEVFRTLYSQ--------CKAELDLQMEPPFSKDHAQLSSKLRENKKTA-----ELIKTANLLFNSFEPYYMWDYIARWFEECCRRTLHARLQVGPGDSSDSSELQLTNFCLLVDFLLDIVSLETYIEIQTEHLPQLLLRMISALTSHLQTLRLSELTDSLRLCSKILSKV 533          
BLAST of Dopey_N domain-containing protein vs. Ensembl Mouse
Match: Dop1a (DOP1 leucine zipper like protein A [Source:MGI Symbol;Acc:MGI:1289294])

HSP 1 Score: 352.829 bits (904), Expect = 9.319e-98
Identity = 218/570 (38.25%), Postives = 327/570 (57.37%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIID-NPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRD-----STIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQ-------------EVTPSQFP-SFQMTIDRICELVKFIL--IRLPI--------ETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  +D+K+RN+   +DK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++P+K  +GKRL+QCLHPALP GVH KALE +++IF IIGP++LA DLF+Y +G+FPLL+ +AM +K  L  LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +VE   FY+ LW  +L +P+VR  G  ++L H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G    R +                   +  E    YF  +S+++L+ A+  I+  N     S  +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L  +         +A       P   +D     S +RE+ K+      E +KTANL F + +  + W+Y+ R F +  +Q             +V P     S ++ +   C LV F+L  + LP         ETY ++ + HLP LL  +   L  H+  L +  +   L++   I  K+
Sbjct:    4 EELELLSDSKYRNYVAAIDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPKKLTIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLANAAMSVKPALLGLYEMYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYERTNTLLEKVAAAVEQSAFYSALWGSLLTSPAVRLPGITYVLAHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALHVVLRRDMSLNRRLYAWLLGPRSTRHS-------------------NPEEHATYYFTTFSKELLVQAMVGILQVNGFGEESTLMQDLKPFRILISLLDKPELGPVILEDVLIEVFRTLYSQ--------CKAELDLQMEPPFSKDHAQLSSKLRENKKTA-----ELIKTANLLFNSFEPYYMWDYIARWFEECCRQSFFLSRRTLHARLQVGPGDSSDSSELQLTNFCLLVDFLLDIVSLPTRSMRVLCQETYIEIQTEHLPQLLLRMISALTSHLQTLRLSELTDSLRLCSKILSKV 541          

HSP 2 Score: 100.138 bits (248), Expect = 3.590e-20
Identity = 81/297 (27.27%), Postives = 146/297 (49.16%), Query Frame = 3
Query: 2007 CQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2897
            CQL +E +S+P+Y      + S ++S++      +   PQWL  L+++     +F ++S A+S ++DL+  T+ V         +  +N+     ++ +SPN           ++QG+              ++ +  KT+FF    L+LWD L    PQ HQ +V L  +LH   PS+SICE+++ Q++   + +  +++H +F +LW L     +       N SS    R+FD+ + ++LDSL     S        ++  +WL +  Q     +++ PLLL LL P T R+S+
Sbjct:  748 CQLFLECSSFPVYI-AEGNHTSESHSEKPDTDCEHAHPPQWLRTLMSACSQARDFRVQSAAVSLVMDLVGLTQSV-------AMVTGENINSMEPAQPLSPNQGRVAVVIRPPLTQGN--------------LKYIAEKTEFFKHVALTLWDQLGDGTPQHHQKSVELFYQLHNLVPSSSICEDVVSQQLTHKDKKIRMEAHAKFAVLWHLTRDLHI-------NKSSFA--RSFDRSLFIMLDSLTSLDGST------SSVGQAWLNQVLQRHDIARVLEPLLLLLLHPKTQRVSV 1007          

HSP 3 Score: 90.5077 bits (223), Expect = 2.662e-17
Identity = 88/382 (23.04%), Postives = 175/382 (45.81%), Query Frame = 3
Query: 3498 SNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQI---GYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSI-----TQPEKTT---------NILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNI 4592
            S ++ IHPL+ H+LLY  +YDS+  LY+ S +++I ++ P          I+  +   +   N+      +  QN    +L+RH  ++ G +FY +  ++   +F+S   +EI++ +C ++M S YP   T  KV+ +D+  N+ +Q+++ EIL  +  E+  +++    G+ +   D ++                 +C V K  LHC+ +SI        EKT              DS++  +E  LD       Q  L+R++  ++ L++ + T       I  ++  G     +D +   P  ++ + S  Y  + P   ++ Q + L +++  +       +H      I S+L   GK    V++ +  +LC+N+
Sbjct: 1352 SPNFNIHPLYQHVLLYLQLYDSSRTLYAFSAIKSILKTNP----------IAFVNAISTTSVNNAYTPQLSLLQN----LLARHRISVMGKDFYSHIPVDSNHNFRSSMYIEILISLCLYYMRSHYP---THVKVTTQDLIGNRNMQMMSIEILTLLFTELAKVIESSAKGFPSFISDMLS-----------------KCKVQKVILHCLLSSIFSVQKWHSEKTAGKSMVAVEEGFSEDSLINFSEDELDN--GSTLQSQLLRVLQRLIVLEHHVMT-------IPEENEAGFDFVVSDLEHISP--HQPMTSLQYLHAQP---ITCQGMFLCAVIRALHQHCACKMHPQWIGLITSTLPYMGKVLQRVVVSVTLQLCRNL 1685          
BLAST of Dopey_N domain-containing protein vs. Ensembl Mouse
Match: Dop1b (DOP1 leucine zipper like protein B [Source:MGI Symbol;Acc:MGI:1917278])

HSP 1 Score: 321.627 bits (823), Expect = 1.247e-87
Identity = 303/1207 (25.10%), Postives = 531/1207 (43.99%), Query Frame = 3
Query: 3513 IHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVS--FDRCNVAKYALHCMSTSITQPEKTTNILS----------DSIMLLNES----GLDQRVRDAA-QVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILW----EKSSLSEKINLNQECIPPSWTMGRPDK-VRQMILSIIKPLMRQHPSIILISLARVW------PHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPLTEKEEGQ-VKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTG-DERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIK------SIKQNDINKR----------------LNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFT 6974
            +  L  H+LLY   YDS  VLY+ S L  + ++ P   +  +                + +  S   + N I  +L+RH  AL G +FY     +          +E++  +C  F+ S YP      KV   DI  N+ VQ+ + E+L  I  +++++ +                  E KN   +     RC V ++ L  +S S+   +K   + +          DS  L  ES    G DQ   +   Q+ L++L+  ++ L++ L        G   ++++ +     +++  L +  + + +  Y    P   ++ Q +L++++V  +       +H      +  SL  +GKS    + P V ++CKN+      YES  + + +T    S + N  P DY L+ L  L  + HF LL++  +                             K  ++S   ++ +A+N +++ + R ++++ ++W    ++ +    ++L       S    +  K +RQ IL ++ PL       ++ ++A VW       H    ++   N SQ  L+  VC      ++S                           ++   ++++++   +   E+   V + +L+F   F+   S   L      L G+LKE+   +L P   F+LL +L+DF+++    + K++Q+++Q++ Q++LE V  IAGSSLEQ SW  R  ++K       +E    ++++T                            G+   ST +            A   S Y                ++QAL+LL   LAS++D+ Y+S+EKEK  P ++ +++  V PYLR  S+ N  +FR  +QL++SLS Y +T+R+W+K++ +L  +  FFQ D  S   WK +ID+L+T +K  FK+     + +            + ++Q AM +K+ AF ++S ELDQY   +P IQE+L+++LR+G    +  Q+FL FRVLL+RIS QHLTSLW I +   + ++Q  I   +   +      S K N I                   L MYLSACK LD       D +P F  Y+WAFV  +D E   F S         RP    +++     Y  +G   +S E+  +    E PL+ + S+  +  L PFF T
Sbjct: 1101 VEALFKHILLYLQPYDSQRVLYAFSVLEAVLKTNPKEFIEAVSR--------------TGIDTSSTAHLNLISNLLARHQEALIGQSFYGKLQTQAPNVCPHSLLIELLTYLCLSFLRSYYP---CYLKVCHRDILGNRDVQVKSVEVLIRITAQLVSMAKSA----------------EGKNTEFIHSLLQRCKVQEFVLLSLSASMYTSQKRYGLATADRGGRLLAEDS--LFEESLINLGQDQIWSEHPLQIELLKLLQALIVLEHHL--------GQGQEEAETQPALSREWQRAL-NFQQAIGAMQYVQPHP---LTSQGLLVSAVVRGLQPAYGYGMHPAWVSLVTHSLPYFGKSLGWTVTPFVIQICKNLDDLVKQYES--ESVKFTISTTSKKENISP-DYPLTLLEGLTTISHFCLLEQPTQH---------------------------KKTAAVSDPINLRNAKNAILEELPRIVNTMALIWNVLRKEETQKRPVDLLGATKGSSSVYFKTTKTIRQKILDLLNPLTGHLGVQLIAAVATVWNRKQARRHSKTKMVPVANTSQHTLVDLVCALSTLQTDS---------------------------VLQLVKEVVKRPAQIKGDEKSPLVDIPVLQFCYAFIQRLSIPDLQEAFPSLLGVLKEAAQLNLAPPGYFLLLSMLNDFVTRTPNLESKKDQKDLQEITQRILEAVGTIAGSSLEQTSWLSRNLEVKAQPQVSLEESDAEDDVHT----------------------------GAAEASTMVS-----------ASAPSVY----------------SVQALSLLAEVLASLLDMVYRSDEKEKAVPLISRLLY-YVFPYLRNHSAYNAPSFRAGAQLLSSLSGYAYTKRAWKKEVLELFLDPAFFQMDT-SCVHWKSVIDHLLTHEKTMFKDLMNMQSSS--------LKLFSSFEQKAMLLKRQAFAVFSGELDQYHLYLPLIQERLTDNLRVGQTSIVAGQMFLFFRVLLLRISPQHLTSLWPIMV---SELIQTFIQLEEDLKEEDESRNSHKSNRIKAPVADGNGSAGRVLSPSDLTMYLSACKFLDTALAFPPDKMPLFQIYRWAFVPEVDTEHPAFLSELEENHQECRPHTVRILELLRSRYGEIG---SSDEITRK---KEFPLLRQHSVSCIRQLIPFFTT 2129          

HSP 2 Score: 159.458 bits (402), Expect = 3.299e-38
Identity = 148/479 (30.90%), Postives = 231/479 (48.23%), Query Frame = 3
Query:  372 MHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRS--------QLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSA--SERISS-IKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLF---VKALKQEVTPSQFPSFQMTIDRICELVKFILIRLPIETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKIFQNASQTFDVSTLHNPVSIPTSNSTARKPSLAMYTSNLTS 1766
            M ++  L  LYEKYF+ L   + P+    L GLLPGLEEG+E Y R + +L + +  V    FY  LW  +L +PS+R   + F++NH +R     +Q   LG    L + SL   L D  VLVQR  L+ +LF    +           L   D   + +A    LLRRDMSLNRR Y+WL+G+++ + N I    E  N ++              +F KYS+D+L+ A+  I+      A   ER  + +KPFRI+ +L+D+ EIG  ++E++   +I      Y     +     K +     N   STI+E+  +      E +KT NL  ++L S F W+Y+ R F    + + Q     +  S   T+  +C L+ F+L  +P+E YS+V +++LP +L  L   L E V  L +  +   L+    +  K+ Q      D+     P S  +S    R   +AM T  + +
Sbjct:    1 MSVRPVLLGLYEKYFLPLQKLLLPSLQAFLVGLLPGLEEGSEIYERTDALLLRLSVVVGREVFYAALWGSVLTSPSIRLPASLFVVNHISRDSPGKEQKCMLGTDYQLTVRSLCASLLDANVLVQRNNLEIILFFFPFYTCLDPEERAIPLLRRDVVHILSAATQTLLRRDMSLNRRLYAWLLGSDI-KGNTIVPKSEISNSYEDQCS---------YFFDKYSKDLLVEALAEILHQKFLDADLEERHHAYLKPFRILVSLLDKPEIGPQVVENLFLEVIRAF---YSYCHDVLGSDLKLSYTQSGNPLISTIKENRHAS-----EIVKTVNLLVSSLSSDFLWDYMARRFEACFRPVTQTTAIGEAISPPPTVSELCTLLVFLLDVIPLELYSEVQTQYLPQVLGCLLQPLAEEVEALSLPELTHALKTCFKVLSKV-QMPPSYLDL----EPSSGNSSPVKGRNSGIAMETEAVVA 456          

HSP 3 Score: 71.2478 bits (173), Expect = 2.134e-11
Identity = 80/333 (24.02%), Postives = 146/333 (43.84%), Query Frame = 3
Query: 1968 SVDLIVVEVY--HEICQ--------LVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCIS----------WLEKAFQDGHAHKIVNPLLLALLKPDTARISLPSL 2906
             VD +VVE+    E C+        L+++  ++P+Y +  E+ E +  +       ++   P WL  L+T  C +++ S+++IA++ LL++I        H      +    MK++  S +        NP   K          V +  ++  +++ +  KT F+      LW+ L+    + H   V L  RLH  AP+A+ICE++I   +L  +    L++  RF ++W L  + + S    ++        R+FD+ +                 VVL +L  +          WL +A   G   +I+ P+LL LL+P T R S+  L
Sbjct:  611 GVDQVVVELVGSKEDCREALAAACHLLLDCATFPVYLS-EEETEQLCETLFQTPGASDCSFPPWLKSLMTICCCVSDCSLQNIAIATLLEVI-------NHSQSLALVIEDKMKRYKTSGN--------NPFFGK-------LQMVTVPPIAPGILKVIAEKTDFYQRVARVLWNQLNKETREHHITCVELFYRLHCLAPTANICEDIICHALLDPDKGTRLEALFRFSVIWHLTREIQGSRVTSHN--------RSFDRSL----------------FVVLDSLACTDGAISAAAQGWLVRALSLGDVARILEPMLLLLLQPKTQRTSIQCL 896          
BLAST of Dopey_N domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5JWR5|DOP1_HUMAN (Protein dopey-1 OS=Homo sapiens OX=9606 GN=DOP1A PE=2 SV=1)

HSP 1 Score: 394.43 bits (1012), Expect = 5.637e-109
Identity = 310/1153 (26.89%), Postives = 553/1153 (47.96%), Query Frame = 3
Query: 3498 SNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQI---GYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEK-------TTNILS-------DSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEI---NTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILW---EKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPLT-EKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCD----------IKSIKQN-----------DINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFL 6818
            S ++ IHPL+ H+LLY  +YDS+  LY+ S ++ I ++ P          I+  +   +   N+      +  QN    +L+RH  ++ G +FY +  ++   +F+S   +EI++ +C ++M S YP   T  KV+ +D+  N+ +Q+++ EIL  +  E+  +++    G+ +   D ++                 +C V K  LHC+ +SI   +K         N+++       DS++  +E   D       Q  L++++  ++ L++ + T       I  ++  G     +D +   P  ++ + S  Y  + P   ++ Q + L +++  +       +H      I S+L   GK    V++ +  +LC+N+    NL +   Q    T   DS  +   + +P D  L+ L  + A+ H+ LLD   + +QL            L ++  K               H+ +AR+ ++ ++   + S+ +LW    ++  SEK+ +       +  +G    +RQ IL ++ P+   H    + ++A VW    Q                   N+ +T    + +     + ++EL R +      T +I T ++++++   +  +K+   ++V +L+F   ++       L      L  LLK+SI  SLP    F++L +L++FI K    + K++QR++QD+  K+++ +  IAGSSLEQ +W RR  ++K           S +I  DG                                          +L +  ++  +  M T NI  TPS    ++ AL LL+  LA ++D+ + S+EKE+V P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D   +  W+ I+DNLMT DK TF++  T++ V Q   LNLF +++ E +Q AM +K+LAF I+SSE+DQY K +P+IQE+L ESLRL  +P + +Q+FL FRVLL+R+S QHLTSLW   I  L  V   +  +L  D          +  ++             +  + LN+YLSACK LD+   +  +++PQF  Y+WAF+    +++          Q  F+P++
Sbjct: 1357 SPNFNIHPLYQHVLLYLQLYDSSRTLYAFSAIKAILKTNP----------IAFVNAISTTSVNNAYTPQLSLLQN----LLARHRISVMGKDFYSHIPVDSNHNFRSSMYIEILISLCLYYMRSHYP---THVKVTAQDLIGNRNMQMMSIEILTLLFTELAKVIESSAKGFPSFISDMLS-----------------KCKVQKVILHCLLSSIFSAQKWHSEKMAGKNLVAVEEGFSEDSLINFSEDEFDNG--STLQSQLLKVLQRLIVLEHRVMT-------IPEENETGFDFVVSDLEHISP--HQPMTSLQYLHAQP---ITCQGMFLCAVIRALHQHCACKMHPQWIGLITSTLPYMGKVLQRVVVSVTLQLCRNLD---NLIQ---QYKYETGLSDSRPLWMASIIPPDMILTLLEGITAIIHYCLLDPTTQYHQL------------LVSVDQK---------------HLFEARSGILSILHMIMSSVTLLWSILHQADSSEKMTIAASASLTTINLGATKNLRQQILELLGPISMNHGVHFMAAIAFVWNERRQ-------------------NKTTTRTKVIPAASEEQLLLVELVRSISVMRAET-VIQTVKEVLKQPPAIAKDKKHLSLEVCMLQFFYAYIQRIPVPNLVDSWASLLILLKDSIQLSLPAPGQFLILGVLNEFIMKNPSLENKKDQRDLQDVTHKIVDAIGAIAGSSLEQTTWLRRNLEVK----------PSPKIMVDGT-----------------------------------------NLESDVEDMLSPAMETANI--TPS--VYSVHALTLLSEVLAHLLDMVFYSDEKERVIPLLVNIMH-YVVPYLRNHSAHNAPSYRACVQLLSSLSGYQYTRRAWKKEAFDLFMDPSFFQMDASCVNHWRAIMDNLMTHDKTTFRDLMTRVAVAQSSSLNLFANRDVELEQRAMLLKRLAFAIFSSEIDQYQKYLPDIQERLVESLRLPQVPTLHSQVFLFFRVLLLRMSPQHLTSLWPTMITELVQVFLLMEQELTADEDISRTSGPSVAGLETTYTGGNGFSTSYNSQRWLNLYLSACKFLDLALALPSENLPQFQMYRWAFIPEASDDSGLEVRRQGIHQREFKPYV 2352          

HSP 2 Score: 348.591 bits (893), Expect = 7.160e-95
Identity = 214/558 (38.35%), Postives = 334/558 (59.86%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIID-NPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQ------EVTPSQF-PSFQMTIDRICELVKFIL--IRLPI--------ETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  +D+K+RN+   +DK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++P+K  +GKRL+QCLHPALP GVH KALE +++IF IIGP++LA DLF+Y +G+FPLL+ +AM +K  L +LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +V+   FY+ LW  +L +P+VR  G  ++L H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G + + A     ++   +    + E     E    YF  +S+++L+ A+  I+  N     +  +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L  +      L +E   + +    +   S +RE+ K+      E +KTANL F + +  + W+Y+ R F +  ++      ++ P     S ++ +   C LV F+L  + LP         ETY ++ + HLP LL  +   L  H+  L +  +   L++   I  K+
Sbjct:    4 EELELLSDSKYRNYVAAIDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPKKLTIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLANAAMSVKPTLLSLYEIYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYERTNMLLEKVAAAVDQSAFYSALWGSLLTSPAVRLPGITYVLAHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALHVVLRRDMSLNRRLYAWLLGFDNNGA-----IIGPRSTRHSNPE-----EHATYYFTTFSKELLVQAMVGILQVNGFGEENTLMQDLKPFRILISLLDKPELGPVILEDVLIEVFRTLYSQCKAELDLQTEPPFSKDHAQLS---SKLRENKKTA-----ELIKTANLLFNSFEPYYMWDYVARWFEECCRRTLHVRLQIGPGDSNDSSELQLTNFCLLVDFLLDIVSLPTRSMRVLCQETYIEIQTEHLPQLLLRMISALTSHLQTLHLSELTDSLRLCSKILSKV 543          

HSP 3 Score: 100.908 bits (250), Expect = 1.736e-19
Identity = 82/297 (27.61%), Postives = 148/297 (49.83%), Query Frame = 3
Query: 2007 CQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2897
            CQL +E +S+P+Y      + S   S++      +   PQWL  L+ +    ++FS++S+A+S ++DL+  T+ V         +  +N+     ++ +SPN           ++QG+              +  +  KT+FF    L+LWD L    PQ HQ +V L  +LH   PS+SICE++I Q++   + +  +++H +F +LW L     +   N +S+      +R+FD+ + ++LDSL+    S        ++  +WL +  Q     +++ PLLL LL P T R+S+
Sbjct:  751 CQLFLECSSFPVYI-AEGNHTSELRSEKLETDCEHVQPPQWLQTLMNACSQASDFSVQSVAISLVMDLVGLTQSV-------AMVTGENINSVEPAQPLSPNQGRVAVVIRPPLTQGN--------------LRYIAEKTEFFKHVALTLWDQLGDGTPQHHQKSVELFYQLHNLVPSSSICEDVISQQLTHKDKKIRMEAHAKFAVLWHLTRDLHI---NKSSSF-----VRSFDRSLFIMLDSLNSLDGST------SSVGQAWLNQVLQRHDIARVLEPLLLLLLHPKTQRVSV 1011          
BLAST of Dopey_N domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BL99|DOP1_MOUSE (Protein dopey-1 OS=Mus musculus OX=10090 GN=Dop1a PE=1 SV=2)

HSP 1 Score: 357.836 bits (917), Expect = 8.903e-98
Identity = 217/560 (38.75%), Postives = 331/560 (59.11%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIID-NPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRD-----STIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQ-------------EVTPSQFP-SFQMTIDRICELVKFILIRLPIETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  +D+K+RN+   +DK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++P+K  +GKRL+QCLHPALP GVH KALE +++IF IIGP++LA DLF+Y +G+FPLL+ +AM +K  L  LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +VE   FY+ LW  +L +P+VR  G  ++L H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G + + A     ++   +    + E     E    YF  +S+++L+ A+  I+  N     S  +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L  +         +A       P   +D     S +RE+ K+      E +KTANL F + +  + W+Y+ R F +  +Q             +V P     S ++ +   C LV F+L  + +ETY ++ + HLP LL  +   L  H+  L +  +   L++   I  K+
Sbjct:    4 EELELLSDSKYRNYVAAIDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPKKLTIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLANAAMSVKPALLGLYEMYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYERTNTLLEKVAAAVEQSAFYSALWGSLLTSPAVRLPGITYVLAHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALHVVLRRDMSLNRRLYAWLLGFDNNGA-----IIGPRSTRHSNPE-----EHATYYFTTFSKELLVQAMVGILQVNGFGEESTLMQDLKPFRILISLLDKPELGPVILEDVLIEVFRTLYSQ--------CKAELDLQMEPPFSKDHAQLSSKLRENKKTA-----ELIKTANLLFNSFEPYYMWDYIARWFEECCRQSFFLSRRTLHARLQVGPGDSSDSSELQLTNFCLLVDFLLDIVSLETYIEIQTEHLPQLLLRMISALTSHLQTLRLSELTDSLRLCSKILSKV 540          

HSP 2 Score: 246.514 bits (628), Expect = 8.016e-64
Identity = 174/536 (32.46%), Postives = 277/536 (51.68%), Query Frame = 3
Query: 5229 ICILELARGLKKSFTITHIINTCRDIIRKSFPLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLIS-----GCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQNDINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFL 6818
            + ++EL R +      T +I T ++++++  P   K+    KV  L F + F     + ++ + +       L  LLK+SI  SLP    F++L +L++FI K    + K++QR++QD+  K+++ +  IAGSSLEQ +W RR  ++K           S +I  DG                                          +L +  ++  +  M T NI  TPS    ++ AL LL+  LA ++D+ + S+EKE+V P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D   +  W+ I+DNLMT DK TF++  T++ V Q   LNLF +++ E +Q AM +K+LAF + SSE DQY K +P+IQE+L ESLRL   PQ+  Q+FL        +  Q LT+   I      S           +  S   N   + LN+YLSACK LD+   +  +++PQF  Y+WAF+    +++          Q  F+P++
Sbjct: 1810 LLLVELVRSISVMRAET-VIQTVKEVLKQP-PAIAKD----KVRKLCFCRKFSFRTGADRIPVPNIVDSWTSLLVLLKDSIQLSLPAPGQFLILGVLNEFIMKNPSLENKKDQRDLQDVTHKIVDAIGAIAGSSLEQTTWLRRNLEVK----------PSPKIMVDGT-----------------------------------------NLESDVEDMLSPAMETSNI--TPS--VYSVHALTLLSEVLAHLLDMVFYSDEKERVIPLLVNIMH-YVVPYLRNHSAHNAPSYRACVQLLSSLSGYQYTRRAWKKEAFDLFMDPSFFQMDASCVSHWRAIMDNLMTHDKTTFRDLMTRVAVAQSSSLNLFANRDVELEQRAMLLKRLAFAVLSSESDQYQKYLPDIQERLVESLRL---PQV--QVFL--------LMEQELTADEDISRTSGPSAAGLETTYTGGNGFSTSYNS-QRWLNLYLSACKFLDLALALPSENLPQFQMYRWAFIPEASDDSGLEVRRQGIHQREFKPYV 2269          

HSP 3 Score: 101.293 bits (251), Expect = 1.042e-19
Identity = 116/513 (22.61%), Postives = 228/513 (44.44%), Query Frame = 3
Query: 3498 SNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQI---GYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSI-----TQPEKTT---------NILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEI---NTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILW---EKSSLSEKI 4967
            S ++ IHPL+ H+LLY  +YDS+  LY+ S +++I ++ P          I+  +   +   N+      +  QN    +L+RH  ++ G +FY +  ++   +F+S   +EI++ +C ++M S YP   T  KV+ +D+  N+ +Q+++ EIL  +  E+  +++    G+ +   D ++                 +C V K  LHC+ +SI        EKT              DS++  +E  LD       Q  L+R++  ++ L++ + T       I  ++  G     +D +   P  ++ + S  Y  + P   ++ Q + L +++  +       +H      I S+L   GK    V++ +  +LC+N+    NL +   Q    T   DS  +   + +P D  L+ L  + A+ H+ LLD   + +QL               L N  +             H+++AR+ ++ ++   + S+ +LW    ++  SEK+
Sbjct: 1352 SPNFNIHPLYQHVLLYLQLYDSSRTLYAFSAIKSILKTNP----------IAFVNAISTTSVNNAYTPQLSLLQN----LLARHRISVMGKDFYSHIPVDSNHNFRSSMYIEILISLCLYYMRSHYP---THVKVTTQDLIGNRNMQMMSIEILTLLFTELAKVIESSAKGFPSFISDMLS-----------------KCKVQKVILHCLLSSIFSVQKWHSEKTAGKSMVAVEEGFSEDSLINFSEDELDN--GSTLQSQLLRVLQRLIVLEHHVMT-------IPEENEAGFDFVVSDLEHISP--HQPMTSLQYLHAQP---ITCQGMFLCAVIRALHQHCACKMHPQWIGLITSTLPYMGKVLQRVVVSVTLQLCRNLD---NLIQ---QYKYETGLSDSRPLWVASIIPPDMILTLLEGITAIIHYCLLDPTTQYHQL---------------LVNVDQK------------HLVEARSGILSILHMIMSSVTLLWSILHQADASEKM 1783          

HSP 4 Score: 100.523 bits (249), Expect = 2.147e-19
Identity = 81/297 (27.27%), Postives = 146/297 (49.16%), Query Frame = 3
Query: 2007 CQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2897
            CQL +E +S+P+Y      + S ++S++      +   PQWL  L+++     +F ++S A+S ++DL+  T+ V         +  +N+     ++ +SPN           ++QG+              ++ +  KT+FF    L+LWD L    PQ HQ +V L  +LH   PS+SICE+++ Q++   + +  +++H +F +LW L     +       N SS    R+FD+ + ++LDSL     S        ++  +WL +  Q     +++ PLLL LL P T R+S+
Sbjct:  748 CQLFLECSSFPVYI-AEGNHTSESHSEKPDTDCEHAHPPQWLRTLMSACSQARDFRVQSAAVSLVMDLVGLTQSV-------AMVTGENINSMEPAQPLSPNQGRVAVVIRPPLTQGN--------------LKYIAEKTEFFKHVALTLWDQLGDGTPQHHQKSVELFYQLHNLVPSSSICEDVVSQQLTHKDKKIRMEAHAKFAVLWHLTRDLHI-------NKSSFA--RSFDRSLFIMLDSLTSLDGST------SSVGQAWLNQVLQRHDIARVLEPLLLLLLHPKTQRVSV 1007          
BLAST of Dopey_N domain-containing protein vs. UniProt/SwissProt
Match: sp|Q642P2|DOP2_XENLA (Protein dopey-2 OS=Xenopus laevis OX=8355 GN=dop1b PE=2 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 1.126e-86
Identity = 311/1198 (25.96%), Postives = 538/1198 (44.91%), Query Frame = 3
Query: 3510 LIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSF--DRCNVAKYALHCMSTSITQPEKTTNILSDSIMLLNESGLDQRVRDAAQVNLMR--------LVLNVLKLDYGLNTSYVLSNGIKL--KDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECI-----PPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPLTEKEEGQ-VKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTG--DERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDI-----KSIKQNDINKRLN-------------MYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDM-NFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYEN---LYNEKPLIYRQSIHSLTDLAPFFFT 6974
            +I  L  H+LLY   YDS  VLY+ + L  I ++ P   +               + + +++  S   + N I  +L+RH  AL G +FY     +          +E++  +C  F+ S YP      KVS +D+  N+ VQ+ + E+L  I+ +++ I +                  E K +  + F  +RC V ++ L  +S S+   +K   ++S         G+D    +   +N  +        L + +LKL   L    VL + ++    D D   +   +++  + +  +++ +  Y  +    +++ Q + ++++V  +       +H      + SSL  +GKS    + P V ++CKN+      YE+ +  I  T    S   N  P DY L+ L  L  + HF LLD     +  Q +K SSS+ + L                        +ARN +++ + R I+++ +LW   S  E+     + +       S        ++Q IL  + PL       ++ ++A VW    +F   + + S++ ++              + SE   +   L  A    K+ TI H++   +++++K   +   E+   V + +L+F   F+   S ++L   S  L  LLKES+  +L P   F+LL +L+DF+++    + K++Q+E+Q++ QK+LE V  +AGSSLEQ SW  R  ++K        D      ++N D V+A                        S   ++A                 S Y +  +++        L     NLL M         Y+S+EKEK  P ++ +++  V PYLR  S+ N+ +FR  +QL++SLS Y +T+R+W+K++ DL  +  FFQ D  S   WK IID+ +T +K  FK+  +  + +            +  +Q AM +K+  F + S E+DQY + +P IQE+L+E++R+G  P +  Q++L FRVLL+RIS QHLTSLW I +  L      L +DL  ++     K+ K       +N             +YLSACK LD    +  D +P F  Y+WAFV  +D E     S  + N+Q   +P +  +++  +++           E   E+      E PL+   SI S+T L PFF T
Sbjct: 1194 MIEALFKHILLYLQPYDSKRVLYAFTVLEAILKTNPKEFI--------------ESVAATSMDTSSTAHLNLIYNLLARHQEALVGQSFYGKLQTQSPLMCPHSLLIELLTYLCLSFLRSYYP---CYLKVSHKDVLGNRDVQVKSVEVLIRIMSQLVNIAKSA----------------EGKKVEFIRFLLERCKVQEFVLLSLSASMYTSQKKYELMSAG----GNRGIDLGFFEEGIINFGQDQIWSEHPLQIELLKL---LQVLIVLEHHLRQLQDDQDTHGDLTKEWQRGI-NFQQSINAMQYVQAH---SITSQGLFVSAVVKALRPDYGYGMHPQWVALVTSSLPFFGKSLGLTVAPFVVQICKNLDELVKQYENESFKISTT----SKRENVSP-DYPLTLLEGLTMIGHFCLLD-----HPTQSKKSSSSDPANLK-----------------------NARNALLEELPRIINTMSLLWSIISKQEREKRPSDLLGTIKASSSVYFKSTKTLKQKILDFLNPLTSHLGVQLIAAVAAVWKK-KRF---NKSLSKAKILP-------------VPSESQLIFVDLVCALKTLKTDTILHLV---KEVVKKPPQIKGDEKSSLVDIPMLQFSYTFIQRLSGSELQENSQSLLALLKESVPLNLAPPGFFLLLSMLNDFVTRTPNLESKKDQKELQEVTQKILEAVGNVAGSSLEQTSWLSRNLEVKAQPQISLDDAEAEEEDLNDDSVVA----------------------QSSMVSASA----------------PSMYSVQALSL--------LAEVLANLLDM--------VYRSDEKEKAVPLISRLLY-YVFPYLRNHSAYNIPSFRAGAQLLSSLSGYAYTKRAWKKEVLDLYMDPGFFQMD-TSCVHWKAIIDHFLTHEKTMFKDLMSMPSSS--------LKLYSSSEQKAMLLKRQGFAVLSGEVDQYHQYLPLIQERLTENIRMGQTPNMAAQMYLFFRVLLLRISPQHLTSLWPIMVTELIHTFVQLQEDLMDEVPTKSSKASKHKTATAEVNGTVYCEIQQSALELYLSACKFLDTALSIPPDKMPLFQLYRWAFVPEVDTEACSVPSEKVENYQEC-KPHVLRILE-LLRFRFG--------EKTTEDPKWKRTEFPLLNLHSICSVTQLTPFFRT 2220          

HSP 2 Score: 300.442 bits (768), Expect = 3.087e-80
Identity = 185/526 (35.17%), Postives = 306/526 (58.17%), Query Frame = 3
Query:   24 IEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLF-------------ALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWII-DNPTSSASER--ISSIKPFRIITTLMDRSEIG----GDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKAL--KQEVTPS-QFPSFQMTIDRICELVKFILIRLPIETYSDVHSRH 1532
            +E+Q+   D ++RN+++ ++K L+ FE SSEWADLI++LGKL K LQ N+++ ++PR+ ++ KRL+QCLHPALP+GVH+KALE +++IF IIG + LA DLF+Y +G+FPLLS +AM ++  L  LYE YF+ L  ++ P+    + GLLPGLEEG+E Y R +++L++ +  V    FY  LW  +L + S+R   + F+++H N+ LS   Q Y LG    L + SL   + D  VLVQR  L+ +LF             ++ +HR     SD  ++ A  +  +LRRDMSLNRR ++WL+G+++   ++   + +S            + E    +F +YS+D+L+ A+  I+  N  +S +E+  +  +KPFRI+ +L+D+ EIG    G++  +++   I Y         +L+   N            + +  ++K   N   E +KT NL  ++L S F W+Y+   F  +   K   TP+  +     +I  +C L+ F+L  +P+E YS+V +++
Sbjct:    3 VEEQELLGDYRYRNYSSVIEKALRNFESSSEWADLISSLGKLNKALQTNLKYCLLPRRIIISKRLAQCLHPALPSGVHLKALETYEIIFKIIGTKCLAKDLFLYSSGLFPLLSHAAMSVRPILLGLYETYFIPLQRALLPSLQAFITGLLPGLEEGSEIYERTDQLLQRLSVVVGQNVFYGSLWGSVLVSSSIRLPASLFVVSHINKDLSAQSQSYMLGKDQELAIKSLCASVVDSNVLVQRNTLEILLFFFPFNTCLVPDECSMLLHR-----SDMVRILAGSIQTVLRRDMSLNRRLFAWLLGSDIKGRHMAPELKDSSG----------DEEYCNHFFARYSKDLLVEALMQILHQNTLASDTEQGLLVYLKPFRILVSLLDKPEIGPPVVGELFLEVMRAFIAYCRDALGTQMQLSYSQN-----------GAQLISAIKENKN-ASEIVKTVNLLISSLSSDFLWDYMTICFEDSFRRKDHDTPAGNYLGRAPSITEVCSLLVFLLDVIPLELYSEVQTQY 501          

HSP 3 Score: 67.0106 bits (162), Expect = 2.681e-9
Identity = 67/303 (22.11%), Postives = 125/303 (41.25%), Query Frame = 3
Query: 1989 EVYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2897
            E     C ++++  ++P+Y +  E+ E + +    +   ++   P W   L+   C + +  I+++A+S LL++I        + +Q +S+   +  K   +                 VS G              V++ + +KT F+      LW+ L+    + H   V L  RLH  APSA+ICEE+I Q +L ++    L++  RF ++W L  + + S    ++        R+FD+               N     +      WL +A       +I+  + L LL P T R S+
Sbjct:  735 EALAAACHVLLDCATFPVYMS-EEETEHLYSVLSQVPGSSDVSFPLWFKTLMMVCCCVKDCYIQNVAISTLLEVI--------NHSQSLSLVLADRMKRSKTPGFGEVFGKLQMVTIPPVSPG--------------VLKLIADKTDFYPRVAHVLWNQLNIETREHHITCVELFYRLHCLAPSANICEEIICQTLLHNDKLTRLEALFRFSVIWHLTREIQGSRVTSHN--------RSFDR------SLFVVLDSLNCSDGAIGAAAQGWLVRALSLNDVARILEAVFLLLLHPKTQRNSI 1000          
BLAST of Dopey_N domain-containing protein vs. UniProt/SwissProt
Match: sp|A1ZBE8|DOP1_DROME (Protein dopey-1 homolog OS=Drosophila melanogaster OX=7227 GN=CG15099 PE=1 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 8.610e-84
Identity = 188/514 (36.58%), Postives = 289/514 (56.23%), Query Frame = 3
Query:   21 MIEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALK-----QEVTPSQFPSFQMTID---------RICELVKFILIRLPIETYSDV 1520
            ++E+Q    + K+R +   +DK L+ FEYSSEWADLI+ LGKL K + +N ++ +IPR+  + KRL+QC+HPALP+GVH+KALE + VIFS  GP +LA + FIY  G+FPLL  +AM+++  L  +YE YFV LG  +RPA  G L G+LPG + G + + R + +L+Q   +V P++FYT LW+ +    ++R     +LL HFN+RL   +Q+Y +G++  +M+++L   LND  +LVQR  L+F+L    MH   L+  D  KL    L  +LRRDMSLNRR +SWL+G+ + + N   +   S +     LE   E      YF K+SR ILI A+   +      A      +KP+RI+ +L+D++EIG  +++ +L ++I    +  +I     S  N                           E LK+ANL FA  D ++ W+Y+  +F KA +     QE + +   S +   D          IC L +F+L  + +E Y++ 
Sbjct:    7 LVEEQKLMAEAKYRTYMTNIDKALRNFEYSSEWADLISALGKLSKAISSNTQYQVIPRRLKIAKRLAQCMHPALPSGVHLKALETYSVIFSKTGPERLATE-FIYSAGLFPLLGYAAMNVRPALLAIYETYFVPLGDKLRPALSGFLNGVLPGYDCGLDHFERISALLKQVCNAVNPMHFYTVLWESVANNAAIRLPAITYLLEHFNKRLDMQEQIYIMGHNREIMMSALCVCLNDSLILVQRNTLEFLLLGFPMHTVLLSEDDLVKLVTNGLNTILRRDMSLNRRLFSWLLGSEVAK-NSPTYDTLSLDTSNAPLEEEPEP-----YFVKHSRHILIKALITTLRLSLECAP---MDLKPYRIMLSLLDKAEIGSAVLDYVLHDII----RAMYI-----SSGNA--------------------------EALKSANLLFATFDPAYIWSYMTNMFEKACQQANSMQEKSQAGETSGKYACDVGSGDPCVLEICVLTEFLLETVSLEMYTET 475          

HSP 2 Score: 243.817 bits (621), Expect = 6.067e-63
Identity = 153/444 (34.46%), Postives = 242/444 (54.50%), Query Frame = 3
Query: 5922 TLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRL-GMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQ-------------------NDINKRLNM------YLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRP------FLTLVIDSYIQYYLSLG----IPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFTASLRNDLNQEARATQYGITVVNEKDINADCNNNSCGRFFNFENEVEMILDNEFVEPI 7145
            +LQA ++L   L++++DV Y S+EK+KV   +T +++ N+ PYL+  ++ N+  F   S L+ASLS YQ+TR++WRKD+ DLL ++ FFQ  +  L  W++I+D+LMT D  TF+E  T+++++Q G LN+FTS++ EY+Q AM +K+LAF+IY SE DQ+ K MP+IQE+L+ SLRL  M P ++  +FLCFRVLL+R+S  H+TSLW I I  +  V   +  +LK + +   Q                   N  N +  M       L ACKLL++  ++    +P F  Y+WAFVG     T +    D++ + V  P        TL    Y+ +   +     +   S   + +   N   +++ Q + SL +L  FF               T  GI+    ++  AD  N+      N   E+E +L N+F+E +
Sbjct: 2179 SLQAQSVLAAILSNLLDVAYGSQEKDKVVNIVTPLLY-NITPYLKNHTARNVPFFYACSALLASLSGYQYTRKAWRKDMLDLLLDNAFFQMHLSCLPFWRMIMDSLMTYDNTTFRELMTRVSLSQAGSLNIFTSRDQEYEQRAMLLKRLAFVIYCSEFDQHNKYMPDIQEQLANSLRLVPMGPSVQAAVFLCFRVLLLRMSPDHVTSLWPIIIAEMVQVFLQMEQELKSESEERNQQLRLPSGIDVSWSAASGASNGYNSQTPMQHWRSVQLEACKLLELGCVLPATKLPHFQMYRWAFVG-----TEF----DVHEEEVCLPNGSLENLATLPSALYVPHVRRVARLMDMKYTSQSPILQRPSNRHLMLHFQQLQSLQELYAFF---------------TTLGISCPQPRNF-ADTENDVA----NCLKEIEEVLANDFLEKL 2592          

HSP 3 Score: 136.346 bits (342), Expect = 2.716e-30
Identity = 162/754 (21.49%), Postives = 325/754 (43.10%), Query Frame = 3
Query: 3516 HPLHSHMLLYCSIYDSNGVLYSLSKLRTIF----RSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQN-PTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFK---VSFEDIFENKKVQILASEILDFIVQEMLTILQ---IGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSIT----QPEKTTNILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWG-KSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSY------QLQEEKGSSSEQSFLGALFN--------KSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNS--EQFRVICILELARGLK-KSFTIT--HIINTCRDIIRKSFPLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSIS--DEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSD 5666
            H  H+H+L+Y +IYD+   LY+L  LR I     R+   + +                        + +F    + ++L RH  ++ G  F  +    E  Q ++    LE+++ +C ++    +       +    + +DI  N+++Q+ + E+L  I  E++ I++    G  N+  D +                  R  + K  LHC+++S+     +    +   ++ ++  N+   DQ   D  Q+ L+RL+L V++L++ ++     +     +DS G ++       P         +  Y    P   +S+Q + L +++  +   +LRHLH      + SSL  +   S + +++ +V +LC N+   + +       +P  +          P DY +S L  L  +CH+ LLD   ++       Q   +  SS++ S  G L N         S+ +TS     +P   +  ARN ++  + R + S+  +W+                    +G+   VRQ +L  + P+   H S  L ++A  W        ++G          + + E    NS L +   Q  ++ ++   R +   SF +T  H++ +   I R    L+      ++V+ LE    ++ +  + +L+     L  L+++ ++  PP A F LL +L++F+ +       +K+E RE+ D+  +++++++ +AGS LEQ +W RR   +K D+D
Sbjct: 1511 HLYHNHLLIYLAIYDTRQTLYALQTLRNIICCDKRTFLCLSI------------------------TTSFSSASLKQLLVRHRKSISGKGFDGSVGNSEYAQGYRGCMQLELLVTLCLFYARGYFQKESLDAQRQSPTLQDIVNNRRIQLESIELLTLICSELIEIVKGMGRGLANYIADLLA-----------------RAKLQKVMLHCLNSSVCSYGLKGNTNSGSYAEQVLSFNDPQDDQLHADCFQLQLLRLLLAVIRLEHEVHQLRQDTPPAAGEDSAGNAS-------PTRLAEGATANVKYL---PNCLISQQPMFLAAVLGALQQERLRHLHRNWTDLVTSSLNCFSFGSLTNIVISVVHQLCSNLDRISKMG------LPQQRH--------FPPDYVVSQLEALTILCHYCLLDNTQQTALSHLFNQAYPQTSSSAQSSSTGQLLNSIVHSFLSASESSTSAPAPRNP--QLQAARNAVLSHLPRIMSSVAAIWDSE------------------LGQLRPVRQQLLEFLSPVSLHHGSNFLAAVAVTWQQRGIATNMNG----------LSIAEQFQRNSVLQACPAQLSLVSLVSSIRVMPMDSFVMTLHHVVRSPPPIHRPPAQLS------IEVSALELFYFYMKSAPAPQLADAWSSLLALIRDGLNLTPP-AQFALLMLLNEFVQRCPQMPFQDKKEVRELHDVTSRLVDSLSSVAGSCLEQTTWLRRNLAVKEDTD 2162          
BLAST of Dopey_N domain-containing protein vs. UniProt/SwissProt
Match: sp|Q292H2|DOP1_DROPS (Protein dopey-1 homolog OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=GA13490 PE=3 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 1.296e-82
Identity = 186/519 (35.84%), Postives = 289/519 (55.68%), Query Frame = 3
Query:   21 MIEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQ--------EVTP-----------SQFPSFQMTIDRICELVKFILIRLPIETYSDV 1520
            ++E+Q    + K+RN+   +DK L+ FEYSSEWADLI+ LGKL K + +N ++ +IPR+  + KRL+QC+HPALP+GVH+KALE + VIFS  GP +LA + FIY  G+FPLL  +AM+++  L  +YE YFV LG  +RPA  G L G+LPG + G + + R + +L+Q   +V P++FYT LW+ +    ++R     +LL HFN+RL   +Q+Y +G++  +M+++L   LND  +LVQR  L+F+L    MH + L   D  KL    L  +LRRDMSLNRR +SWL+G+ + + N   +   S +     L+   E      YF K+SR ILI A+   +      A      +KP+RI+ +L+D++EIG  +++ +L ++I    +  +I     S  N                           E LK+ANL FA  D ++ W+Y+  +F +A  Q        ++ P            +  S    +  IC L +F+L  + +E Y++ 
Sbjct:    7 LMEEQKLMAEAKYRNYMTNIDKALRNFEYSSEWADLISALGKLSKAISSNTQYQVIPRRLKIAKRLAQCMHPALPSGVHLKALETYSVIFSKTGPERLATE-FIYSAGLFPLLGYAAMNVRPALLAIYETYFVPLGDKLRPALSGFLNGVLPGYDCGLDHFERISALLKQVCNAVNPMHFYTVLWESVANNAAIRLPAITYLLEHFNKRLDMQEQIYVMGHNREIMMSALCACLNDSLILVQRNTLEFLLLGFPMHTALLAEDDLVKLVTNGLNTILRRDMSLNRRLFSWLLGSEVAK-NSPTYDTLSLDASATPLDEPPEP-----YFVKHSRHILIRALITTLRLSLECAP---MDLKPYRIMLSLLDKAEIGSAVLDYVLHDII----RAMYI-----SSGNP--------------------------EALKSANLLFATFDPAYIWSYMTNMFERACHQANSSDKQDKLLPQASAEGGDKFACEVGSGDPCVLEICVLTEFLLETVSLEMYTET 480          

HSP 2 Score: 243.047 bits (619), Expect = 1.032e-62
Identity = 126/302 (41.72%), Postives = 190/302 (62.91%), Query Frame = 3
Query: 5922 TLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRL-GMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQ-------------------NDINKRLNM------YLSACKLLDIIFLMNEDSVPQFLYYKWAFVGN 6749
            +LQA ++L   L++++DV Y S+EK+KV   +T +++ N+ PYL+  ++ N+  F   S L+ASLS YQ+TR++WRKD+ DLL ++ FFQ  I  L  W++I+D+LMT D  TF+E  T+++++Q G LN+FTS+E E++Q  M +K+LAF+IY SE DQ+ K MP+IQE+L+ SLRL  M P ++  +FLCFRVLL+R+S  H+TSLW I I  +  V   +  +LK + +   Q                   N IN +  M       L ACKLL++  ++    +P F  Y+WAFVG 
Sbjct: 2209 SLQAQSVLATILSNLLDVAYGSQEKDKVVNIVTPLLY-NITPYLKNHTARNVPFFYACSALLASLSGYQYTRKAWRKDMLDLLLDNSFFQMHISCLPFWRMIMDSLMTYDNTTFRELMTRVSLSQAGSLNIFTSREQEFEQRGMLLKRLAFVIYCSEFDQHNKYMPDIQEQLANSLRLVPMGPSVQAAVFLCFRVLLLRMSPDHVTSLWPIIIAEMVQVFLQMEQELKSESEERSQQMRLPSSIDVSWSNNSGASNGINAQTPMQHWRSVQLEACKLLELGCVLPATKLPHFQMYRWAFVGT 2509          

HSP 3 Score: 121.709 bits (304), Expect = 7.805e-26
Identity = 158/744 (21.24%), Postives = 308/744 (41.40%), Query Frame = 3
Query: 3549 SIYDSNGVLYSLSKLRTIF----RSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQN-PTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFK---VSFEDIFENKKVQILASEILDFIVQEMLTILQ---IGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQ--PEKTTNILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWG-KSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDE----AL-----KSYQLQEEKG---------SSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGN-FSQSDLIQDVCLNEASTSNSNLNS--EQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPLTEKEEG-QVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSIS--DEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSD 5666
            +IYD+   LY+L  LR I     R+   + +                        + +F    + ++L RH  ++ G  F  +    E  Q ++    LE+++ +C ++    +       +    + +DI  N+++Q+ + E+L  I  E++ I++    G   +  D +                  R  + K  LHC+++S+        T   ++ ++  N+   DQ   D  Q+ L+RL+L+V++L++ +   + L         D  + N +  +L   +     +        P   +S+Q + L +++  +   +LRHLH      + SSL  +   S + +++ +V +LC N+   A L                 +    P DY LS L  L  +CH+ LLD     AL     ++Y                +S   SFL A  N+S   TS     +P   +  ARN ++  + R + S+  +W+                    +G+   VRQ ++  + P+   H    L ++A  W         +G+  S SD  Q          NS L +   Q  ++ ++   R +     +   + T   ++R   P+        ++V+ LE    ++ +   T+L+     L  L+++ ++  PP A F LL +L++F+ +       +K+E RE+ D+  +++++++ +AGS LEQ +W RR   +K D+D
Sbjct: 1549 AIYDTRQTLYALQTLRNIICCDKRTFLCLSI------------------------TTSFSSASLKQLLVRHRKSISGKGFDGSVGNSEYAQGYRGCMQLELLVTLCLFYARGYFQRESLDAQRQSPTLQDIVNNRRIQLESIELLTLICSELIEIVKGMGRGLACYIADLLA-----------------RAKLQKVMLHCLNSSVCSYGRRAPTGSYAEQVLSFNDPQDDQLHADCFQLQLLRLLLSVIRLEHEV---HQLRQDTPPAAGDDSTGNTSPTRLAEGAAANVKYL-------PNCLISQQPMFLAAVLGALQQERLRHLHRNWTDLVTSSLNCFTFGSLTNIVISVVHQLCNNLDRMARL--------------GLQQQRHFPPDYVLSQLEALTILCHYCLLDNTQQTALSHLFNQAYPQTSSSAQSSSTSQLLNSFVHSFLSA--NESSTGTSAPAPRNP--QLQAARNAVLSHLPRIMSSVAAIWDSE------------------LGQLRPVRQQLMEFLSPVSLHHGCNFLAAVAVTWQQRGSSNASNGSGLSISDQFQ---------RNSTLQACPGQLSLVSLVSSIRVMP----MDSFVMTLHQVVRSPPPIHRPPAHLSIEVSALELFYFYMKSAPGTQLADAWSSLLALIRDGLNLSPP-AQFALLMLLNEFVQRCPQMPFQDKKEVRELHDVTSRLVDSLSGVAGSCLEQTTWLRRNLAVKEDTD 2191          
BLAST of Dopey_N domain-containing protein vs. TrEMBL
Match: A0A131YJI6 (Protein dopey 1 OS=Rhipicephalus appendiculatus OX=34631 PE=4 SV=1)

HSP 1 Score: 764.222 bits (1972), Expect = 0.000e+0
Identity = 674/2457 (27.43%), Postives = 1164/2457 (47.37%), Query Frame = 3
Query:   21 MIEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENEL----QLRYFKKYSRDILIAAIKWIIDNPTSSASERISS----IKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQ------EVTP----------SQFPSFQMTIDRICELVKFILIRLPIETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKIFQNASQTFDVSTLHNPVSIPTSNSTAR-KPSLAMYTSNLTSYNSSKVMVRTIHNFREFTRKFF-VFVLDCSNDQISQCANSLFSQNTKKSRVEK-----------LNKAEMEYNSLKLP---------LSVDLIVVEV----------YHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSA-SICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISLPSLVXXXXXXXXXXXXXXEICEEAENSAIALEEKRIYAISNENGNVKYHL-KPNSIGTQSNNSDSSQKVQP----VSLIQTFEVTRKSKSSNIVKGVNSE---PLRINELNS----ENNWSDANFNGNSKFLSSDSMESNVKVSMEKVITNVLSGKETSGNLENDSYLEDDVLHQVENS---NPVDFAIDP--TELCEEITES--GNQEINLNDSEYTPSNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIG------YINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEKTT----NILSDSIMLLNE-----SGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNG-IKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKS----------------KDNTSKE--DSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEK--INLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNE--INTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQ-------------------NDINKR-----LNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLY--NEKPLIYRQSIHSLTDLAPFF 6968
            ++E+ +   D K+R +   +DK LK F+ +SEWADLI+ LGKL K++ +++++ ++PR+  + KRL+QC+HPALP+GVH+KALE +D+I   +GP++L  +LF+Y  G+FPLL+ SAM+++  L +LYE +F+ LG  +RP   G L G+LPGLEEG+E+Y R +K+L     +VE  YFY  LW+ +L  P +R     F+++H+NRRLS +DQLY +G  I  M+ +L   L D  +LVQR  L+ +L A  +H   L   +R  +C A L VLLRRDMSLNRR ++WL G+  D ++    V  S++    +  S    +       RYF  +S  +L+ AIK +  NP++S S  +SS      P+RI+ +LMD+ E    I++D+L ++   L  E  +     S   K  N                 ++N   E +KTANL F++L+ ++ W Y+++ F  A ++      EV P          +   + Q ++  +C L +F+L  + ++TY  V + +LP LL  +   L ++  +L    +   L +   +  K+ Q  +   + S +    S   S+ T+R + S  + TS     + + ++     +F+    +F  ++VL  ++  ++Q A +L S+  K    EK             +    Y S++LP           +  I ++V          Y  +CQL+VE++S+P         ++I    ++    +   LP WL  L+  +CF  +  +    ++ +LDL+   R          +  +        S+ +SP S  T              + +V       ++E    +T+F  LA   LW  L     + H  +V L+  L+   P     CE+++ + + ++N +E  D+ +RF +LW L   +++   +  SN+     +R FD+C+  +L SL   S         R     WL  +   G   +++ P ++ LL PDTARIS+   V++ +   + Q +       A     A  E RI+AIS+  GNV YH+ K  +    + N+ +   + P    ++L       + + S  + +  N +   P  +  L+      N +      G+   L S S +     +  ++  + L  +++S +   D   ++++ H V  S     +D A  P   E  E  + +  G+ +  L  +  T S     HPLH+H+LLYC ++DS   LY+L+ L+TI  S P + +               + + +++  S +    ++  +L+RH  ++ GNNF+     E +  ++S   LE+++  C +F+ S YP       ++  ++  N+ V++L  E+L  +  E++ +++        Y+N   D +T                 RC V K  LHC+  S+   +K +    N L+  I+  NE      GL +  ++  QV L++L+  ++  +  + TS++  +G    K +  K+  K  F+         + +  Y  + P   +  Q++  T+++  +      HLH++    ++ +L   GKS + +++ +  ++C N+ +A     + N  +      +   ++T P DY    +  L  +CH+ LLD A  +      +        L    N S                KD  ++E   S+ P   IL  R  ++  + R + +L+ +WE  S  EK    L+ + +   W MG P  V+Q ILS + P+   + S  + ++A VW    +         ++  +Q   + + S  +  L  E    I +L +   ++    +           +K  PL        +V++L+F   ++     T+L      L GL K+ +  +  P   F LL +L +F+ +  + ++K++Q+++QD+ QKV+E  + +A +SLEQ +W RR   +         RPG     + TD                       G +  +  G    +   +  +    A N ++Y   ++             QAL++L   LA ++DV Y SEEKEKV P L+ ++F  V PYLR     N  +FR  SQL++SLS YQHTR++WR+D  +LL E  FFQ D++ L  W+  +D+LMT DK TF++   +  V Q G LN+F+SKE EY+  A  +K+LAF+I+ SE DQY + MP+IQE+LSESL+L  +P I  Q+FLCFRVLL+R+S QH+TSLW   I  L      +  +L  D +  ++                   N +N       L +YLSACKLLD+   +  D +PQF  Y+WAF+ +    ++    +     P  +         ++ + + L   +N     YEN +  N +PL+   SI S  DL  FF
Sbjct:    5 VLEEYELLGDPKYRAYVTAIDKALKSFDNTSEWADLISALGKLNKVVSSHLKYQVVPRRLTISKRLAQCMHPALPSGVHLKALESYDLILRAVGPQRLGQELFLYGAGLFPLLAHSAMNVRPALLSLYETHFLPLGERLRPGLNGFLIGVLPGLEEGSEYYDRTDKLLLDVCVAVEKSYFYGSLWKCILCNPGIRQAAINFIVSHYNRRLSVEDQLYVIGTDIECMVQALCASLQDSSILVQRSTLELLLLAFPLHNCSLVYGERVLVCTAALGVLLRRDMSLNRRLFAWLFGS--DGSSTASVVPASESTGSSEPPSSPVPDSPEPTHARYFHLHSSFLLLDAIKCLF-NPSTSRSPVLSSNFSVFWPYRILVSLMDKPETNF-ILDDVLIDVFRSLYIECNLGTVTKSHQEKQAN-----------------RSNF--ELIKTANLLFSSLEPNYLWEYVHKCFQGACERASSSATEVPPKSKCSEGNKVAHVGAGQPSLIEVCVLSEFLLEVISLDTY--VETDNLPTLLQKVAKDLEQYCSSLSPEELNGALLLCSRLLSKV-QPTTMQPNSSGMEPACSPADSHITSRQQTSEKLSTSCEEELSLANLISSCTSSFQHLFLRFVELWVLTDASAVLNQFATALISKRAKMDDREKELHGLLQLCLLQEEGGDPYQSIELPQVPPRPPENAEIPQIKLQVQPCFSKLKDTYATLCQLLVELSSFPASLGT---LKAIFFDADSPRCADEEFLPNWLRQLLMMSCFAEDRDLLLQTLATVLDLLGLAR---------TAAVALEPSLRDGSRTLSPGSQAT---------LAMVVVPMVRPRDLRAILE----RTRFVGLAAGRLWGLLEPGASELHLRSVELLQLLNNLTPEQDGSCEDVLCRALASENDQEQTDAQKRFAILWHL--SRDLKFKSTPSNL-----VRPFDRCLFQMLHSLSRPSGMQ------RAAAQVWLNHSLMRGDLARLLEPSMMVLLHPDTARISV-QHVSVRAGAATTQAAVTADATPATTHDDANAEGRIFAISSVGGNVIYHVDKTKATALTAGNTSAVAPLNPERKVLALTSIVGPEKGNGSKVVTRSSNVDVEFPPALESLHQISLFINPFGSLTSLGSDYGLDSYSYDPPDLSNATRIDGSAL--RKSSFDESEDPSSKEEISHTVVRSILDEILDLATSPEGKEPLERTSHNLHGDDQTQLEATSNTSSGQLTSHPLHTHLLLYCQVFDSQKTLYALTVLKTIIESNPRVAL--------------CSMATTSVSSSLSQRGAQLQTLLARHRKSVFGNNFHGELAPEALSGYRSSMFLEVLVSACLYFVRSYYPSLPQT-HLTPAELSGNRDVRLLCCELLRLVFSELVAVVRDSGRSFAIYLN---DLLT-----------------RCKVQKALLHCLVASVYGFQKPSSENDNALTVGIIEFNEKIPAGEGLAEDFQETFQVYLLQLIAALIVFEERV-TSHIGEDGHPGHKPATEKAAPKMRFQ-------PQMSTLRYQHNVP---IPCQAMFGTALLTALRQQHKAHLHAHWMSLVMCALPFAGKSLTQLVLSVASQVCSNLEVAVAAPSASNSTL------EQEGMSTYPPDYLTLLVEGLTLLCHYCLLDSAAPAAVTPVTQQPPPTPQALAPSANVSQIIYNLIHVFSNTDPHKDMHARESGGSLDP---ILSTRRTLLSNLPRLLAALVSVWEAVSREEKDPFQLSPK-LAQLWVMGAPKVVKQHILSFLSPISMTYGSNFMAAVAVVWYERRK---------KTTSVQRKVIPQWS-PDQLLLVELVSAIKVLPMDSVVQVVRQVIRQPPPTNHDRKKRVPL--------EVSMLQFFLAYVQHTPGTQLQESWSSLLGLWKDGLQLTAMPLVQFHLLGLLHEFVQRAPLLEDKKDQKDLQDITQKVIEACSTVASASLEQTTWLRRNLAV---------RPGPQPDIMGTDA-------------------DAEGDMATTSEGILVNDADTTEQAAGQPAYNPTSYAQYSV-------------QALSVLAEFLAPVLDVVYVSEEKEKVVPLLSGIMF-YVTPYLRNHRVHNAPSFRACSQLVSSLSGYQHTRKAWRRDALELLLEPAFFQMDLVCLAHWRATVDHLMTNDKTTFRDFMARFAVAQSGSLNIFSSKEQEYEVRAQLLKRLAFVIFCSESDQYQRYMPDIQERLSESLKLSHVPSIHAQVFLCFRVLLLRMSSQHITSLWPGIITELVQAFLQIEQELSTDTEEFRRNPSSHLRRLQGLDSSWAVSNGLNAHNHPAWLQLYLSACKLLDLALALPADMLPQFQMYRWAFISDNAPLSHDGTQSQQESPPKGQ-------HEFVPHIVRLAALMNKNNPNYENPHYKNGRPLLSLTSIKSFYDLQGFF 2271          
BLAST of Dopey_N domain-containing protein vs. TrEMBL
Match: A0A131Z6B8 (Protein dopey 1 (Fragment) OS=Rhipicephalus appendiculatus OX=34631 PE=4 SV=1)

HSP 1 Score: 739.954 bits (1909), Expect = 0.000e+0
Identity = 641/2313 (27.71%), Postives = 1106/2313 (47.82%), Query Frame = 3
Query:   21 MIEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENEL----QLRYFKKYSRDILIAAIKWIIDNPTSSASERISS----IKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQ------EVTP----------SQFPSFQMTIDRICELVKFILIRLPIETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKIFQNASQTFDVSTLHNPVSIPTSNSTAR-KPSLAMYTSNLTSYNSSKVMVRTIHNFREFTRKFF-VFVLDCSNDQISQCANSLFSQNTKKSRVEK-----------LNKAEMEYNSLKLP---------LSVDLIVVEV----------YHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSA-SICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISLPSLVXXXXXXXXXXXXXXEICEEAENSAIALEEKRIYAISNENGNVKYHL-KPNSIGTQSNNSDSSQKVQP---VSLIQTFEVTRKSKSSNIV---KGVNSE-PLRINELNS----ENNWSDANFNGNSKFLSSDSMESNVKVSMEKVITNVLSGKETSGNLENDSYLEDDVLHQVENS---NPVDFAIDP--TELCEEITES--GNQEINLNDSEYTPSNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIG------YINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEKTT----NILSDSIMLLNE-----SGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNG-IKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKS----------------KDNTSKE--DSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEK--INLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNE--INTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIK 6614
            ++E+ +   D K+R +   +DK LK F+ +SEWADLI+ LGKL K++ +++++ ++PR+  + KRL+QC+HPALP+GVH+KALE +D+I   +GP++L  +LF+Y  G+FPLL+ SAM+++  L +LYE +F+ LG  +RP   G L G+LPGLEEG+E+Y R +K+L     +VE  YFY  LW+ +L  P +R     F+++H+NRRLS +DQLY +G  I  M+ +L   L D  +LVQR  L+ +L A  +H   L   +R  +C A L VLLRRDMSLNRR ++WL G+  D ++    V  S++    +  S    +       RYF  +S  +L+ AIK +  NP++S S  +SS      P+RI+ +LMD+ E    I++D+L ++   L  E  +     S   K  N                 ++N   E +KTANL F++L+ ++ W Y+++ F  A ++      EV P          +   + Q ++  +C L +F+L  + ++TY  V + +LP LL  +   L ++  +L    +   L +   +  K+ Q  +   + S +    S   S+ T+R + S  + TS     + + ++     +F+    +F  ++VL  ++  ++Q A +L S+  K    EK             +    Y S++LP           +  I ++V          Y  +CQL+VE++S+P         ++I    ++    +   LP WL  L+  +CF  +  +    ++ +LDL+   R          +  +        S+ +SP S  T              + +V       ++E    +T+F  LA   LW  L     + H  +V L+  L+   P     CE+++ + + ++N +E  D+ +RF +LW L   +++   +  SN+     +R FD+C+  +L SL   S         R     WL  +   G   +++ P ++ LL PDTARIS+   V++ +   + Q +       A     A  E RI+AIS+  GNV YH+ K  +    + N+ +   + P   V  + +     K   S +V     V+ E P  +  L+      N +      G+   L S S +     +  ++  + L  +++S +   D   ++++ H V  S     +D A  P   E  E  + +  G+ +  L  +  T S     HPLH+H+LLYC ++DS   LY+L+ L+TI  S P + +               + + +++  S +    ++  +L+RH  ++ GNNF+     E +  ++S   LE+++  C +F+ S YP       ++  ++  N+ V++L  E+L  +  E++ +++        Y+N   D +T                 RC V K  LHC+  S+   +K +    N L+  I+  NE      GL +  ++  QV L++L+  ++  +  + TS++  +G    K +  K+  K  F+         + +  Y  + P   +  Q++  T+++  +      HLH++    ++ +L   GKS + +++ +  ++C N+ +A     + N  +      +   ++T P DY    +  L  +CH+ LLD A  +      +        L    N S                KD  ++E   S+ P   IL  R  ++  + R + +L+ +WE  S  EK    L+ + +   W MG P  V+Q ILS + P+   + S  + ++A VW    +         ++  +Q   + + S  +  L  E    I +L +   ++    +           +K  PL        +V++L+F   ++     T+L      L GL K+ +  +  P   F LL +L +F+ +  + ++K++Q+++QD+ QKV+E  + +A +SLEQ +W RR   +         RPG     + TD                       G +  +  G    +   +  +    A N ++Y   ++             QAL++L   LA ++DV Y SEEKEKV P L+ ++F  V PYLR     N  +FR  SQL++SLS YQHTR++WR+D  +LL E  FFQ D++ L  W+  +D+LMT DK TF++   +  V Q G LN+F+SKE EY+  A  +K+LAF+I+ SE DQY + MP+IQE+LSESL+L  +P I  Q+FLCFRVLL+R+S QH+TSLW   I  L      +  +L  D +
Sbjct:    5 VLEEYELLGDPKYRAYVTAIDKALKSFDNTSEWADLISALGKLNKVVSSHLKYQVVPRRLTISKRLAQCMHPALPSGVHLKALESYDLILRAVGPQRLGQELFLYGAGLFPLLAHSAMNVRPALLSLYETHFLPLGERLRPGLNGFLIGVLPGLEEGSEYYDRTDKLLLDVCVAVEKSYFYGSLWKCILCNPGIRQAAINFIVSHYNRRLSVEDQLYVIGTDIECMVQALCASLQDSSILVQRSTLELLLLAFPLHNCSLVYGERVLVCTAALGVLLRRDMSLNRRLFAWLFGS--DGSSTASVVPASESTGSSEPPSSPVPDSPEPTHARYFHLHSSFLLLDAIKCLF-NPSTSRSPVLSSNFSVFWPYRILVSLMDKPETNF-ILDDVLIDVFRSLYIECNLGTVTKSHQEKQAN-----------------RSNF--ELIKTANLLFSSLEPNYLWEYVHKCFQGACERASSSATEVPPKSKCSEGNKVAHVGAGQPSLIEVCVLSEFLLEVISLDTY--VETDNLPTLLQKVAKDLEQYCSSLSPEELNGALLLCSRLLSKV-QPTTMQPNSSGMEPACSPADSHITSRQQTSEKLSTSCEEELSLANLISSCTSSFQHLFLRFVELWVLTDASAVLNQFATALISKRAKMDDREKELHGLLQLCLLQEEGGDPYQSIELPQVPPRPPENAEIPQIKLQVQPCFSKLKDTYATLCQLLVELSSFPASLGT---LKAIFFDADSPRCADEEFLPNWLRQLLMMSCFAEDRDLLLQTLATVLDLLGLAR---------TAAVALEPSLRDGSRTLSPGSQAT---------LAMVVVPMVRPRDLRAILE----RTRFVGLAAGRLWGLLEPGASELHLRSVELLQLLNNLTPEQDGSCEDVLCRALASENDQEQTDAQKRFAILWHL--SRDLKFKSTPSNL-----VRPFDRCLFQMLHSLSRPSGMQ------RAAAQVWLNHSLMRGDLARLLEPSMMVLLHPDTARISVQH-VSVRAGAATTQAAVTADATPATTHDDANAEGRIFAISSVGGNVIYHVDKTKATALTAGNTSAVAPLNPERKVLALTSIVGPEKGNGSKVVTRSSNVDVEFPPALESLHQISLFINPFGSLTSLGSDYGLDSYSYDPPDLSNATRIDGSAL--RKSSFDESEDPSSKEEISHTVVRSILDEILDLATSPEGKEPLERTSHNLHGDDQTQLEATSNTSSGQLTSHPLHTHLLLYCQVFDSQKTLYALTVLKTIIESNPRVAL--------------CSMATTSVSSSLSQRGAQLQTLLARHRKSVFGNNFHGELAPEALSGYRSSMFLEVLVSACLYFVRSYYPSLPQT-HLTPAELSGNRDVRLLCCELLRLVFSELVAVVRDSGRSFAIYLN---DLLT-----------------RCKVQKALLHCLVASVYGFQKPSSENDNALTVGIIEFNEKIPAGEGLAEDFQETFQVYLLQLIAALIVFEERV-TSHIGEDGHPGHKPATEKAAPKMRFQ-------PQMSTLRYQHNVP---IPCQAMFGTALLTALRQQHKAHLHAHWMSLVMCALPFAGKSLTQLVLSVASQVCSNLEVAVAAPSASNSTL------EQEGMSTYPPDYLTLLVEGLTLLCHYCLLDSAAPAAVTPVTQQPPPTPQALAPSANVSQIIYNLIHVFSNTDPHKDMHARESGGSLDP---ILSTRRTLLSNLPRLLAALVSVWEAVSREEKDPFQLSPK-LAQLWVMGAPKVVKQHILSFLSPISMTYGSNFMAAVAVVWYERRK---------KTTSVQRKVIPQWS-PDQLLLVELVSAIKVLPMDSVVQVVRQVIRQPPPTNHDRKKRVPL--------EVSMLQFFLAYVQHTPGTQLQESWSSLLGLWKDGLQLTAMPLVQFHLLGLLHEFVQRAPLLEDKKDQKDLQDITQKVIEACSTVASASLEQTTWLRRNLAV---------RPGPQPDIMGTDA-------------------DAEGDMATTSEGILVNDADTTEQAAGQPAYNPTSYAQYSV-------------QALSVLAEFLAPVLDVVYVSEEKEKVVPLLSGIMF-YVTPYLRNHRVHNAPSFRACSQLVSSLSGYQHTRKAWRRDALELLLEPAFFQMDLVCLAHWRATVDHLMTNDKTTFRDFMARFAVAQSGSLNIFSSKEQEYEVRAQLLKRLAFVIFCSESDQYQRYMPDIQERLSESLKLSHVPSIHAQVFLCFRVLLLRMSSQHITSLWPGIITELVQAFLQIEQELSTDTE 2134          
BLAST of Dopey_N domain-containing protein vs. TrEMBL
Match: A0A4D5RTM7 (Putative dopey (Fragment) OS=Ixodes scapularis OX=6945 PE=4 SV=1)

HSP 1 Score: 680.633 bits (1755), Expect = 0.000e+0
Identity = 651/2445 (26.63%), Postives = 1099/2445 (44.95%), Query Frame = 3
Query:  120 ADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQK--------DLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSA---SERISSIKPFRIITTLMDRSEIGGDIIEDILFNLI--VYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKA-LKQEVTP----------SQFPSFQMTIDRICELVKFILIRLPIETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKIFQNASQTFDVSTLHNPVSIPTSNSTARKPSL----AMYTSNLTSYNSSKVMVRTIHNF-REFTRKFFVFVLDCSNDQISQCANSLFSQNTKKSRVEK---------LNKAEME-YNSLKLP------------LSVDLI-----VVEVYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSA-SICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISLPSLVXXXXXXXXXXXXXXEICEEAENSAIALEEKRIYAISNENGNVKYHLKPNSIGTQSNNSDSS----QKVQPVSLIQTFE---------VTRKSK-----SSNIVKGVNSEPLRINELNS----ENNWSDANFNGNSKFLSSDSM---ESNVKVSMEKVITNVLSGKETSGNLENDSYLEDDVLHQVENSNPVDFAIDPTELCEEITESGNQEINLNDSEYTPSNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQ---IGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEKTTN-----ILSDSIMLLNE-----SGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKS----------YQLQEEKGSSSEQSFLGALFN--------KSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPS---------WTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLK-------LDSDTGDERPGSNE-----INTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIK---------------QNDINKR-----LNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGN-----LDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEK--PLIYRQSIHSLTDLAPFF 6968
            ADL + +GKL K+L +N R+ +IPR+  V KRL+QC+HPALP+GVH+KALE +D++    GP++L  +LF+Y  G+FPLL+ +AM+++  L  LYE +F+ LG  +RP   G L G+LPGLEEG++ Y R + +L     SVE  YFY  LW+ +L  P+VR     F+++H+NRR S +DQL+ +G  I+ M+  L   L D  VLVQR AL+ +L    +H  QL  +DR ++C A + VLLRRDMSLNRR ++WL G+  D +     V  S              D  + S +     YF   S  +L+ A+K +    T  A   S   S   P+RI+ +LMD+ EI   I++DIL ++   +YLE     L K   E                     K       E +KTANL F++L+  + W Y+ + F  A +++   P          +   S   T+  +C L +F+L  + +++Y  + + HLPDLL S+ + L EH   L    +K  L +   +  K+ Q + Q           ++P + S + +P      A+         S+ +M   + +F R F R   ++VL    + ++   ++L  + T +   EK         L + E + Y S+ LP            +S++L      + E Y  +CQL+VE++S+P     + K   +     T        LP WL  L+  +CF  +  +     + +L+L+  +R                     A+  + P+  + +       SQ +  + VV  +    +   L+ +T+F  +    LW+ L  +    H   V L+  LH  AP     CE+++ + + +++ +E  ++ +RF +LW L    +       S  SSL  +R+FD+C+  +L  L             R     WL  +   G   +++ P ++ LL PDTARIS+  +   S    + +       +EA +S     E RI+AIS+  GNV YH+    +   +    +S    ++V  ++ I   E         VTR SK         +  ++   L +N   S     N++   ++  ++  LS+ +     S  K S ++   N  S +E S +    S L++ V   +  S P     D     + +    ++  ++      P+     HPLHSH+LLYC ++DS   LY+L  L+ +  S P   +               + + +++  S +    ++  +L+RH  ++ GNNF+     E +  ++S   LE+++  C +F+ S YP        + E +  N+ V++L  E+L  +  EM+ +++     +  + GD +                  RC V K  LHC+  S+   ++ T       ++  I+  NE      GL +  ++  QV L++L+  ++  +  +            K S  K   K  F+         + +  Y    P   +  Q++  T+ +  +       LH++    ++ +L   GK  + +++ +  ++C N+    +     ++  P  +     E    P DY +S +  L  +CH+ LLD                       S++    +  L +        K  +N     S+ P   IL  R  ++  + R + +L+ +WE  S         +  PP+         W MG P  V+Q ILS + P+   + S  + ++A VW    +         Q  +I         + +  L  E    I +L +   ++    +           +K  PL        +V++L+F   ++     T+L      L GL K+ +  +  P   F LL +L++F+ +  + ++K++Q+++QD+ QKV+E  + +A + LEQ +W RR   ++       L SD   E P S+       N DG  +P                     + S F ++                  + Y +  +++                L   LA ++DV Y SEEKEKV P L+S++   V PYLR R   N+ +FR  SQL++SLSSYQ+TR++W++D  +LL ++ FFQ D   +  W+ I+D+LMT DK TF++   +  V Q G LN+F+SKE EY+  A  +K+LAFI++ SE DQY + MP+IQE+L+ESL+L  +P ++ Q+FLCFRVLL+R+S   +TSLW   I  L      +  +L  D ++                  N +N       L +YLSACKLLD+   +  D +PQF  Y+WAF+G+       + T   + N  +    F P           + + L   +N     YE L      P +   SI SL D+  FF
Sbjct:    1 ADLNSPIGKLNKVLLSNARYQVIPRRLTVSKRLAQCMHPALPSGVHLKALETYDLMLRSAGPQRLGQELFLYSAGLFPLLAHAAMNVRPALLALYETHFLPLGERLRPGLNGFLIGVLPGLEEGSDHYDRTDALLLDVCLSVEKSYFYGSLWKCVLCNPAVRLAAINFIISHYNRRQSMEDQLFIIGTDINCMVQGLCAALQDTSVLVQRSALELLLLGFPLHSCQLVAADRVRVCTAAVVVLLRRDMSLNRRLFAWLFGS--DGSTTTSGVAASPPATTSTAAIPDSIDASTASAST----YFYTNSCALLLEALKCLFSPSTCRAPVLSSNFSVFWPYRILVSLMDKPEITTAILDDILIDVFRSLYLECSSGTLAKSQQE---------------------KQADRTHFELVKTANLLFSSLEPDYLWGYVAKSFHGACVRRSADPLPRTLQSGKVAPVGSGAPTLQEVCILSEFLLEVISMDSY--METEHLPDLLHSVAEDLREHCSCLHPPELKSALVLCSRLLSKV-QPSLQPGGSE------AVPGTTSRSSQPDTCLEQAVPPGGADDLCSATMMANCVASFQRLFLRFVELWVLVQPQETLALFGSALLRKRTMQGDREKELHRLLEQCLRRGEEDPYRSIDLPRRKTPEREVAPEVSLELRPEFSDLKEAYACLCQLLVELSSFPASL-ATLKTILLVEVPGTEGPEGTGGLPDWLRQLLMLSCFAPDQDLLISTTATVLELLELSR--------------------TAAAALEPSFRDVSRCLTPGGSQATLAIVVVPMVRPSDLSAVLE-QTRFVRVVAGRLWELLEPHREALHLRAVELLQLLHNVAPEGDGACEDVLCRALSSEDEQEQTEAQKRFSILWNLSRNLKF-----KSTPSSL--VRSFDRCLFQMLHCLSRPWGPQ------RAASQVWLNHSLLRGDLARLLEPPMMVLLHPDTARISVQHVSVHSGMAATVEPVPVLARDEASSS-----EARIFAISSVGGNVIYHVDKAKVAAGAVAPLASVNPEKRVLALTSIVGPEKGNGSKLQVVTRSSKVDVEFPPASLDSLHQMSLFVNPFGSLTSLTNDYLLDSYGYDAPDLSNATRIHGTSLRKSSFDEPDENAASDREDSAHEIVRSILDEIV--DLATSIPKGLHDDDAAASDSVFHEESKRSSVGAFAGQPT----AHPLHSHLLLYCQVFDSQKTLYALGVLKLVVESNPRAAL--------------CSMATTSVSSSLSQRGAQLQTLLARHRKSIFGNNFHGEMAPEALSGYRSSMFLEVLVSACLYFVRSYYPSLPQAHLTAAE-LSGNRDVRLLCCELLRLVFSEMVAVVRDSGRSFAVYLGDLLM-----------------RCKVQKALLHCLVASVYGFQQKTGSDGERAITTDIIEFNEKVPVGEGLAEDFQETFQVYLLQLIAALIIFEDRVAAQMGDDTHPAHKPSTDKVAQKTRFQ-------PQMSTLRYQHGVP---IPCQAMFGTATLTALRQQHKAQLHAHWLSLVMCALPFAGKCLTQLVLSVASQVCSNLEAVVS-----DRAGPGVQ----GEGVARPPDYLISLVEGLTLLCHYCLLDGVAAPAVNPVTQQPPPAPPALTPSANVSQIIYNLIHVFSNTDPQKDLNNRESGGSLDP---ILSTRRSLLSNLPRILAALVTVWEAVS-------RDDGGPPAGSGAKQSRLWIMGAPKVVKQHILSFLSPISLSYGSNFMAAVAVVWYERRK----KNAVPQRKVIPQW------SPDQLLLVELVSAIKVLPMDSVVQVVRQVLRQPPPTSHDKKKRVPL--------EVSVLQFFLAYVQHTPGTQLLESWSALLGLWKDGLQLTALPLVQFHLLGLLNEFVQRAPLLEDKKDQKDLQDITQKVIEACSTVASACLEQTTWLRRNLAVRPGPQPDILGSDADPEDPTSSTDTRMLTNGDGSESPP--------------------STSNFATS----------------THAQYSVQALSV----------------LAEFLAPVLDVVYVSEEKEKVVPLLSSIMC-YVTPYLRNRRLHNVPSFRACSQLVSSLSSYQYTRKAWKRDALELLLDAAFFQMDQPCMAHWRSIVDHLMTHDKTTFRDFLARFAVTQSGSLNIFSSKEQEYESRAQLLKRLAFILFCSEPDQYQRYMPDIQERLAESLKLSHVPAVQAQVFLCFRVLLLRMSPHQVTSLWPGIITELVQAFLQIEQELSTDSEAFGSHLRRLQGLDSSWAVSNGLNAHNHPAWLQLYLSACKLLDLAVALPADMLPQFQMYRWAFIGDNAPLLSSDGTQPLQDNSKSEHHEFVP-----------HIMRLAALMNKNNPNYEPLMQRAGHPFLTLTSIKSLYDMQGFF 2220          
BLAST of Dopey_N domain-containing protein vs. TrEMBL
Match: A0A164NWD9 (Dopey_N domain-containing protein OS=Daphnia magna OX=35525 GN=APZ42_030252 PE=4 SV=1)

HSP 1 Score: 657.522 bits (1695), Expect = 0.000e+0
Identity = 674/2460 (27.40%), Postives = 1136/2460 (46.18%), Query Frame = 3
Query:   24 IEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQ-EEFLKTANLFFANLDSSFFWNYLNRLFVKAL--------KQEVTPSQFPSFQMTIDRICELVKFILIRLPIETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKIFQNASQTFDV-----STLHNPVSIPTSNSTARKP--SLAMYTSNLTSYNSSKVMVRTIHNFREFTRKFF---VFVLDCSNDQISQCANSLFSQNT------KKSRVEKLNKAEMEYNSLKLPLSVDLIVVE--------------------VYHEICQLVVEMTSYPLYFNVS-EKYESITNSQETMYKVNNHDLPQW--LVCLI---TSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPS--ASICEELIL----QKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISLPSLVXXXXXXXXXXXXXXEICEEAENSAIALEEKRIYAISNENGNVKYHLKPNSIGTQSNNSDSSQKVQPVSLIQTFEVTRKSKSSNIVKGVNSEPLRINELNSE---NNWSDANFNGNSKFLSSDSMESNVKVSMEKVITNVLSGKETSGNLEND---SYLEDDVLHQVENSNPVDFAIDPTELCEEITESGNQEINLNDSEYTPSNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTI---LQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSI-------TQPEKTTN-------ILSDSIMLLNESGLDQR----VRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDE----------------ALKSYQLQEEKGSSSEQSFLGALF---------NKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKS--SLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPLT-EKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKT--LTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGM-IPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIK----------------------SIKQNDINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVG--NLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNS-IEVVYENL-----YNEKPLIYRQSIHSLTDLAPFF 6968
            +E+ +  ++ K+RN+ N VDK LK FEY+SEWADLI  LGKL K+LQ + +F IIPR+ +V KRL+QCLHPALP+GVH+KALE +D+IF ++G  +L+++LFIY  G++PLL+ +A++++  L +LYE + + +   ++P   G L G+LPGLEEGA+ Y R + + ++    V   +FY CLW+ + + P +R     ++L+HF+R+LS +DQL  LG +I LM++S+   L D  VLVQR AL+F+L A  +H S L   D   L AA +  LLRRDMSLNRR +SWL+G+          ++ +D+    D  +L ++     YF +YS+ +L+ +++ ++ N   SA+ +   +KP+R++ +L+D+ EIG  I++DIL ++   L   YF                      S   +S K K   Q +E +KTANLFF  L+ ++ W+Y  RL  K+          Q+V       F+M     C+L  F+L  L +++ SD    HLP LL    DLL      +   ++   +++   + +KI      T ++     S      +I +S+     P  S A+ +S   S +  +++   +   ++   K     +FV D     + Q +N L  Q        ++   E +N +   Y +L  P SV   + E                    V  + C L+ E++++P Y   +   ++ I+N+Q+ +       LP W  L+CL+    S        I  I  + LLDL   T  +      P +        ++   DI  + +                  V+L +++ T +  L NK+  F      LW+ + S + +C Q    LI++LH  AP   + + E++IL    Q+M  +  E C  +  +F +LW L    E S +           ++TFD+C+ +LLD L     S       RT    W  +A       +I++PLLL LLKP +AR+S+  +    ++            +E E   +  E+  IYAIS+ NG+V YH+ P+   T+S     S+ V  + L              +V        +I E       N +S+  F+  + F +S               T+  SG+E+    E+      L D+++  V N      A    +L E  T +  +   L D          IHPLH+H+LLYC + D+   L+ L  LR+  +                      + S++ +  S++ +   + E+L+RH   L GN FY   + + +   +S   LEI++ +  + + + Y        ++ ++I  N++VQ+   ++L+  + E+L +   L  G+ +   D +T                 RC V K ALH +   +        +P K  N        L++ I+L NE   D++      +A  ++L++L+L+++ ++                D   K N+     LP  +V  +  ++   T    + V  Q +  T+I+  +     R LH+   + ++SSL + G+S   +L  +V ++C N+   A                 S +    P DY ++ L  L A+CHF+L+D                    S+ +     S +  +  G +          N        E + + G   L AR +M+  + R +  +  LW+ S   L+ K+                   RQ +L  + P+   H   +L +++  W    +  +  GN     +I +              SEQ  ++ ++   R L        ++   R ++++   +       +++V LL F   +L   +  +L    G L  LL+E ++++ P   F  L +  + + +     EKR+QRE+Q++  K+LE    +A +SLEQ +W RR   L +  DT    P + E +   ++  M+++ +   +                                   + SA   A + +    ++KT   ++QAL +L   LA + D+ + S++KE+V P LTS++  NV+PYLR+ S  N+   R +S L++SLS Y  TRR+WRKD FDLL +  FF  DI +L+ WK IIDNLM  DK+ F+E   +++V+  G   LF+S+E E +   + +K+LAF ++ ++ DQY + +P+IQEKLSESLRL    P ++ Q+FLCFRVLL++ S QH+TSLW   +     VL  L  +L+ D +                       ++ N     L++YL+ CKLL +  ++  + +PQF  Y+WAF+G  N  +      S  M+  P F P+LT +      Y L     L S +EV   +L      ++  L    +I SL DL PFF
Sbjct:    6 LEELELIDEPKYRNYINSVDKALKNFEYTSEWADLIAALGKLNKVLQNHSKFNIIPRRVIVAKRLAQCLHPALPSGVHLKALETYDLIFKLVGAARLSNELFIYSAGLYPLLAHAAINVRPVLLSLYEIHLIPIAEYLKPGLSGFLNGVLPGLEEGADHYDRTSTLFDKICNGVSANFFYGCLWKCIAENPQIRLPAYTYILSHFDRKLSIEDQLEILGQNIDLMIHSMCASLEDSSVLVQRSALEFLLAAFPLHGSHLLKPDVVHLLAAAITALLRRDMSLNRRLFSWLLGSEPQ-------LLSADDSLVND--TLRDSPNVKSYFHRYSKSLLVESLQLVLKN---SAAAKPPDMKPYRVLISLLDKPEIGPIILDDILIDVFRSL---YF----------------------SNNDQSKKQKKAAQHDELVKTANLFFGTLEEAYIWSYTGRLLQKSSCIETASREVQQVGQGSPHFFEM-----CKLSAFLLELLSVDSSSDTQVEHLPSLLVQTADLLHASFGAMSAASVLAGIELCLTLLKKILPAHEGTEELAGSWSSPSEGEEAIESSSGEFHSPPSSPALISS---SQHQKQLLEHAVVAIQQLLAKLLNPGIFVSD-RTTLLKQASNILSVQTVSCTPPLEEMLEECVNPSTSSYLTLAKPSSVSQEMYELDLSKELKLADADQLAQLLPVLKKCCTLLKELSAFPTYCAAAMASHQVISNNQDWI------TLPDWLQLLCLVSCCLSNSSSQSNQIYLIGTATLLDLTAITSSII-----PTAYWKPEQTTNLQKGDIPSDMFTV----------------VLLPVITPTQLLTLLNKSCVFQRMARQLWEGVGSTF-EC-QRCAELIHQLHTLAPPTLSHVAEDVILSSLSQQMRRN--EGCSSAVEKFTVLWHLGRDLEPSRWGSR-------RLKTFDRCLQLLLDWLSLDPPSPQ-----RTAAEGWFVQALLRNDLSRILDPLLLKLLKPHSARVSIRHVTFQPTN------------QENEKQPVDREDN-IYAISSVNGHVIYHVTPSR--TKSRPFSPSRSVLTLGLGADGRAPESFVDRQVVFPWQLPQHQIMEQTVGLFVNPFSEDLFHVPNAFTTS--------------ATSTDSGQESPKEPESSVVAKSLLDELIETVVNKAVAAAAAARFKLKESATVAAEK---LAD----------IHPLHNHILLYCQVSDAEQTLHVLRTLRSQLQL--------------QPRLLLLSLSSTGIASSRSPHSVLLQELLARHRKCLFGNGFYGEVSGDMMAPNRSSMYLEILLQLLLYHLRTYYSSLGMS-SLTRQEIISNRQVQLACVQLLNMFLSELLPLVRDLGKGFSSFISDMLT-----------------RCRVQKVALHSILAMLHVVTLDHNKPVKKRNGNPGLLPTLTEEIILFNEE--DEKSGSSYSEATLISLVKLLLSIMAIE----------------DQLSKQNSPAG-DLPSVNVAASSPASVPGTYQRGVPVHSQPLFTTAILTALKQKSSRWLHTEFSRLLVSSLPLMGRSLPTLLNAVVPQVCLNLESIA---------------ASSTQHLICPPDYLITELEALTALCHFVLVDSPHNAGGPTLAGSAGMLGGMSWGVSNVYASGTPPNPNGQILNNLMHAFTPNGINGTLGNESASAGGDPYLVARRQMLSSLPRILVCISYLWQSSIDRLTGKVQ------------------RQKLLEFVSPIGHHHGVSLLAAVSVAWVEKRKDSMT-GNGKSKKIIPEC------------GSEQLALVDLISSVRVLPPDT----LVQLLRQVLKQPLQMQLHNRSSRLEVGLLHFFHAYLQKINRVQLGECWGSLLQLLRE-VTTMAPPILFAGLVVFGEAVQRYQTPGEKRDQRELQEVTGKLLEACGAVAAASLEQTTWLRR--NLSVRRDTLSAAP-TAESDDAAILDEMSSSSSDTSSV----------------------------------HMSATDDAAVVVNPISNNKTSRYSIQALVVLAELLAPLQDLIFPSQDKERVIPLLTSLL-ANVVPYLRHHSQSNISGMRAASLLLSSLSDYPATRRAWRKDAFDLLLDPTFFMMDIETLRHWKNIIDNLMCHDKDAFREFLNRVSVSPSG---LFSSRELEMETRTLFLKRLAFTLFCTDGDQYQRFLPDIQEKLSESLRLAQSWPSVQAQVFLCFRVLLLKTSQQHVTSLWPSVVAETVQVLSQLEHELRRDTEEFSSQIRRLSALDSTWVTSTTNGLQGNAHPAWLHLYLATCKLLHLALILPANRLPQFQMYRWAFIGDDNASDGDISSSSRTMHVTPNFVPYLTRI------YRL-----LRSKVEVAKTSLPTTVSLDDMALPSACNIKSLMDLLPFF 2180          
BLAST of Dopey_N domain-containing protein vs. TrEMBL
Match: R7VE65 (Dopey_N domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_134195 PE=4 SV=1)

HSP 1 Score: 640.958 bits (1652), Expect = 0.000e+0
Identity = 563/1982 (28.41%), Postives = 968/1982 (48.84%), Query Frame = 3
Query:   24 IEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSA----SERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEVTPSQFPSF----QMTIDRICELVKFILIRLPIETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKIFQNASQTFDVSTLHNPVSIPTSNSTARKPSLAMYTSNLTSYNSSKVMVRTIHNFREFTRKFFVFVLDCSNDQISQCANSLFSQNTKKSRVEKLNKAEMEYNSLKLPLSVDLIVVEVYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLG-SMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISLPSLVXXXXXXXXXXXXXXEICEEAENSAIALEEKRIYAISNENGNVKYHLKPNSIGTQSNNSDSSQKVQPVSLIQTFEVTRKSKSSNI-------VKGVNSEPL--RINELNSENNWSDANFNGNSKFLSSDSMESNVKVSMEKVIT--NVLSGKETSGNLENDSYLE--------DD------------------VLHQVENSNPVDFAIDPTELCEEITESGNQ-----------EINLNDSEY--TPSNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEKTTNILSDS-----IMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSE--KINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRK--------------------SFPLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTD 5708
            +E+ +   D+K+R +  QV+K L+ FE +SEWADLI  LGKL K+L A+V++ +IP++  +GKRL+QCLHPALP+GVH+KALE +D+IF  IG  +LA DLF Y  G+FPLL+ +A+++K  L  LYE +FV LG  I+PA  GLL GLLPGLEEG+E + R   +LE+F E+ EP YFY C+W+ +L + +VR     ++L HF+R+ S +DQ++F+G+++ L++ +L   + DQ VLVQR AL+ +L A  MH SQLT  D  KLC+A + V+LRRDMSLNRR Y+WL+G +     L      +D +      + SE E+   YF  +SR+IL+A IK  I+    SA     + +  ++PFRI+ +L+DR+E+G  ++EDI+ ++   + +E  +L   T +    +       +D   R   +    +  E +KTANL F   +  + W+++ R F  A ++  T  +   +     + I+ +C LV F+L ++ +E Y++  + +LP+LL ++T  L     NL    +K  LQ+   I  ++                            PS+A     +  Y       R      E   +    + D   D +    + L  Q++    +E + +     N   LP +    V E +   CQL+VE +S P+Y      Y+ +    +T +K      P WL  L+T ACF++ F I++ A+S ++DLI  T               Q++     S+  +P         ++  S+G+ ++ ++ ++  +  ++ L+ +T F+    ++LW+ LS + P CH   V L++ LH+ AP   ICE +I   +L+D+    +++++RF +LW LL         D  + SS G ++RTFD+ + ++LDSL   +         R+L  +WL  + Q G   +I+ P+LL LL PDTARIS+  +          Q  R  I  +  +  +   E +IYAIS+E GNV YH+      T      +S++ +  ++    E   ++K++          + V++  L  R+N   S ++     F G     S      NVK    +      +   ++  G  E+D  +E        DD                  VL + E     +   + ++  EE  + G++           EI+ +D E    PS    IHPLH+H+LLY   +D+   LY+LS L+T+  + P +    +                +N+  ++  +  ++  +L RH  ++ G +F+     E + +F+S   +E+++ +C +F+ S YP      K++  ++  NK+VQ+L+ E+L  ++QE+   + +G  + RG F T       I ++      +C + K  LHC+  S+    K T   S+S     ++  NE  +D    D  QV L++L+L V+ L+  L    V  +   L     +  +     L +P++ K      Y  + P   V  QS+LLT++++ +      H+H +    + S+L   G+  S +++ +V ++C+N+ L ++ Y++            + + + +P D+ ++ L  L  +CH+ LL                              D+ +++D  S    +++AR  ++ ++ R + +L +LW     SE  K +L ++   PSWTMG P +VRQ IL  I P+ R H   ++ ++A VW +  Q     G F     +              + S     + ++EL   + K F    +I T + +I                      S  L+ ++    +V LL+F   ++       L      L  LLKE +  +L P   FILL +LS+F+ K+ + D++++ +++QD+ QK+LE+V  IAG+SLEQ ++FRR   +K  +   D +P + E  TD
Sbjct:    3 LEECELLADSKYRAYIAQVEKTLRNFESTSEWADLIAALGKLNKVLSAHVKYPVIPKRVTIGKRLAQCLHPALPSGVHLKALETYDIIFKCIGTPRLASDLFTYSAGLFPLLAHAALNVKPALLLLYETHFVPLGKHIKPALSGLLLGLLPGLEEGSESFDRTVALLEEFCEAAEPTYFYACVWECVLSSSAVRLAAINYVLLHFSRKQSMEDQIHFMGSNVDLLVEALVLSMQDQSVLVQRSALELLLVAFPMHNSQLTRPDMIKLCSAAVKVVLRRDMSLNRRLYAWLLGTDSGGNPLPS---RADTI-----STCSEPEMD--YFFFFSREILVAGIKICINETRESAIPSGGKPLGHLRPFRILISLLDRAEVGCSVLEDIMIDVFRCMYRECAVLSSSTVQNGDASVTSLGRKKDGKTR---REDRLMLVEVVKTANLLFGAFEPHYMWDFIGRTFELACQEAGTSRKAKCYTEEKNICINELCILVDFLLDKVSLEVYTETQTEYLPELLRTITQSLCVSCINLRDSEMKNSLQLCSKILSRVL---------------------------PSMA----PVGGYEIEGSPFRHKPEPIEEKEEEEEEIEDDCEDNLVPPPSQLPRQSSTPDNMECVRRV----NLTDLPST----VAEAFLCACQLLVEFSSLPMYCT---DYQQVL---QTSFKTEP-SFPGWLRLLMTCACFVDNFCIQTAAVSTMIDLIGLT---------------QSVLNLCDSESATPPVAVPEGQRSRSNSEGTVSVVIIPAISPKH-LQMLNKQTSFYKAVAMNLWNCLSESTPACHTRAVELLDHLHQLAPETWICENVIGNGLLSDDKAVKVEAYKRFTILWHLL--------RDRGSTSSPGKTIRTFDRSMFLMLDSLHLDTHP------CRSLTQTWLTHSVQRGDIARILEPILLILLHPDTARISIQHV-------SIHQPKRVRIASDISDDPLDEAETKIYAISSEGGNVIYHVS----NTPKAPPSASKENRTFAMTSISEAGHRAKTAKTKMETELHFEKVSASDLNVRVNPFGSASSADRVVFEGYEIPPSQKFHLQNVKRLDAETCKKEGIFFTEDQDGTDESDLTMEVRDEAERTDDEKSTEEIVAEIIAEMINKVLSEKEVEEEEEVKEEESKRGEEAVDGGSEQLLNSIEGRMSEIDESDEEREEAPS----IHPLHTHILLYGQKFDAQRTLYALSCLKTLLTATPRLATCAIAT--------------TNVSSAQTVHATQVQHLLLRHRRSVFGKSFFSEFPAEALSTFRSTMFIEVLLSLCLYFIRSYYPNLMMS-KLTESELNGNKEVQVLSCEVLTLLLQEL---VNLGKDSGRG-FATY------IHDLLA----KCKIQKTLLHCVLASVYNARKKTPSPSESNFTEAVISFNEENMDGDTNDTFQVKLLKLLLVVIHLEDILMK--VRGDSESLAHLPAEMEHTRAAAL-VPTLAK----VRYFNNRP---VVYQSMLLTAVLSALKQQHRSHMHRHWIATLTSALPYLGRGLSHMVVTVVNQICRNMELLSHQYDTGAM-----HSGGNYQPDKVPPDHVITLLEGLTTLCHYCLL------------------------------DSMAQQDQPSVVNPVVEARRHLLSILPRILSALCVLWHSVQTSEHKKGSLGED--QPSWTMGPPRQVRQYILEFISPISRYHSINLMGAMAVVWNNRRQ----RGAFYNPKRV--------------IPSAGDDQLLLVELISAI-KVFPTDTLIQTVKQVIHNPPTTASEKVTPPSHPPLFALSHTLSSQKRTSHEVGLLQFFFAYVQRTPGAHLVDSWPSLLSLLKEGLQINLSPPGHFILLALLSEFVQKIPMFDDRKDLKDLQDILQKLLESVGEIAGASLEQTTFFRRNLVVKPGAQI-DVQPEAEEAQTD 1784          

HSP 2 Score: 274.633 bits (701), Expect = 6.251e-70
Identity = 137/322 (42.55%), Postives = 209/322 (64.91%), Query Frame = 3
Query: 5922 TLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIK----------------SIKQNDINKR----LNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLV 6827
            ++QAL ++    A+++DV Y+SEEK++V P L ++++ NV PYL+  S  NL +FR  +QL+A+LS YQ+TR++W+K+ F+LL +S FFQ D   +  W+ IIDNLMT DK TF++   ++T+ QG  LNLFTSKE E +  A  +K+L+F ++ S+LDQY +SMPEIQE+LS+SLRL  +P ++ Q+FLCFRVL+MR+S  HLTSLW   I  L  VL  +  +L  +++                +++ N +++     L +YL+ACKLLD+  ++  D +PQF  Y+WAF+G+  E  +  R       P F P +T +
Sbjct: 1793 SVQALVIIAELTATLLDVVYRSEEKDRVVPLLHNLMY-NVFPYLKNHSPHNLPSFRACAQLLANLSEYQYTRKAWKKEAFELLLDSSFFQTDETCIGFWRTIIDNLMTHDKTTFRDLLGRVTITQGASLNLFTSKEHEIELRAQLLKRLSFTVFCSDLDQYQRSMPEIQERLSDSLRLQSVPSVQAQVFLCFRVLIMRVSPHHLTSLWPTIITELVQVLLQIEQELSPEMEDSRTRVAQIANLDPSWALQGNGVHQHQPGWLRLYLAACKLLDLALVLPADLLPQFQLYRWAFIGDTYEADDTGRRFKDQV-PFFTPHITRI 2112          
BLAST of Dopey_N domain-containing protein vs. Ensembl Cavefish
Match: dop1b (DOP1 leucine zipper like protein B [Source:ZFIN;Acc:ZDB-GENE-040426-1195])

HSP 1 Score: 302.753 bits (774), Expect = 6.718e-82
Identity = 187/517 (36.17%), Postives = 300/517 (58.03%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLF-------------ALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLR-YFKKYSRDILIAAIKWIIDNP-TSSASERISS-IKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEVTPSQFPSFQMTIDRICELVKFILIRLPIETYSDVHSR 1529
            E+ +  ND ++R++A  ++K L+ FE SSEWADLI++LGKL K LQ+N+++ ++PR+ ++GKRL+QCLHPALP+GVH+KALE ++VIF IIG + LA DLFIY +G+FPLL+ +AM +K  L  LYE+YF+ L  ++ P+    + GLLPGLEEG E Y R + +L + +  V    FY  LW  +L +P VR   + F++ HF+R  S+ +Q Y LG    L + ++   L D  VLVQR +L+ +L+             A+ + R Q+       + +A    LLRRDMSLNRR Y+WL+G ++ +  ++            DL   S  E  +  YF  YSR++L+ A+  I+         + +S  ++PFRII +L+D+SEIG  ++ D+L  +I       +  E L  EA  ++      +  + +   VK   N   E +KT N+    + S + W+Y+ + F   L+ +  PS+  S   ++  +  L+ F+L  +P+E Y+++ ++
Sbjct:    4 EEAELQNDYRYRSYAAVIEKALRNFESSSEWADLISSLGKLNKALQSNLKYSLLPRRLIIGKRLAQCLHPALPSGVHLKALETYEVIFKIIGTKWLAKDLFIYSSGLFPLLAHAAMSVKPVLLTLYERYFLPLQKALLPSLQAFITGLLPGLEEGLEVYDRTDALLLKLSLLVGQSVFYGALWGSVLVSPLVRLPASLFIVTHFDRMASSCEQKYMLGTDHRLTVKAMCLSLQDSNVLVQRNSLEILLYFFSFGTCLDPEKSAIPLRREQMIT-----VVSAASLTLLRRDMSLNRRLYAWLLGLDI-KGGMVA----------PDLSQYSTVEEHVEYYFNTYSRELLVQALVNILQQKDIEKDPDNVSDYLRPFRIIISLLDKSEIGPLVLSDVLLEVIRAFYS--YCREMLGEEALNSS------LSGNQLNSKVKENKN-ASEIIKTVNMLVGAISSEYLWDYMTKHFQTCLRYKAPPSKAWSPPPSMTELSTLIIFLLDVIPLELYAEIQTQ 495          

HSP 2 Score: 206.838 bits (525), Expect = 1.104e-52
Identity = 124/352 (35.23%), Postives = 198/352 (56.25%), Query Frame = 3
Query: 5970 DVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQNDINKR---------------LNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEET-NYFRSNDMNFQPVFRPFLTLVIDS-YIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFT 6974
            D+ Y+S+EKEK  P ++ +++  V PYL+  S+ N+ +F   +QL++SLS Y +T+R+W+K++ +L  +  FF  +      WK I+D+L+T +K  FK+    L   Q   L LF S E    Q  M +K+ AF ++S E DQY   +P IQE+L+E+LR+G  P +  Q+FL FRVLL+RIS QHLTSLW    PI+ + L  +   L+  +   K N  NKR               L+MYLSACK LD       + +P F  Y+WAFV  +D ++ +   +  +  +   +P +  +++  + +Y L+  +  +++E +      E PL+  +S+ S+T L PFF T
Sbjct: 1820 DMVYRSDEKEKAVPLISRLMY-YVFPYLKNHSAYNMPSFSAGAQLLSSLSGYAYTKRAWKKEVLELFMDPMFFTMEPACACHWKSIVDHLLTHEKTMFKD----LMSMQSSSLKLFNSAE----QRPMLLKRQAFAMFSGETDQYHLYLPLIQERLTENLRVGQTPAMAAQMFLMFRVLLLRISPQHLTSLW----PIMVTELIRIYARLEKTLLEEKDNSKNKRGGQEKNGLLTFPQAELDMYLSACKFLDTAVSFPPERMPLFQMYRWAFVPEVDVDSYDGPGTTLLEGEQECKPHVVRILEGLHHRYGLNGTVGESTLESI------EFPLLTLRSLSSITQLVPFFQT 2152          

HSP 3 Score: 97.0561 bits (240), Expect = 2.382e-19
Identity = 103/456 (22.59%), Postives = 204/456 (44.74%), Query Frame = 3
Query: 4374 KNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKV-RQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPLTEKEEGQ--VKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRR----AAQLKLDSDTGDERPGSNEINTDGVI 5717
            +++ +  Y +S P +A   Q + +++    +       +H      +  +L   G+S + ++ PI+ ++CKN+      +E  ++ I  +  +   E N  P DY L+ L  L  + H+ LL++                                K+ + S  T + +A N +++     I ++ +LW     ++  + +     P+    +  K+ +Q IL  + PL + + S ++ S+A VW         +   S+    ++  L   S S           + I++L + L    T   I++  +++++K   +   ++    V V +L+F   ++ +  +  L      L  LL+ES+  +L P   F+LL IL+DF++++   D KR+ RE+Q++ Q++LE V  +AGSSLEQ SW  R     AQ ++     +E P  N+ N  G +
Sbjct: 1399 QSIKAVRYVSSQPIMA---QGMFVSAAARALCPQYGFAMHPAWVTLLCGTLPFLGRSLAIIVAPIIAQICKNLDELVKQHE--HKSIKSSHSILKRE-NIAP-DYPLTLLEGLTTITHYCLLEQ--------------------------------KKSAGSDATDMRNACNAILEEFPHMISTMAMLWGVVKGADSSHSSSSRSSPASVYFKSTKILKQKILGFLMPLTQLYGSQVMASMAAVW---------NSRRSRKRRSKNKILPAVSDSQ----------MTIVDLVKSLNTLHT-DAILHLVKEVVKKPNQIKGDQQKPILVDVPMLQFCYAYIQSLPAQALQDNIMPLLCLLRESVQLNLTPPGHFLLLGILNDFVNRLPNMDNKRDSRELQEVTQRILEAVGGVAGSSLEQTSWLSRNLEVKAQPQICLQEDEEEPEGNDCNGGGAM 1795          

HSP 4 Score: 75.0998 bits (183), Expect = 1.014e-12
Identity = 80/320 (25.00%), Postives = 141/320 (44.06%), Query Frame = 3
Query: 1989 EVYHEICQLVVEMTSYPLYFNVSEKYE----SITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTL----------CISWLEKAFQDGHAHKIVNPLLLALLKPDTARISLPSL 2906
            + +   C L++E T++P+Y+   E  E      TN+  T         P +L  L+T  C   ++ ++ +A+S+L++LI                 SQ++   I  K+    S   NP + +          V L  +  +V++ ++ +T F+      LW  L +   + H   V L  RLH  APSA+ICE++I   +L+ +    L+   RF +LW L   +EV   N +++++     R+FD+ +                 VVL +L            SWL +A       +I+ P+LL L+ P T R ++ S+
Sbjct:  678 QAFTAACHLLLECTTFPVYYTEEESQELHSSMFTNTTGTQLYTGCSS-PIYL-SLMTLCCISKDYKVQHVAISSLMELIN---------------HSQSLALVIQDKNQRYKSSEANPLSGQ-------LQMVTLPPIYPSVLKTVERQTNFYQRVAQVLWAQLDTERREHHISCVELFYRLHCLAPSAAICEDIICMALLSRDKVVRLEGLHRFSVLWHL--TREVQT-NRSTSLN-----RSFDRSL----------------FVVLDSLNSQDGSVSAAGQSWLVRALSLNDVIRILEPVLLLLVDPRTQRTAIHSV 949          
BLAST of Dopey_N domain-containing protein vs. Ensembl Cavefish
Match: dop1a (DOP1 leucine zipper like protein A [Source:ZFIN;Acc:ZDB-GENE-050309-65])

HSP 1 Score: 255.373 bits (651), Expect = 2.352e-68
Identity = 130/309 (42.07%), Postives = 191/309 (61.81%), Query Frame = 3
Query: 5955 LASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCD----------IKSIKQN-----------DINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFL 6818
            LA ++D+ + S+EKE+V P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D   +  W+ IID+LMT DK TF++  T++ V Q   LNLFT+++AE +Q AM +K+LAF IYSSE+DQY K +P+IQE+L ESLRL  +P +  Q+FL FRVLL+R+S QHLTSLW   I  L  V   +  +L  D          I  ++             +  + LN+YLSACKLLD+   +  +S+PQF  Y+WAF+    +++          Q  F+P++
Sbjct:  776 LAHLLDMVFYSDEKERVIPLLVNIMH-YVVPYLRNHSAHNAPSYRACIQLLSSLSGYQYTRRAWKKEAFDLFMDHTFFQMDSSCVSHWRAIIDHLMTHDKTTFRDLMTRVAVAQSSSLNLFTNRDAELEQRAMLLKRLAFTIYSSEVDQYQKYLPDIQERLVESLRLPQVPILHAQVFLFFRVLLLRMSPQHLTSLWPTMITELVQVFLLMEQELTADEDITRTSGPSIAGLETTYSGGNGFSTSYNSQRWLNLYLSACKLLDLALALPSESLPQFQMYRWAFIPEASDDSGLEVRRQGTHQREFKPYV 1083          

HSP 2 Score: 147.902 bits (372), Expect = 6.501e-35
Identity = 171/763 (22.41%), Postives = 314/763 (41.15%), Query Frame = 3
Query: 3471 NLNDSEYTPSNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFY-QNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEKTTNILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKS-----------------------NNKNDFKLPLPSV-----YKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKIN----LNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPLT-EKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLK 5654
            N + S  +PS  + +HPL+ H+LLY  +YDS+  L++LS +  + R+ P   V  +               N+      +  QN    +L+RH  ++ G +FY   P      SF+S   LEI++ +C +F+ S Y         + +D+  N+ +Q+ + E+L  +  E+               VT    K     I  V F +C V K  LHC+ +SI   +K                 DQRVR +          NV  ++ G+    +++  +     DG S                         +  F+L    V      + + S  Y    P   ++ Q + L +++  +       +H      I ++L   G+    V+  +  +LC+N+    NL +        T          +P D  L+ L  + A+ H+ LLD + + +QLQ     S +Q                        H+ +AR  ++ ++   + S+ +LW    L++  +        C   +  +G    +RQ IL ++ P+   H +  + ++A VW    Q                    +A   N  + +     + +++L R +    T T ++ T ++++++   +  EK+   ++V +L+F   ++     + L      L  LLK+S+   LP    F+LL +L++FI K    + K++QRE+QD+  K++E +  IAGSSLEQ +W RR  ++K
Sbjct:  100 NASRSCTSPSR-FNVHPLYQHVLLYLQLYDSSRTLHALSAIAAMLRTAPASFVSAIST----------TSINNTYTPQLSLLQN----LLARHRVSVMGKDFYCPIPQDSHSHSFRSAMYLEIVISLCLYFLRSYY---SAHVAATTQDLAGNRSMQLTSVEVLTLLFCELAK-------------VTGASAKGFASFISDVLF-KCKVQKVTLHCLLSSIFSAQKWH---------------DQRVRGS----------NVAAVEEGMTEESIIN--LSEDQLDGCSAVQSQLLRLLQSLVVLEHHVMVPGEEGGFELLGGEVEHVNPQQPMASLQYLPGQP---ITAQGMFLCAVIRALHQHHACKMHPQWISLITATLPYMGRVLRRVVASVTLQLCRNLD---NLIQQYRYETGLTDARPQWMALCIPPDLILTVLEGVTAIIHYCLLDPSSQYHQLQ----VSVDQK-----------------------HLAEARAGILSILHTIMSSVTLLWSVLYLADSSDRPAGAAAACSSSNINLGSTKNLRQQILELLGPISMNHGTHFMAAIAYVWNERKQV-------------------KAPARNKVIPTASEEQLLLVDLVRSVNAMRTET-VMQTVKEVLKQPPAIAKEKKHLSLEVCMLQFFYAYVQRIPVSSLVDSWPSLLALLKDSVQLGLPAPGQFLLLGVLNEFILKNPTLESKKDQRELQDVTHKIVEAIGTIAGSSLEQTTWLRRNLEVK 750          
BLAST of Dopey_N domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000058128.1 (pep primary_assembly:Astyanax_mexicanus-2.0:17:22379001:22384436:-1 gene:ENSAMXG00000030154.1 transcript:ENSAMXT00000058128.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.57 bits (462), Expect = 4.509e-52
Identity = 79/141 (56.03%), Postives = 109/141 (77.30%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAF 449
            E+ +   D+K+RN+   VDK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++P+K  +GKRL+QCLHPALP+GVH KALE +++IF IIGP++LA DLF+Y +G+FPLLS +AM +K  L  LYE Y++ LG +++P  
Sbjct:    4 EELELLGDSKYRNYVAAVDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPKKLTIGKRLAQCLHPALPSGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLSNAAMSVKPVLLGLYETYYLPLGKTLKPGL 144          
BLAST of Dopey_N domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000037483.1 (pep primary_assembly:Astyanax_mexicanus-2.0:17:22364275:22375882:-1 gene:ENSAMXG00000030687.1 transcript:ENSAMXT00000037483.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.9593 bits (206), Expect = 7.414e-16
Identity = 52/196 (26.53%), Postives = 98/196 (50.00%), Query Frame = 3
Query: 1992 VYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKML 2579
             +   CQL +E +S+P+Y  V+E     ++++E      +   P WL  L+ + C   +FSI+++A+S ++DL+  T+ V         + ++ +    + + +SP+           ++QG              +++ +  KT FF    L LW+ L  + PQ HQ +V L  +LH   PS+SICE++I Q+++
Sbjct:  295 AFTAACQLFLECSSFPVY--VAEGNMKSSSTREEQADGESILPPAWLQTLMDACCSATDFSIQAVAISLVMDLVGLTQSV-------AMVTAERVASPDSGQPMSPSQGRVAVVIRPPLTQG--------------ILKYIAEKTNFFKSVALILWEQLGESTPQHHQRSVELFYQLHNLVPSSSICEDVISQQLM 467          
BLAST of Dopey_N domain-containing protein vs. Ensembl Yeast
Match: DOP1 (Golgi-localized, leucine-zipper domain containing protein; involved in endosome to Golgi transport, organization of the ER, establishing cell polarity, and morphogenesis; detected in highly purified mitochondria in high-throughput studies [Source:SGD;Acc:S000002548])

HSP 1 Score: 119.783 bits (299), Expect = 3.296e-27
Identity = 134/501 (26.75%), Postives = 208/501 (41.52%), Query Frame = 3
Query:   48 DNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQA------NVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFV-----TLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESV-EPIYFYTCLWQVMLQAPSVRTYGTAFLL-------------------------------NHFNRRLSTDDQLYFLGNSI--------SLMLNSLTQILNDQ-QVLVQRQALDFVLFALSMHRSQLTV----SDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYL 1382
            D+K + F   V++ L+ F+  +EWAD I +LG L+K LQ+      NVR+  +P    V +RL+  L PALPAGVH K LE +  IF  IG   LA +  I+  GI PL++ ++M +++ L  LY+ Y +     TL + IRP        L    +E  +F     K++E   E++ +   F+  L+ VM      R  G  +L                                +H +R+   ++    L  +          L++  L   L D+  +L++R  LD +L  L +    L V     D++ L  +C    L +DMSLNRR ++WL+G               +          S NE    YF KY    L+  +  ++       SE  S +  FRI   +MDR EIG  +I ++   L+                                   S K K N  E+ +KTA  FF N +++  W  L
Sbjct:   18 DSKQKKFRANVERALERFDSVTEWADYIASLGTLLKALQSWSPKFQNVRY-YVPSPYQVSRRLTSSLSPALPAGVHQKTLEVYTYIFEHIGLETLATECNIWIPGILPLMTYASMSVRSHLIELYDNYILLLPQTTLRLLIRPLI---SSLLPGIDDESNDFLPLTLKLIETLQENLDDDSLFWQTLFLVMTANKGRRLGGLTWLTRKFPSLNAVPHLVNKIKMEAEENPSETETNDSHLDRKKRKEEAFKVLLPAAKDLVTPEPGLLIRCLVGCLEDENDILIKRSVLDLLLQRLRLDSPVLNVLITSEDKKLLIMSCCRTTLSKDMSLNRRIWNWLLGPTAGGMLNNNGGNSMEYTTSVK----SANEESNVYFTKYGLSALLEGLSDLL-------SEEESVLTAFRISMAVMDRWEIGSLVIPELFIPLLY---------------------------------SSEKFKQN--EQIMKTARTFFDNTETNIIWGKL 468          
BLAST of Dopey_N domain-containing protein vs. Ensembl Nematostella
Match: EDO38329 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDA1])

HSP 1 Score: 253.832 bits (647), Expect = 8.294e-69
Identity = 141/369 (38.21%), Postives = 212/369 (57.45%), Query Frame = 3
Query: 5928 QALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLT-VNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQNDI-------------------NKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYN--EKPLIYRQSIHSLTDLAPFF 6968
            QAL +L+  LAS++D+ + SEEK++V   LTSV++ NV PY++     N+ NFR    L+++LS YQ+ RR+WRK++ + + +  FFQ DI  + SW+ IIDNLMTQD+ +FK+   K+    Q   +N+F +KE E +Q A  +KKLAF I+ SE DQY   +PEIQE+L+ESLRL  +P +  Q+FL  RVLL+R+S QHLTSLW + +  +  VL  +  DL  + KS     +                   +K L +YL+ACKLLD+   ++ +++P F  Y+WAF G     T   RS       VF+P +  +      + L       + + + +NL    ++PL+    I S+  L PFF
Sbjct:  689 QALTVLSEVLASLLDMVFGSEEKDRVTTILTSVMY-NVTPYMKNHGPRNVPNFRACCALVSALSGYQYMRRAWRKEVMEQVLDPVFFQMDITCIASWRTIIDNLMTQDRTSFKDLMAKVAGFGQSAAINIFANKEQEIEQRASLLKKLAFAIFCSETDQYQDCLPEIQERLAESLRLAQVPVLHEQVFLALRVLLLRMSPQHLTSLWPVMVSEVVHVLLQMESDLSSEGKSTSSQRLMTSEALFGNNVVHNVTYSQDKWLGLYLAACKLLDLALCLSSEALPHFQMYRWAFEGGDSNATMVTRSKAEKIS-VFKPHIARL------WKLLRKRSRRTADDI-DNLLRAPDRPLLTMYQIKSMDQLLPFF 1048          

HSP 2 Score: 153.295 bits (386), Expect = 3.573e-37
Identity = 170/733 (23.19%), Postives = 323/733 (44.07%), Query Frame = 3
Query: 3495 PSNHY---LIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQ---IGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEKTTNILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYI---AVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPS---WTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPLTEKEEGQV-----KVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRA 5642
            PS+H     +HPL  H L+Y   YD    LY+ + + ++ RS P   V          S++               +Q K+ E+L+RH   L G  FY  P  +   +      LEI++ VC +F+ S Y     G      D+  N +VQ+ ++E+L  IV +++ +++    G+    G F++               F RC V K  LHC+ +++ +    T I   +    N   L +R+      + +R +   L     L   +VL + I+L +S     N +   +P         ST + ++  YI    ++RQS+LL++++  +       LH    QF+I+ L     S S  ++ + +++ + +      Y+   +     KD     + +LP DY  S L  +  +CHF LLD A  S                           +  D   P   +L AR  ++ ++   + ++  +W   S  +      + +P     + +G P  VR  ++ ++ P+   H  + L SLA VW    Q    D     ++    V + +       ++ EQ   + ++++  GLK + +  + I+  + I+R+   +T K++  V     +VN+L+F   ++   + ++L+   G L  L+KE +    P A F++L IL  ++ ++ + ++K+ ++E+QD+ Q+++E    +AGSSLE+ +W  R+
Sbjct:    2 PSDHAPKPQVHPLDQHKLVYVLRYDWKLTLYAFNTILSVLRSAPHQFVCAASAHSVSSSNTP--------------HQVKMKELLARHRKCLLGKGFY-GPLYDSPTASAPGMYLEILISVCLYFIRSEY---GVGLDRDAADVDGNAQVQMTSAEVLTSIVWQLVEVVRETGAGF----GPFISD-------------LFTRCKVQKALLHCLVSTLYE---RTGINVPTAGADNGPHL-KRIDGGKTASQLRGLQVKLLKL--LQAIFVLESNIELSES---ITNDSITNVPASPAKLESESTIHQSAQRYIPGRTLARQSMLLSAVLHGL-KYDDYDLHHEWLQFVITCLPHMKGSLSTWVVRVTEQVGRMLEFQTTAYQPLWKHGKTGKD-QIQSMPSLPPDYIASLLEHIGTICHFCLLDGAPSS--------------------------PASVDGPKP---LLGAREGLLSILPSLLSAVFTVWNAWS-PQTFETTGQRLPSESYLYLIGTPKMVRHHVMQLLTPVAMHHTIVFLASLADVW---HQRRRGDSQVQTANKTSKVVVPQ-------ISEEQ---VVVVDIVYGLK-ALSFDNTIDNIKQIVRQV--VTNKDKSTVTHTGLEVNILQFFYYYMQRATQSQLTNSRGSLISLMKEGLQLNQPPALFLMLVILQSYVQRLPLQEDKKARKELQDITQRLIEACNTVAGSSLEKAAWLSRS 642          
BLAST of Dopey_N domain-containing protein vs. Ensembl Nematostella
Match: EDO38328 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDA0])

HSP 1 Score: 203.756 bits (517), Expect = 4.010e-56
Identity = 114/226 (50.44%), Postives = 154/226 (68.14%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLN 704
            E+ D  +D+K+R F + VDK LK FEYSSEWADLI+ LGKL K LQ + +F  IPRK  +GKRLSQC HPALP+GVH+KALE +D+IF  +G + L  DLFIY  G+FPLL  +AM +K  L  LYE++F++LG ++ P   GLL GLLPG+EEG+E+  R   +LE  + + +   FYTCLW   L + SVR     F+L+  +R+ S +   Y LG+ I LM++
Sbjct:    4 EELDLLSDSKYRQFISAVDKALKSFEYSSEWADLISALGKLNKALQGHPKFKAIPRKLTIGKRLSQCTHPALPSGVHLKALETYDLIFKRLGKKGLGQDLFIYGAGLFPLLGNAAMSVKPVLMGLYEEHFLSLGKALLPGLQGLLLGLLPGIEEGSEYTERTISLLEAISHNTDRPAFYTCLWSCFLSSSSVRLPAVTFILSRLSRKTSLNKD-YILGDDIPLMVS 228          

HSP 2 Score: 62.7734 bits (151), Expect = 1.316e-9
Identity = 37/115 (32.17%), Postives = 62/115 (53.91%), Query Frame = 3
Query: 1065 TSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRE-----SVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLF 1394
            TS+ ++R ++++PFRI+ +L+DR E+G  I+ED+L  +     +  ++  K+  E             +S   E     S  SKT L +E +KTANL F   +  F W+YL++L 
Sbjct:  275 TSNGAKRSNALRPFRILISLLDRPEVGSAILEDVLIEVF----RALYVQCKVIKEKTPIEELGSYESIESLTAEFENPSSSSSKTKLTDEVVKTANLLFNAFEPYFMWDYLSKLL 385          
BLAST of Dopey_N domain-containing protein vs. Ensembl Medaka
Match: dop1b (DOP1 leucine zipper like protein B [Source:NCBI gene;Acc:101172207])

HSP 1 Score: 312.383 bits (799), Expect = 6.865e-85
Identity = 318/1208 (26.32%), Postives = 541/1208 (44.78%), Query Frame = 3
Query: 3513 IHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNL-EIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSI--------TQPEKTTNILS----DSIMLLNES-GLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKN--LF-----STHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDK----------VRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPLT-EKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCD-----IKSIKQNDINKR---------LNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDE------ETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSL-GIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFT 6974
            I  L  HMLLY +      +L  LS L ++FRS      P++E L           S+++L  S A + N +  +L RH  A  G +FY              + L E+++ +C  F+ S YP   +   ++  D+  N++VQ+ +  +L  IV ++                 + K    +++I K+    C + +YAL  +S S+         +P K+   L     +S++ L ++ G +Q      Q+ L++L+  ++ L+Y +    V+S G   +  +  + +      PL   ++   LF     +  Y  S P  A   Q + +++    +       +H +    + SSL   G+S   ++ P + ++C+N+     L+E        T    S +   +  DY L+ L  L A+ H+ LLD                           +K +    D++     + +ARN +I+ +   + S+  LW    + E++       P    M R             +RQ IL  + PL R H   ++ SL  VW H                      ++    N  L       + I+EL + L    T T I++  +++++K   +  E++   V + +L+F   ++ +  +  L      L  LL++S+  +L P   F+LL IL+DF++++   D K++ +++Q++ Q++LE V  IAGSSLEQ SW  R+ ++K+ S    +    +E   DG                                   E R            ESA   +T+     PS    ++QAL LL   LA ++D+ Y+S+EKEK  P ++ +++  V PYL+  S+ N+ +F   +QL++SLS Y +T+R+W+K++F+L  +  FF  +     SWK I+D+L+T +K  FK+    L   Q   L LF+S E    Q  M +K+ AF ++S ELDQY   +P IQE+L+E+LR+        Q+FL FRVLL+RIS QHLTSLW I +  L      L   L+ +     +  + +  +++          L+MYLSACK LD       + +P F  Y+WAFV  +DE      ET      +        P +  V++   Q Y ++ G+   S E   E L  E PL+ ++S+ S+T L PF  T
Sbjct: 1186 IDSLFRHMLLYPAAGGWRHLLQGLSLLDSLFRS--SAECPLVEAL-----------SSTSLDTSLAPHLNLVSNLLQRHQQAQDGKSFYGGLLSPSSTPSAPPSLLIELLVSLCLLFLRSHYP---SYLSLTPLDLQGNREVQVKSVTVLTRIVNQLCC-------------TAREKEGRNLESIRKI-LSGCKLQQYALLSLSASMYASQKGADREPSKSAEELGGPPEESLVNLGDARGQEQY---PLQIELLKLLHALIVLEYHVWPGGVVSAGQASEPREASTPST-----PLAREWQTAVLFQQSIKAAQYVHSHPITA---QGMFVSAAARALQPQYGYAMHPHWVSLLCSSLPYLGRSLGIIVTPFISQVCRNLDDLVKLHEHDGG---KTNQSFSGKRENIAPDYPLTLLEGLTAITHYCLLD---------------------------NKKSLVSSDAVD----VRNARNAVIEALPSMLSSMASLW-GVVMREEVKRRPSDSP---QMSRHTSTSVYFKSNKILRQRILEFLLPLTRPHGVQLMASLGVVWSHRR--------------------SKRKHKNQVLPVASEPRMTIVELVKSLNTMQTET-ILHLVKEVVKKPHQIKGEQKSTLVDIPMLQFSYAYIQSIPAQALQENVAALLSLLRDSVQLNLAPPGHFLLLGILNDFVNRLPNLDSKKDTKDLQEVTQRILEAVGGIAGSSLEQTSWLSRSLEVKVQSQVCQDAEELDESYVDG-----------------------------------EHR------------ESAAPESTMVSSSAPS--VYSVQALILLAEILAPLLDMVYQSDEKEKAVPLISRLMY-YVFPYLKNHSAYNIPSFEAGAQLLSSLSGYAYTKRAWKKEVFELFMDPLFFTMNSTCAYSWKSIVDHLLTHEKTMFKD----LMSMQSSSLKLFSSAE----QKPMLLKRQAFALFSGELDQYHLYLPLIQERLTETLRMNPTAASSAQMFLMFRVLLLRISSQHLTSLWPIMVTELIRTFTRLEKALQAEKDVSKLAKVVRGALDRNGPVNFSQADLDMYLSACKFLDTSLAFPPERMPLFQMYRWAFVPEVDESCYSGPETTLIEGEEG-----CSPHVVRVLERIEQRYRTINGL---SEESSTERL--EFPLLTQRSLTSITQLLPFLRT 2225          

HSP 2 Score: 308.531 bits (789), Expect = 1.174e-83
Identity = 190/514 (36.96%), Postives = 298/514 (57.98%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVL----FALSMHRSQLTVS----DREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWII--DNPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEVTPS----QFPSFQMTIDRICELVKFILIRLPIETYSDVHS 1526
            E+ +  ND ++R++A  ++K L+ FE SSEWADLI++LGKL K LQ+N+R+ ++P++ ++GKRL+QCLHPALP+GVH+KALE ++VIF IIG + LA DLFIY +G+FPLL  SAM +K  L  LYE+YF+ L  ++ P+    + GLLPGLEEG E Y R + +L + +  V    FY  LW  M+  P+VR   + F++ H++R    D Q + LG     ++  +   L D  VLVQR  L+ +L    FA  +  +Q+  +    D   + +A L  +LRRDMSLNRR Y+WL+GA++    +      S  V  +D  S         YF  YS+D+L+ A+  I+   +  ++A   +  +KPFRII +L+D+ EIG  ++  IL +L+       +  E L  E N       + +  + +   +K   N   E +KT N+  ++++S F W Y+ + F  AL ++  P+    Q     ++   + EL+ F+L  LP+E ++D+ S
Sbjct:    4 EELELQNDYRYRSYAAVIEKALRNFESSSEWADLISSLGKLNKALQSNLRYSLLPKRLIIGKRLAQCLHPALPSGVHLKALETYEVIFKIIGTKWLAKDLFIYSSGLFPLLGQSAMAVKPVLLTLYERYFLPLQRALMPSLQAFITGLLPGLEEGLEVYDRTDALLVKLSFLVGQQVFYCALWGSMVVTPTVRLPASTFIVTHYDRMTPLDRQTHMLGYGHHAVVKPICLALQDSNVLVQRNMLEVLLYFFPFATCLDPAQVAATLANEDLITVVSAALLTILRRDMSLNRRLYAWLLGADIKGGMVAPHPSLSTTV--EDHSSF--------YFNTYSKDLLVKAMINILKQKDVDTAAESVVCYLKPFRIIISLLDKPEIGPAVLNCILLDLVRAFHS--YCREALGEENN-------SKLSGNRLASKIKENKN-ASEIIKTVNMLVSSMNSEFLWEYMTQRFCIALSEKNPPASPEQQTALHALSATEMSELIIFLLEVLPLELHADIQS 497          

HSP 3 Score: 79.7221 bits (195), Expect = 4.090e-14
Identity = 77/296 (26.01%), Postives = 137/296 (46.28%), Query Frame = 3
Query: 2010 QLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2897
             L++E T++P+Y++  E   ++          +   +P WL  L+   C   +  I+  A+++LL+LI        + +Q +++  Q+  +   S DI+P S                   V +  +   +++ ++  T F+      LW  L +   + H   V+L  RLH  AP+ SICE++I Q +L  +    LD+  RF +LW L   +EV   N   ++S     R+FD+ + V+++SL  +     G +     C  WL +A       +I+ P+LL LL P T R S+
Sbjct:  759 HLMLECTTFPVYYS-EEDTLALHTDMFGPAGSSEASIPVWLRSLMILCCMSRDCFIQHTAVASLLELI--------NHSQSLALVIQDKHRRYQSSDINPLSGRLQ--------------MVTMPPIYPALLQAMEENTDFYQRVAHVLWSQLDTERREHHVSCVDLFYRLHCLAPTTSICEDIICQALLHKDKAVRLDALHRFTVLWHL--TREVQT-NRTMSVS-----RSFDRSLCVVVNSLSSA----DGSISAAAQC--WLVRALSLNDVLRILEPILLFLLHPSTQRRSI 1017          
BLAST of Dopey_N domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000002497.2 (pep primary_assembly:ASM223467v1:16:4428243:4432549:1 gene:ENSORLG00000002001.2 transcript:ENSORLT00000002497.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 173.326 bits (438), Expect = 4.577e-46
Identity = 86/181 (47.51%), Postives = 124/181 (68.51%), Query Frame = 3
Query: 5901 TPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSE 6443
            TPS    ++ AL LL   LA ++D+ + S+EKEKV P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D   +  W+ IID+LMT DK TF++  T++ V Q   L+LFT+++AE +Q AM +K+LAF IYSSE+DQY K +P+IQ K S 
Sbjct:  210 TPS--VYSVHALTLLAKVLAHLLDMVFYSDEKEKVIPLLINIMH-YVVPYLRNHSAHNAPSYRACIQLLSSLSGYQYTRRAWKKEAFDLFMDHTFFQMDASCVSHWRAIIDHLMTHDKTTFRDLMTRVAVAQSSSLSLFTNRDAELEQRAMLLKRLAFTIYSSEVDQYQKYLPDIQGKHSH 387          

HSP 2 Score: 75.485 bits (184), Expect = 2.399e-13
Identity = 47/144 (32.64%), Postives = 84/144 (58.33%), Query Frame = 3
Query: 5229 ICILELARGLKKSFTITHIINTCRDIIRKSFPLT-EKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLK 5654
            + ++EL R +    T T +I T ++++++   +  +K+   ++V +L+F   ++     + L      L  LLK+S+   LP    F++L IL++FI K    + K++QRE+QD+  KV+E +  IAGSSLEQ +W RR  ++K
Sbjct:   38 LLLVELVRSVSAMRTET-VIQTVKEVLKQPPAIAKDKKHLSLEVCMLQFFYAYVQRIPVSSLVDSWQPLLVLLKDSVQLGLPAPGQFLILGILNEFILKNPNLESKKDQRELQDVTHKVVEAIGTIAGSSLEQTTWLRRNLEVK 180          
BLAST of Dopey_N domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000002494.2 (pep primary_assembly:ASM223467v1:16:4414772:4422418:1 gene:ENSORLG00000022489.1 transcript:ENSORLT00000002494.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.8929 bits (224), Expect = 4.433e-18
Identity = 58/198 (29.29%), Postives = 103/198 (52.02%), Query Frame = 3
Query: 1986 VEVYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKML 2579
            V  +   CQL +E +S+P+Y  ++E     + + E  +      LP WL  L+ + C  N+FS++  A+S L+DLI  T+ V         + ++++   I+S D   ++  T+PS  +          ++   L++ +++ +  +T FF    L LW  LS   PQ HQ +V L  +LH   PS+SICE++I Q+++
Sbjct:  296 VAAFTAACQLFLECSSFPVY--IAEGNLKSSPTLEEPFDTEEVRLPVWLQTLMDACCLANDFSLQGAAISLLMDLIGLTQSV-------AMVTAESVASGISSFD---STQTTSPSQGR-------VAVIIRPPLTQGILKHIAERTDFFKSVALILWHQLSEGTPQHHQRSVELFYQLHNLVPSSSICEDVISQQLM 474          
BLAST of Dopey_N domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000040938.1 (pep primary_assembly:ASM223467v1:16:4408074:4435072:1 gene:ENSORLG00000025627.1 transcript:ENSORLT00000040938.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 3.161e-6
Identity = 21/36 (58.33%), Postives = 28/36 (77.78%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLIT 134
            E+ +  +D+K+RN+   VDK LK FEYSSEWADLI+
Sbjct:    4 EEVELLSDSKYRNYVAAVDKALKNFEYSSEWADLIS 39          
BLAST of Dopey_N domain-containing protein vs. Planmine SMEST
Match: SMESG000074793.1 (SMESG000074793.1)

HSP 1 Score: 2222.2 bits (5757), Expect = 0.000e+0
Identity = 1104/1115 (99.01%), Postives = 1104/1115 (99.01%), Query Frame = 3
Query: 3840 MMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEKTTNILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFP----------LTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQNDINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFTASLRNDLNQEARATQYGITVVNEKDINADCNNNSCGRFFNFENEVEMILDNEFVEPINKP 7154
            MMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEKTTNILSDSIMLLNESGLD RVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFP          LTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMNTNETTDITNEINNVTSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQNDINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFTASLRNDLNQEARATQYGITVVNEKDINADCNNNSCGRFFNFENEVEMILDNEFVEPINKP
Sbjct:    1 MMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEKTTNILSDSIMLLNESGLDHRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMNTNETTDITNEINNVTSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQNDINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFTASLRNDLNQEARATQYGITVVNEKDINADCNNNSCGRFFNFENEVEMILDNEFVEPINKP 1115          
BLAST of Dopey_N domain-containing protein vs. Planmine SMEST
Match: SMESG000074793.1 (SMESG000074793.1)

HSP 1 Score: 2220.66 bits (5753), Expect = 0.000e+0
Identity = 1103/1114 (99.01%), Postives = 1103/1114 (99.01%), Query Frame = 3
Query: 3843 MVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEKTTNILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFP----------LTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQNDINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFTASLRNDLNQEARATQYGITVVNEKDINADCNNNSCGRFFNFENEVEMILDNEFVEPINKP 7154
            MVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEKTTNILSDSIMLLNESGLD RVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFP          LTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMNTNETTDITNEINNVTSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQNDINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFTASLRNDLNQEARATQYGITVVNEKDINADCNNNSCGRFFNFENEVEMILDNEFVEPINKP
Sbjct:    1 MVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEKTTNILSDSIMLLNESGLDHRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMNTNETTDITNEINNVTSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQNDINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFTASLRNDLNQEARATQYGITVVNEKDINADCNNNSCGRFFNFENEVEMILDNEFVEPINKP 1114          
BLAST of Dopey_N domain-containing protein vs. Planmine SMEST
Match: SMESG000074793.1 (SMESG000074793.1)

HSP 1 Score: 2204.48 bits (5711), Expect = 0.000e+0
Identity = 1097/1108 (99.01%), Postives = 1097/1108 (99.01%), Query Frame = 3
Query: 3861 MCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEKTTNILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFP----------LTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQNDINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFTASLRNDLNQEARATQYGITVVNEKDINADCNNNSCGRFFNFENEVEMILDNEFVEPINKP 7154
            MCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEKTTNILSDSIMLLNESGLD RVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFP          LTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMNTNETTDITNEINNVTSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQNDINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFTASLRNDLNQEARATQYGITVVNEKDINADCNNNSCGRFFNFENEVEMILDNEFVEPINKP
Sbjct:    1 MCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEKTTNILSDSIMLLNESGLDHRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMNTNETTDITNEINNVTSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQNDINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFTASLRNDLNQEARATQYGITVVNEKDINADCNNNSCGRFFNFENEVEMILDNEFVEPINKP 1108          
BLAST of Dopey_N domain-containing protein vs. Planmine SMEST
Match: SMESG000074794.1 (SMESG000074794.1)

HSP 1 Score: 2194.08 bits (5684), Expect = 0.000e+0
Identity = 1157/1160 (99.74%), Postives = 1159/1160 (99.91%), Query Frame = 3
Query:   21 MIEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEVTPSQFPSFQMTIDRICELVKFILIRLPIETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKIFQNASQTFDVSTLHNPVSIPTSNSTARKPSLAMYTSNLTSYNSSKVMVRTIHNFREFTRKFFVFVLDCSNDQISQCANSLFSQNTKKSRVEKLNKAEMEYNSLKLPLSVDLIVVEVYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISLPSLVXXXXXXXXXXXXXXEICEEAENSAIALEEKRIYAISNENGNVKYHLKPNSIGTQSNNSDSSQKVQPVSLIQTFEVTRKSKSSNIVKGVNSEPLRINELNSENNWSDANFNGNSKFLSSDSMESNVKVSMEKVITNVLSGKETSGNLENDSYLEDDVLHQVENSNPVDFAIDPTELCEEITESGNQEINLNDSEYTPS 3500
            MIEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGI+IRPAFVGLLQGLLPGLEEGAEFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKLCAACLAVLLRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEVTPSQFPSFQMTIDRICELVKFILIRLPIETYSDVHSRHLPDLLASLTDLLVEHVPNLGIHNIKMILQVYRMIFEKIFQNASQTFDVSTLHNPVSIPTSNSTARKPSLAMYTSNLTSYNSSKVMVRTIHNFREFTRKFFVFVLDCSNDQISQCANSLFSQNTKKSRVEKLNKAEMEYNSLKLPLSVDLIVVEVYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGSSNLNVVLSLLSETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCVLVLLDSLDHSSDSNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISLPSLVNLSSSKRSKQLSRNEICEEAENSAIALEEKRIYAISNENGNVKYHLKPNSIGTQSNNSDSSQKVQPVSLIQTFEVTRKSKSSNIVKGVNSE LRINELNSENNWSDANFNGNSKFLSSDSMESNVKVSMEKVITNVLSGKETSGNLENDSYLEDDVLHQVENSNPVDFAIDPTELCEEITESGNQEINLNDSEYTP+
Sbjct:    1 MIEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGIAIRPAFVGLLQGLLPGLEEGAEFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKLCAACLAVLLRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEVTPSQFPSFQMTIDRICELVKFILIRLPIETYSDVHSRHLPDLLASLTDLLVEHVPNLGIHNIKMILQVYRMIFEKIFQNASQTFDVSTLHNPVSIPTSNSTARKPSLAMYTSNLTSYNSSKVMVRTIHNFREFTRKFFVFVLDCSNDQISQCANSLFSQNTKKSRVEKLNKAEMEYNSLKLPLSVDLIVVEVYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGSSNLNVVLSLLSETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCVLVLLDSLDHSSDSNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISLPSLVNLSSSKRSKQLSRNEICEEAENSAIALEEKRIYAISNENGNVKYHLKPNSIGTQSNNSDSSQKVQPVSLIQTFEVTRKSKSSNIVKGVNSESLRINELNSENNWSDANFNGNSKFLSSDSMESNVKVSMEKVITNVLSGKETSGNLENDSYLEDDVLHQVENSNPVDFAIDPTELCEEITESGNQEINLNDSEYTPA 1160          
BLAST of Dopey_N domain-containing protein vs. Planmine SMEST
Match: SMESG000074794.1 (SMESG000074794.1)

HSP 1 Score: 2121.67 bits (5496), Expect = 0.000e+0
Identity = 1127/1160 (97.16%), Postives = 1129/1160 (97.33%), Query Frame = 3
Query:   21 MIEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEVTPSQFPSFQMTIDRICELVKFILIRLPIETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKIFQNASQTFDVSTLHNPVSIPTSNSTARKPSLAMYTSNLTSYNSSKVMVRTIHNFREFTRKFFVFVLDCSNDQISQCANSLFSQNTKKSRVEKLNKAEMEYNSLKLPLSVDLIVVEVYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISLPSLVXXXXXXXXXXXXXXEICEEAENSAIALEEKRIYAISNENGNVKYHLKPNSIGTQSNNSDSSQKVQPVSLIQTFEVTRKSKSSNIVKGVNSEPLRINELNSENNWSDANFNGNSKFLSSDSMESNVKVSMEKVITNVLSGKETSGNLENDSYLEDDVLHQVENSNPVDFAIDPTELCEEITESGNQEINLNDSEYTPS 3500
            MIEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGI+IRPAFVGLLQGLLPGLEEGAEFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKLCAACLAVLLRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEVTPSQFPSFQMTIDRICELVKFILIRLPIETYSDVHSRHLPDLLASLTDLLVEHVPNLGIHNIKMILQVYRMIFEKIFQNASQTFDVSTLHNPVSIPTSNSTARKPSLAMYTSNLTSYNSSKVMVRTIHNFREFTRKFFVFVLDCSNDQISQCANSLFSQNTKKSRVEKLNKAEMEYNSLKLPLSVDLIVVEVYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGSSNLNVVLSLLSETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCVLVLLDSLDHSSDSNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISLPSLVNLSSSKRSKQLSRNEICEEAENSAIALEEKRIYAISNENGNVKYHLKPNSIGTQSNNSDSSQ                               RINELNSENNWSDANFNGNSKFLSSDSMESNVKVSMEKVITNVLSGKETSGNLENDSYLEDDVLHQVENSNPVDFAIDPTELCEEITESGNQEINLNDSEYTP+
Sbjct:    1 MIEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGIAIRPAFVGLLQGLLPGLEEGAEFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKLCAACLAVLLRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEVTPSQFPSFQMTIDRICELVKFILIRLPIETYSDVHSRHLPDLLASLTDLLVEHVPNLGIHNIKMILQVYRMIFEKIFQNASQTFDVSTLHNPVSIPTSNSTARKPSLAMYTSNLTSYNSSKVMVRTIHNFREFTRKFFVFVLDCSNDQISQCANSLFSQNTKKSRVEKLNKAEMEYNSLKLPLSVDLIVVEVYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKDISPNSYNTNPSANKDVSQGSSNLNVVLSLLSETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCVLVLLDSLDHSSDSNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISLPSLVNLSSSKRSKQLSRNEICEEAENSAIALEEKRIYAISNENGNVKYHLKPNSIGTQSNNSDSSQ-------------------------------RINELNSENNWSDANFNGNSKFLSSDSMESNVKVSMEKVITNVLSGKETSGNLENDSYLEDDVLHQVENSNPVDFAIDPTELCEEITESGNQEINLNDSEYTPA 1129          
The following BLAST results are available for this feature:
BLAST of Dopey_N domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DOP1A6.161e-11026.89DOP1 leucine zipper like protein A [Source:HGNC Sy... [more]
DOP1A6.161e-11026.89DOP1 leucine zipper like protein A [Source:HGNC Sy... [more]
DOP1A1.174e-10926.89DOP1 leucine zipper like protein A [Source:HGNC Sy... [more]
DOP1B9.840e-8136.82DOP1 leucine zipper like protein B [Source:HGNC Sy... [more]
DOP1B5.313e-4751.06DOP1 leucine zipper like protein B [Source:HGNC Sy... [more]
back to top
BLAST of Dopey_N domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pad-11.672e-7324.35pep chromosome:WBcel235:I:12878595:12902806:1 gene... [more]
pad-11.672e-7324.35pep chromosome:WBcel235:I:12878639:12902806:1 gene... [more]
back to top
BLAST of Dopey_N domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG150998.590e-8536.58gene:FBgn0034400 transcript:FBtr0086628[more]
CG150991.005e-8436.58gene:FBgn0034400 transcript:FBtr0330054[more]
back to top
BLAST of Dopey_N domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dop1a1.102e-10039.70DOP1 leucine zipper like protein A [Source:ZFIN;Ac... [more]
dop1b3.537e-8634.77DOP1 leucine zipper like protein B [Source:ZFIN;Ac... [more]
dop1b1.896e-7925.64DOP1 leucine zipper like protein B [Source:ZFIN;Ac... [more]
dop1b1.549e-4853.19DOP1 leucine zipper like protein B [Source:ZFIN;Ac... [more]
dop1a1.515e-4447.16DOP1 leucine zipper like protein A [Source:ZFIN;Ac... [more]
back to top
BLAST of Dopey_N domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DOP1A3.654e-9939.49DOP1 leucine zipper like protein A [Source:HGNC Sy... [more]
DOP1A1.472e-9739.14DOP1 leucine zipper like protein A [Source:HGNC Sy... [more]
DOP1A1.558e-9739.14DOP1 leucine zipper like protein A [Source:HGNC Sy... [more]
DOP1A3.108e-9738.99DOP1 leucine zipper like protein A [Source:HGNC Sy... [more]
DOP1A1.732e-9638.48DOP1 leucine zipper like protein A [Source:HGNC Sy... [more]
back to top
BLAST of Dopey_N domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dop1a2.435e-10826.95DOP1 leucine zipper like protein A [Source:MGI Sym... [more]
Dop1a2.435e-10826.95DOP1 leucine zipper like protein A [Source:MGI Sym... [more]
Dop1a4.896e-10639.06DOP1 leucine zipper like protein A [Source:MGI Sym... [more]
Dop1a9.319e-9838.25DOP1 leucine zipper like protein A [Source:MGI Sym... [more]
Dop1b1.247e-8725.10DOP1 leucine zipper like protein B [Source:MGI Sym... [more]
back to top
BLAST of Dopey_N domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5JWR5|DOP1_HUMAN5.637e-10926.89Protein dopey-1 OS=Homo sapiens OX=9606 GN=DOP1A P... [more]
sp|Q8BL99|DOP1_MOUSE8.903e-9838.75Protein dopey-1 OS=Mus musculus OX=10090 GN=Dop1a ... [more]
sp|Q642P2|DOP2_XENLA1.126e-8625.96Protein dopey-2 OS=Xenopus laevis OX=8355 GN=dop1b... [more]
sp|A1ZBE8|DOP1_DROME8.610e-8436.58Protein dopey-1 homolog OS=Drosophila melanogaster... [more]
sp|Q292H2|DOP1_DROPS1.296e-8235.84Protein dopey-1 homolog OS=Drosophila pseudoobscur... [more]
back to top
BLAST of Dopey_N domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A131YJI60.000e+027.43Protein dopey 1 OS=Rhipicephalus appendiculatus OX... [more]
A0A131Z6B80.000e+027.71Protein dopey 1 (Fragment) OS=Rhipicephalus append... [more]
A0A4D5RTM70.000e+026.63Putative dopey (Fragment) OS=Ixodes scapularis OX=... [more]
A0A164NWD90.000e+027.40Dopey_N domain-containing protein OS=Daphnia magna... [more]
R7VE656.251e-7028.41Dopey_N domain-containing protein OS=Capitella tel... [more]
back to top
BLAST of Dopey_N domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dop1b6.718e-8236.17DOP1 leucine zipper like protein B [Source:ZFIN;Ac... [more]
dop1a2.352e-6842.07DOP1 leucine zipper like protein A [Source:ZFIN;Ac... [more]
ENSAMXT00000058128.14.509e-5256.03pep primary_assembly:Astyanax_mexicanus-2.0:17:223... [more]
ENSAMXT00000037483.17.414e-1626.53pep primary_assembly:Astyanax_mexicanus-2.0:17:223... [more]
back to top
BLAST of Dopey_N domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dopey_N domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DOP13.296e-2726.75Golgi-localized, leucine-zipper domain containing ... [more]
back to top
BLAST of Dopey_N domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO383298.294e-6938.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383284.010e-5650.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dopey_N domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dop1b6.865e-8526.32DOP1 leucine zipper like protein B [Source:NCBI ge... [more]
ENSORLT00000002497.24.577e-4647.51pep primary_assembly:ASM223467v1:16:4428243:443254... [more]
ENSORLT00000002494.24.433e-1829.29pep primary_assembly:ASM223467v1:16:4414772:442241... [more]
ENSORLT00000040938.13.161e-658.33pep primary_assembly:ASM223467v1:16:4408074:443507... [more]
back to top
BLAST of Dopey_N domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074793.10.000e+099.01SMESG000074793.1[more]
SMESG000074793.10.000e+099.01SMESG000074793.1[more]
SMESG000074793.10.000e+099.01SMESG000074793.1[more]
SMESG000074794.10.000e+099.74SMESG000074794.1[more]
SMESG000074794.10.000e+097.16SMESG000074794.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020730 ID=SMED30020730|Name=Dopey_N domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=7221bp
CTATATAAATCTTATATGAAATGATTGAAGATCAAGATTTCTCAAATGAT
AATAAATTTCGTAATTTTGCAAATCAAGTGGATAAATGTTTAAAAGGATT
CGAATATTCATCTGAATGGGCAGATTTAATAACAAATTTAGGAAAATTAA
TTAAATTATTACAAGCTAATGTTCGGTTCGGAATTATTCCCCGAAAACAA
TTAGTTGGTAAAAGATTATCTCAATGTCTTCATCCAGCATTGCCTGCTGG
TGTTCACATAAAAGCACTAGAATGCTTTGATGTTATTTTTTCCATAATTG
GACCTCGCAAATTAGCGGATGATCTATTCATTTATTGCAATGGCATATTT
CCACTTTTGTCTCCATCCGCCATGCATATAAAAACTCCGTTGTTTAATCT
ATACGAAAAATACTTTGTTACTCTAGGAATATCCATTCGCCCGGCATTCG
TTGGATTGTTACAAGGACTACTACCAGGCTTGGAAGAAGGAGCTGAATTT
TACACTAGAGGAAATAAGATATTAGAACAATTTACCGAGTCTGTAGAACC
AATTTATTTTTATACTTGTCTGTGGCAAGTAATGTTACAGGCTCCAAGCG
TACGGACATACGGAACAGCGTTTCTGTTGAACCATTTCAATCGTAGGTTA
TCAACAGATGATCAATTATATTTCTTGGGTAATAGTATTAGTTTAATGTT
GAATTCCTTGACACAAATTTTGAATGATCAACAAGTTTTAGTGCAGCGAC
AAGCTTTAGATTTTGTTTTATTTGCTCTAAGCATGCATCGCAGTCAGCTG
ACTGTTTCTGACCGTGAAAAGCTTTGCGCTGCTTGTCTTGCAGTCTTATT
GAGAAGAGACATGTCACTTAACAGAAGGTTTTATAGCTGGTTAATGGGCG
CAAATCTTGATCGGGCTAATCTTATCAAATTTGTTGTTGAAAGTGACAAT
GTTCATCAAAAGGATCTAGAAAGTTTATCCGAAAATGAATTACAATTGAG
ATATTTCAAAAAGTATTCCAGAGATATTCTGATTGCCGCTATTAAATGGA
TCATCGACAACCCAACATCTTCCGCAAGTGAACGAATTTCTTCTATTAAA
CCGTTTCGTATCATTACAACACTAATGGATCGTTCCGAAATCGGCGGTGA
CATTATTGAAGATATACTTTTCAACTTGATCGTTTACCTGGAAAAAGAAT
ACTTCATATTAGAAAAACTAACTTCTGAGGCAAATAAAACAACCAATTTC
CATCCCACTAATATTCGAGATTCCACGATTCGTGAATCGGTCAAAAGTAA
GACAAATTTACAAGAGGAATTTCTGAAAACGGCAAATTTATTTTTTGCAA
ATCTCGATAGTAGTTTCTTTTGGAACTATTTAAATAGATTGTTTGTGAAA
GCTCTGAAACAAGAAGTAACCCCATCACAATTTCCTAGCTTTCAAATGAC
AATAGACCGAATTTGTGAGCTGGTGAAATTTATTTTAATAAGGCTTCCAA
TTGAAACTTATTCGGATGTCCATAGTCGCCATTTACCAGATTTATTGGCT
AGTTTAACAGATTTGTTAGTTGAACATGTTCCCAATTTAGGGATACACAA
TATAAAGATGATTCTGCAAGTCTATCGAATGATCTTTGAAAAAATATTTC
AGAACGCATCTCAGACTTTCGATGTGAGTACCTTACACAACCCGGTATCA
ATCCCTACTTCCAATTCCACCGCAAGAAAACCATCTTTGGCCATGTACAC
TTCCAACTTAACCAGTTACAATAGTTCAAAGGTCATGGTTCGTACAATTC
ATAATTTCCGAGAGTTTACTCGTAAATTCTTTGTTTTCGTTTTGGATTGT
TCCAATGATCAGATTTCTCAATGTGCAAACAGCCTATTTTCGCAGAATAC
TAAAAAAAGTCGAGTAGAAAAGTTAAACAAAGCCGAAATGGAGTACAATA
GTCTAAAGTTGCCGTTATCTGTTGATTTAATTGTCGTAGAGGTTTATCAC
GAAATCTGTCAGCTGGTCGTTGAAATGACTTCGTATCCACTTTATTTCAA
CGTGTCAGAAAAATATGAAAGTATTACAAACTCTCAAGAAACTATGTATA
AGGTAAATAATCACGATTTACCACAATGGCTTGTTTGTCTAATCACCTCA
GCTTGCTTCATAAATGAATTTTCTATCAAATCTATTGCGATGTCAGCCTT
GTTAGATTTGATTTACGCAACTCGATTAGTCTATGGCCATAAAAACCAAC
CAATTTCAATAAAATCACAAAATATGAAAAAACATATCGCCTCCAAAGAT
ATTTCACCTAATTCATATAATACCAATCCCAGTGCAAATAAAGACGTTTC
TCAAGGGTCATCTAATCTCAATGTGGTTTTATCGCTTCTATCAGAAACAG
TTATTGAAGAATTGGACAATAAAACGAAATTTTTCACTCTTGCTGGCTTA
TCGCTATGGGATTACTTGTCATCAAATTATCCTCAATGTCACCAAGTTAC
AGTTAATCTAATAAATCGACTTCACAAAACCGCTCCATCCGCAAGCATAT
GTGAAGAATTAATTTTGCAGAAAATGCTCACTGATAACTTGGAAGAATGC
TTGGATTCGCATCGTCGATTTATTCTTTTGTGGCAATTACTGGCCAAACA
GGAAGTTTCAATATTCAATGATAACTCAAATATATCTTCACTGGGAAGCA
TGAGAACATTCGATAAATGCGTGCTGGTTCTCCTTGACAGTCTAGACCAT
TCATCAGATTCTAACCATGGGCTGGTTGTGTTGAGAACGCTGTGTATAAG
CTGGCTTGAAAAAGCATTTCAAGACGGGCATGCCCATAAAATTGTGAACC
CATTATTATTGGCATTATTAAAACCGGACACCGCTAGAATTTCCTTGCCA
AGTCTTGTCAACTTATCATCATCAAAGAGATCAAAACAGTTATCACGAAA
TGAAATTTGTGAAGAAGCTGAGAATTCTGCAATAGCCTTGGAAGAGAAAA
GAATCTATGCGATCAGTAATGAGAATGGAAATGTCAAATATCATTTGAAA
CCGAATTCAATTGGAACTCAATCAAATAACAGTGATTCTTCACAGAAAGT
TCAACCGGTATCTTTGATCCAAACCTTTGAAGTGACAAGAAAATCTAAAT
CATCAAATATAGTTAAAGGTGTTAACTCGGAACCTCTTCGTATCAATGAG
CTGAATTCAGAAAACAACTGGTCAGACGCTAATTTTAATGGGAACTCGAA
ATTTCTCTCCAGCGATTCCATGGAATCAAATGTTAAAGTATCTATGGAAA
AAGTCATTACAAATGTGCTATCTGGAAAAGAAACCTCAGGAAATCTGGAA
AACGATTCGTATTTGGAAGATGATGTGTTACACCAAGTCGAAAATTCGAA
TCCCGTGGATTTTGCAATAGACCCAACAGAATTATGTGAAGAAATAACAG
AATCCGGGAATCAAGAAATTAATTTAAATGATAGTGAATATACTCCCAGC
AACCATTATTTAATACATCCTCTCCATAGTCATATGTTGCTCTATTGTTC
CATTTATGACTCGAATGGGGTTTTATATTCTCTTTCAAAATTACGAACTA
TTTTTCGTTCTTTGCCGGGAATCGTTGTTCCAGTTTTAGAAAATTTGATA
TCTCTTGATTCTGATTCCGAAAGCAATAAATCTAATAGTAACTTACCGAA
GTCAAAGGCGTTTTATCAAAATAAAATACTGGAAATTTTGTCGAGACATT
CCAATGCTCTAAAAGGCAATAATTTTTATCAAAATCCAACATTGGAAGAG
ATACAATCCTTCAAGAGCTTCAATAATTTGGAAATAATTATGATGGTATG
TACATGGTTTATGTGTTCCTGTTATCCGGGAACAGATACCGGATTTAAAG
TCTCATTTGAAGATATATTCGAAAATAAAAAGGTTCAAATTCTCGCATCG
GAAATTTTGGATTTTATCGTACAGGAAATGTTGACAATCCTTCAAATCGG
CTACATTAACCACCGGGGTGATTTTGTAACTCAACCAAAAACTAAATTAG
AAATAAAAAATATTTTCAAAGTCTCCTTTGATCGCTGTAATGTTGCAAAA
TATGCGCTCCATTGCATGTCAACCTCAATCACTCAACCGGAAAAAACGAC
TAACATCTTATCGGATTCTATTATGTTATTAAATGAAAGTGGTCTAGATC
AAAGGGTCCGTGACGCAGCTCAAGTCAATTTGATGAGACTCGTTCTTAAT
GTTTTGAAACTTGACTATGGACTCAATACAAGTTATGTTTTATCGAATGG
GATTAAATTAAAAGATTCTGATGGAAAATCCAATAATAAAAATGATTTCA
AACTTCCATTACCTTCTGTATATAAAAACTTGTTTTCAACTCATTATACA
ACATCCAGTCCATACATAGCCGTTTCCAGACAATCTATATTGTTAACCTC
AATTGTCGCTTGTATTGGAGCTATGAAACTGCGACACCTACATTCCTATT
GCTATCAATTCATTATCAGCTCTCTTGGAGTTTGGGGCAAAAGTACTAGT
GCGGTGTTAATGCCAATTGTGAAAAAGTTGTGTAAAAATATCAGATTAGC
AGCAAATCTTTATGAATCCTGCAATCAAATCATTCCATACACAAAAGATG
TTGACTCTAATGAAATAAATACTTTGCCCTTGGATTATTCCCTGAGTACC
TTATTATGTCTGAAAGCGGTTTGTCATTTTCTGTTATTGGACGAAGCATT
AAAAAGTTATCAATTACAAGAGGAAAAAGGATCTTCATCAGAACAAAGTT
TCCTTGGAGCGTTGTTTAATAAATCAAAAGACAACACATCGAAAGAAGAC
TCCATGAGTCCTGGAACGCATATTCTTGATGCCAGGAATAAAATGATCAA
GCTGATGTCTAGATTCATAGATAGCTTGTTGATATTATGGGAAAAATCTT
CTCTATCTGAGAAAATCAACCTCAATCAAGAATGTATCCCACCAAGCTGG
ACAATGGGACGCCCAGATAAAGTCAGACAAATGATTCTAAGCATCATCAA
ACCTCTTATGCGACAACACCCTTCAATAATTCTCATTAGTCTGGCAAGAG
TTTGGCCACATCTTGACCAATTCGTTTTAGTCGATGGGAATTTTTCTCAG
TCGGATCTAATTCAAGATGTTTGTTTAAATGAAGCGTCAACATCAAATTC
TAATTTGAATTCCGAGCAATTTCGAGTCATTTGTATATTGGAATTGGCAC
GAGGTTTGAAAAAATCGTTCACAATAACGCATATAATTAACACATGCCGA
GATATTATCCGCAAATCTTTCCCTTTAACTGAAAAAGAAGAAGGACAAGT
CAAAGTTAATTTGTTGGAATTCCTTCAGTGTTTCTTGATCACCGGTTCAT
CGACGAAATTATCATTAATCAGTGGATGCTTATTCGGACTGTTAAAAGAA
AGCATATCCAGTCTCCCTCCAACCGCAGCCTTCATTCTATTAAAAATTCT
CAGTGATTTTATCAGTAAAGTTTCTATTTCCGATGAAAAAAGAGAACAAA
GAGAAATCCAAGATCTTTGTCAAAAGGTCTTAGAAAATGTTGCTTTAATC
GCAGGTTCATCTTTGGAACAACCGTCTTGGTTTAGAAGGGCAGCTCAATT
GAAATTAGATAGTGATACTGGCGATGAACGGCCAGGAAGCAACGAAATCA
ACACCGATGGCGTTATTGCTCCGATGAACACCAATGAAACTACGGATATT
ACTAATGAAATAAATAATGTTACATCCGGTCAATTAAATGGGAGTCGATT
CGGTTCAACCGCAATAGAGTTTCGAGGATCTCGTAATTCTTTACCCGCAC
TTGCTCAGAACGAATCTGCTTATAAAATGGCAACTATTAATATTAGATGT
ACACCTTCCTCGAAAACTCTGACTTTGCAAGCGTTAAATCTATTAACTAT
GCACCTTGCATCAATAATCGACGTGACATACAAAAGTGAAGAAAAAGAAA
AAGTACAACCGTTTTTGACGTCTGTGATATTCCCAAACGTTTTACCGTAT
CTGCGTTATCGAAGTTCTGGAAATCTTCTTAATTTTCGGATTTCTAGCCA
GCTAATGGCTTCCCTTAGTAGTTATCAGCACACGAGAAGATCTTGGAGGA
AAGATATTTTTGATTTGCTTTTCGAATCATATTTCTTTCAATTTGACATT
ATTTCTTTGAAATCTTGGAAGGTTATTATAGATAATCTGATGACTCAAGA
TAAAAATACTTTTAAAGAAGCTTACACCAAGTTAACTGTGAATCAAGGAG
GCGGCCTCAACCTTTTCACCAGTAAAGAAGCAGAATACGACCAAACTGCG
ATGTGCATGAAGAAATTGGCATTTATCATATACAGTAGTGAACTAGATCA
GTATGTCAAATCAATGCCTGAAATTCAAGAAAAATTGAGTGAATCATTGA
GATTAGGAATGATTCCTCAAATAGAAACTCAAATATTTCTCTGTTTTAGA
GTTTTATTAATGCGAATTTCCCATCAACATTTGACATCATTGTGGCATAT
CTTTATACCAATACTAACATCTGTCCTTCAAAATCTTATTGATGATCTCA
AATGCGATATAAAATCTATTAAACAGAATGATATCAACAAACGATTGAAT
ATGTATCTTTCAGCATGTAAACTGTTGGATATAATTTTTTTGATGAATGA
AGACAGTGTTCCACAATTTTTATATTACAAATGGGCTTTCGTCGGAAATT
TAGATGAAGAAACTAACTACTTCCGGTCAAATGATATGAATTTTCAGCCC
GTTTTTAGACCATTCTTAACGCTGGTTATAGATTCTTATATCCAATATTA
TTTGTCATTGGGCATTCCTCTAAATTCAATAGAAGTTGTGTACGAAAATT
TATACAATGAAAAACCTTTGATTTATCGTCAGTCAATTCATTCATTAACG
GATCTTGCCCCATTCTTTTTCACAGCTTCTTTAAGAAATGATCTCAATCA
AGAAGCAAGAGCTACTCAATACGGAATAACAGTTGTCAATGAAAAGGATA
TCAATGCTGATTGTAACAATAACTCTTGTGGCAGATTTTTCAATTTTGAA
AATGAAGTGGAAATGATCCTTGACAATGAATTTGTTGAACCAATAAATAA
ACCCTGATTATGATGCTGCAATTTTTCATTTTCAACTGATTTTATGCTTT
ATTTAATGTGTTAATATCGTT
back to top

protein sequence of SMED30020730-orf-1

>SMED30020730-orf-1 ID=SMED30020730-orf-1|Name=SMED30020730-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2379bp
MIEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQAN
VRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLAD
DLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVGLLQGL
LPGLEEGAEFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTA
FLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVL
FALSMHRSQLTVSDREKLCAACLAVLLRRDMSLNRRFYSWLMGANLDRAN
LIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTS
SASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKL
TSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFF
WNYLNRLFVKALKQEVTPSQFPSFQMTIDRICELVKFILIRLPIETYSDV
HSRHLPDLLASLTDLLVEHVPNLGIHNIKMILQVYRMIFEKIFQNASQTF
DVSTLHNPVSIPTSNSTARKPSLAMYTSNLTSYNSSKVMVRTIHNFREFT
RKFFVFVLDCSNDQISQCANSLFSQNTKKSRVEKLNKAEMEYNSLKLPLS
VDLIVVEVYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDL
PQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQ
NMKKHIASKDISPNSYNTNPSANKDVSQGSSNLNVVLSLLSETVIEELDN
KTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQ
KMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKC
VLVLLDSLDHSSDSNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALL
KPDTARISLPSLVNLSSSKRSKQLSRNEICEEAENSAIALEEKRIYAISN
ENGNVKYHLKPNSIGTQSNNSDSSQKVQPVSLIQTFEVTRKSKSSNIVKG
VNSEPLRINELNSENNWSDANFNGNSKFLSSDSMESNVKVSMEKVITNVL
SGKETSGNLENDSYLEDDVLHQVENSNPVDFAIDPTELCEEITESGNQEI
NLNDSEYTPSNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPG
IVVPVLENLISLDSDSESNKSNSNLPKSKAFYQNKILEILSRHSNALKGN
NFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIF
ENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFK
VSFDRCNVAKYALHCMSTSITQPEKTTNILSDSIMLLNESGLDQRVRDAA
QVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSV
YKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIIS
SLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEIN
TLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFN
KSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKIN
LNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQ
FVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSF
TITHIINTCRDIIRKSFPLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLI
SGCLFGLLKESISSLPPTAAFILLKILSDFISKVSISDEKREQREIQDLC
QKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIA
PMNTNETTDITNEINNVTSGQLNGSRFGSTAIEFRGSRNSLPALAQNESA
YKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLT
SVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLL
FESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFT
SKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQ
IETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSI
KQNDINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNY
FRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPL
IYRQSIHSLTDLAPFFFTASLRNDLNQEARATQYGITVVNEKDINADCNN
NSCGRFFNFENEVEMILDNEFVEPINKP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005829cytosol
Vocabulary: biological process
TermDefinition
GO:0006895Golgi to endosome transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000484secretory system
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR040314DOP1
IPR003582ShKT_dom
IPR007249Dopey_N
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR040314Protein dopeyPANTHERPTHR14042DOPEY-RELATEDcoord: 2..1158