Phosphodiesterase

Overview
NamePhosphodiesterase
Smed IDSMED30020724
Length (bp)2501
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphodiesterase (SMED30020724) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphodiesterase (SMED30020724) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphodiesterase (SMED30020724) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphodiesterase (SMED30020724) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020724

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30020724SMESG000058236.1 SmedASXL_015272SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30020724SMESG000058236.1 dd_Smed_v4_15988_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30020724SMESG000058236.1 dd_Smed_v4_15988_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30020724SMESG000058236.1 dd_Smed_v6_15988_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30020724SMESG000058236.1 OX_Smed_1.0.14422ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30020724SMESG000058236.1 OX_Smed_1.0.07103ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE4D (phosphodiesterase 4D [Source:HGNC Symbol;Acc:HGNC:8783])

HSP 1 Score: 467.233 bits (1201), Expect = 1.044e-153
Identity = 246/532 (46.24%), Postives = 339/532 (63.72%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILN-VKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            IVTP A +LA L  VR N   LT  +       + +  +  +N   I+E         + ++ +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL +++   ++ ++V ++I +      L++  +++I   +  +  K      QI     L+ SS +    +S  P+       F  +  Q  V   + E                      +  WGL +F    L+    L VI   I ++R L+  F I   T+I Y + +E +Y   + YHN +HAADV QS HVLLS  ALE +FT+LEILA IFA AIHDV HPGV+NQ+LIN   ELA+MYND+SVLENHHLAV F+ LQ+  C+IF +L K QR SLRK+VID+VLATDMSKHM+LL++LK MVE KK++ SGVL  ++YSDR+++LQNMVHCADLSNPTKPL LY++WT RIMEEFFRQGD+ER+  +EISPMCD+  AS+EKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:   92 IVTPFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITE---------EAYQKLASETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEFISNTF----LDKQHEVEIPSPTQKEKEKKKRPMSQISGVKKLMHSSSLT---NSSIPR-------FGVKTEQEDVLAKELED---------------------VNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQ 579          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE4D (phosphodiesterase 4D [Source:HGNC Symbol;Acc:HGNC:8783])

HSP 1 Score: 466.463 bits (1199), Expect = 1.588e-153
Identity = 246/532 (46.24%), Postives = 339/532 (63.72%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILN-VKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            IVTP A +LA L  VR N   LT  +       + +  +  +N   I+E         + ++ +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL +++   ++ ++V ++I +      L++  +++I   +  +  K      QI     L+ SS +    +S  P+       F  +  Q  V   + E                      +  WGL +F    L+    L VI   I ++R L+  F I   T+I Y + +E +Y   + YHN +HAADV QS HVLLS  ALE +FT+LEILA IFA AIHDV HPGV+NQ+LIN   ELA+MYND+SVLENHHLAV F+ LQ+  C+IF +L K QR SLRK+VID+VLATDMSKHM+LL++LK MVE KK++ SGVL  ++YSDR+++LQNMVHCADLSNPTKPL LY++WT RIMEEFFRQGD+ER+  +EISPMCD+  AS+EKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:   91 IVTPFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITE---------EAYQKLASETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEFISNTF----LDKQHEVEIPSPTQKEKEKKKRPMSQISGVKKLMHSSSLT---NSSIPR-------FGVKTEQEDVLAKELED---------------------VNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQ 578          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE4D (phosphodiesterase 4D [Source:HGNC Symbol;Acc:HGNC:8783])

HSP 1 Score: 467.233 bits (1201), Expect = 1.684e-153
Identity = 246/532 (46.24%), Postives = 339/532 (63.72%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILN-VKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            IVTP A +LA L  VR N   LT  +       + +  +  +N   I+E         + ++ +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL +++   ++ ++V ++I +      L++  +++I   +  +  K      QI     L+ SS +    +S  P+       F  +  Q  V   + E                      +  WGL +F    L+    L VI   I ++R L+  F I   T+I Y + +E +Y   + YHN +HAADV QS HVLLS  ALE +FT+LEILA IFA AIHDV HPGV+NQ+LIN   ELA+MYND+SVLENHHLAV F+ LQ+  C+IF +L K QR SLRK+VID+VLATDMSKHM+LL++LK MVE KK++ SGVL  ++YSDR+++LQNMVHCADLSNPTKPL LY++WT RIMEEFFRQGD+ER+  +EISPMCD+  AS+EKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:  112 IVTPFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITE---------EAYQKLASETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEFISNTF----LDKQHEVEIPSPTQKEKEKKKRPMSQISGVKKLMHSSSLT---NSSIPR-------FGVKTEQEDVLAKELED---------------------VNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQ 599          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE4D (phosphodiesterase 4D [Source:HGNC Symbol;Acc:HGNC:8783])

HSP 1 Score: 466.848 bits (1200), Expect = 1.798e-153
Identity = 246/532 (46.24%), Postives = 339/532 (63.72%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILN-VKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            IVTP A +LA L  VR N   LT  +       + +  +  +N   I+E         + ++ +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL +++   ++ ++V ++I +      L++  +++I   +  +  K      QI     L+ SS +    +S  P+       F  +  Q  V   + E                      +  WGL +F    L+    L VI   I ++R L+  F I   T+I Y + +E +Y   + YHN +HAADV QS HVLLS  ALE +FT+LEILA IFA AIHDV HPGV+NQ+LIN   ELA+MYND+SVLENHHLAV F+ LQ+  C+IF +L K QR SLRK+VID+VLATDMSKHM+LL++LK MVE KK++ SGVL  ++YSDR+++LQNMVHCADLSNPTKPL LY++WT RIMEEFFRQGD+ER+  +EISPMCD+  AS+EKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:  100 IVTPFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITE---------EAYQKLASETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEFISNTF----LDKQHEVEIPSPTQKEKEKKKRPMSQISGVKKLMHSSSLT---NSSIPR-------FGVKTEQEDVLAKELED---------------------VNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQ 587          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE4D (phosphodiesterase 4D [Source:HGNC Symbol;Acc:HGNC:8783])

HSP 1 Score: 466.463 bits (1199), Expect = 1.821e-153
Identity = 246/532 (46.24%), Postives = 339/532 (63.72%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILN-VKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            IVTP A +LA L  VR N   LT  +       + +  +  +N   I+E         + ++ +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL +++   ++ ++V ++I +      L++  +++I   +  +  K      QI     L+ SS +    +S  P+       F  +  Q  V   + E                      +  WGL +F    L+    L VI   I ++R L+  F I   T+I Y + +E +Y   + YHN +HAADV QS HVLLS  ALE +FT+LEILA IFA AIHDV HPGV+NQ+LIN   ELA+MYND+SVLENHHLAV F+ LQ+  C+IF +L K QR SLRK+VID+VLATDMSKHM+LL++LK MVE KK++ SGVL  ++YSDR+++LQNMVHCADLSNPTKPL LY++WT RIMEEFFRQGD+ER+  +EISPMCD+  AS+EKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:   86 IVTPFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITE---------EAYQKLASETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEFISNTF----LDKQHEVEIPSPTQKEKEKKKRPMSQISGVKKLMHSSSLT---NSSIPR-------FGVKTEQEDVLAKELED---------------------VNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQ 573          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-4 (Probable 3',5'-cyclic phosphodiesterase pde-4 [Source:UniProtKB/Swiss-Prot;Acc:Q22000])

HSP 1 Score: 460.685 bits (1184), Expect = 1.875e-153
Identity = 247/566 (43.64%), Postives = 365/566 (64.49%), Query Frame = 3
Query:  576 MTISPINS--RGYPRRHSMSVCT-KVSESSIVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKK--ILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDY-IKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSS--QISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            M+IS IN+  R   R+   S  T +  +  IVTP A +LA L  VR N++++T  ++S+     N   K+  + N+++ +D++  +H          ++LEEL+WCL QL  +QT +SV +++  KF+++L++EL + A   K+ ++V  + I ++++  + E S+++++               P     P   G   + + K +++  M    NK S   ++  PS   HD  +    G+    +I ++      L  WG  +F+ D L+  HSL V+T  +L +R L   F I   T++ Y L +E +Y R+  YHN +HAADV QS+HVLL +  L ++FT+LE+LA IFA A+HDV HPG TNQYLIN  +ELAIMYND SVLE HHLAVAF+ LQ   C+  A+L++ QR   RKIVID+VLATDMSKHMSLL++LK MVE KK++G+ V+  + Y+D++++LQ+M+H ADLSNPTKP+ LYQ+W QRIMEE++RQGDKE++  +EISPMCDR   +IEKSQV FID+IV PL+ TWA+LVYP+AQ +L+ LE N++WYQ
Sbjct:    1 MSISLINNNNRSVRRKFGESGFTLRHGDDLIVTPFAQLLASLRNVRSNLISITNIQNSDDSRHANRSAKRPPLHNIELPDDVVHCAH----------DTLEELDWCLDQLETIQTHRSVSEMASSKFRKMLNKELSHFAESSKSGTQVSKFLITTYMDKEEDEPSIEIEV---------------PTEVQGPSTSGPMTLSILKKAQTAAM----NKISGVRKLRAPS---HDGHV-PEYGVNCAREIAVHM---QRLDDWGPDVFKIDELSKNHSLTVVTFSLLRQRNLFKTFEIHQSTLVTYLLNLEHHY-RNNHYHNFIHAADVAQSMHVLLMSPVLTEVFTDLEVLAAIFAGAVHDVDHPGFTNQYLINSNNELAIMYNDESVLEQHHLAVAFKLLQDSNCDFLANLSRKQRLQFRKIVIDMVLATDMSKHMSLLADLKTMVEAKKVAGNNVIVLDKYNDKIQVLQSMIHLADLSNPTKPIELYQQWNQRIMEEYWRQGDKEKELGLEISPMCDRGNVTIEKSQVGFIDYIVHPLYETWADLVYPDAQNILDQLEENREWYQ 529          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-4 (Probable 3',5'-cyclic phosphodiesterase pde-4 [Source:UniProtKB/Swiss-Prot;Acc:Q22000])

HSP 1 Score: 458.759 bits (1179), Expect = 6.259e-152
Identity = 238/539 (44.16%), Postives = 353/539 (65.49%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKK--ILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDY-IKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSS--QISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQFQL 2258
            IVTP A +LA L  VR N++++T  ++S+     N   K+  + N+++ +D++  +H          ++LEEL+WCL QL  +QT +SV +++  KF+++L++EL + A   K+ ++V  + I ++++  + E S+++++               P     P   G   + + K +++  M    NK S   ++  PS   HD  +    G+    +I ++      L  WG  +F+ D L+  HSL V+T  +L +R L   F I   T++ Y L +E +Y R+  YHN +HAADV QS+HVLL +  L ++FT+LE+LA IFA A+HDV HPG TNQYLIN  +ELAIMYND SVLE HHLAVAF+ LQ   C+  A+L++ QR   RKIVID+VLATDMSKHMSLL++LK MVE KK++G+ V+  + Y+D++++LQ+M+H ADLSNPTKP+ LYQ+W QRIMEE++RQGDKE++  +EISPMCDR   +IEKSQV FID+IV PL+ TWA+LVYP+AQ +L+ LE N++WYQ ++
Sbjct:   81 IVTPFAQLLASLRNVRSNLISITNIQNSDDSRHANRSAKRPPLHNIELPDDVVHCAH----------DTLEELDWCLDQLETIQTHRSVSEMASSKFRKMLNKELSHFAESSKSGTQVSKFLITTYMDKEEDEPSIEIEV---------------PTEVQGPSTSGPMTLSILKKAQTAAM----NKISGVRKLRAPS---HDGHV-PEYGVNCAREIAVHM---QRLDDWGPDVFKIDELSKNHSLTVVTFSLLRQRNLFKTFEIHQSTLVTYLLNLEHHY-RNNHYHNFIHAADVAQSMHVLLMSPVLTEVFTDLEVLAAIFAGAVHDVDHPGFTNQYLINSNNELAIMYNDESVLEQHHLAVAFKLLQDSNCDFLANLSRKQRLQFRKIVIDMVLATDMSKHMSLLADLKTMVEAKKVAGNNVIVLDKYNDKIQVLQSMIHLADLSNPTKPIELYQQWNQRIMEEYWRQGDKEKELGLEISPMCDRGNVTIEKSQVGFIDYIVHPLYETWADLVYPDAQNILDQLEENREWYQSRI 582          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-4 (Probable 3',5'-cyclic phosphodiesterase pde-4 [Source:UniProtKB/Swiss-Prot;Acc:Q22000])

HSP 1 Score: 459.144 bits (1180), Expect = 6.341e-152
Identity = 238/539 (44.16%), Postives = 353/539 (65.49%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKK--ILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDY-IKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSS--QISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQFQL 2258
            IVTP A +LA L  VR N++++T  ++S+     N   K+  + N+++ +D++  +H          ++LEEL+WCL QL  +QT +SV +++  KF+++L++EL + A   K+ ++V  + I ++++  + E S+++++               P     P   G   + + K +++  M    NK S   ++  PS   HD  +    G+    +I ++      L  WG  +F+ D L+  HSL V+T  +L +R L   F I   T++ Y L +E +Y R+  YHN +HAADV QS+HVLL +  L ++FT+LE+LA IFA A+HDV HPG TNQYLIN  +ELAIMYND SVLE HHLAVAF+ LQ   C+  A+L++ QR   RKIVID+VLATDMSKHMSLL++LK MVE KK++G+ V+  + Y+D++++LQ+M+H ADLSNPTKP+ LYQ+W QRIMEE++RQGDKE++  +EISPMCDR   +IEKSQV FID+IV PL+ TWA+LVYP+AQ +L+ LE N++WYQ ++
Sbjct:   94 IVTPFAQLLASLRNVRSNLISITNIQNSDDSRHANRSAKRPPLHNIELPDDVVHCAH----------DTLEELDWCLDQLETIQTHRSVSEMASSKFRKMLNKELSHFAESSKSGTQVSKFLITTYMDKEEDEPSIEIEV---------------PTEVQGPSTSGPMTLSILKKAQTAAM----NKISGVRKLRAPS---HDGHV-PEYGVNCAREIAVHM---QRLDDWGPDVFKIDELSKNHSLTVVTFSLLRQRNLFKTFEIHQSTLVTYLLNLEHHY-RNNHYHNFIHAADVAQSMHVLLMSPVLTEVFTDLEVLAAIFAGAVHDVDHPGFTNQYLINSNNELAIMYNDESVLEQHHLAVAFKLLQDSNCDFLANLSRKQRLQFRKIVIDMVLATDMSKHMSLLADLKTMVEAKKVAGNNVIVLDKYNDKIQVLQSMIHLADLSNPTKPIELYQQWNQRIMEEYWRQGDKEKELGLEISPMCDRGNVTIEKSQVGFIDYIVHPLYETWADLVYPDAQNILDQLEENREWYQSRI 595          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-4 (Probable 3',5'-cyclic phosphodiesterase pde-4 [Source:UniProtKB/Swiss-Prot;Acc:Q22000])

HSP 1 Score: 459.144 bits (1180), Expect = 8.034e-152
Identity = 238/539 (44.16%), Postives = 353/539 (65.49%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKK--ILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDY-IKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSS--QISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQFQL 2258
            IVTP A +LA L  VR N++++T  ++S+     N   K+  + N+++ +D++  +H          ++LEEL+WCL QL  +QT +SV +++  KF+++L++EL + A   K+ ++V  + I ++++  + E S+++++               P     P   G   + + K +++  M    NK S   ++  PS   HD  +    G+    +I ++      L  WG  +F+ D L+  HSL V+T  +L +R L   F I   T++ Y L +E +Y R+  YHN +HAADV QS+HVLL +  L ++FT+LE+LA IFA A+HDV HPG TNQYLIN  +ELAIMYND SVLE HHLAVAF+ LQ   C+  A+L++ QR   RKIVID+VLATDMSKHMSLL++LK MVE KK++G+ V+  + Y+D++++LQ+M+H ADLSNPTKP+ LYQ+W QRIMEE++RQGDKE++  +EISPMCDR   +IEKSQV FID+IV PL+ TWA+LVYP+AQ +L+ LE N++WYQ ++
Sbjct:  106 IVTPFAQLLASLRNVRSNLISITNIQNSDDSRHANRSAKRPPLHNIELPDDVVHCAH----------DTLEELDWCLDQLETIQTHRSVSEMASSKFRKMLNKELSHFAESSKSGTQVSKFLITTYMDKEEDEPSIEIEV---------------PTEVQGPSTSGPMTLSILKKAQTAAM----NKISGVRKLRAPS---HDGHV-PEYGVNCAREIAVHM---QRLDDWGPDVFKIDELSKNHSLTVVTFSLLRQRNLFKTFEIHQSTLVTYLLNLEHHY-RNNHYHNFIHAADVAQSMHVLLMSPVLTEVFTDLEVLAAIFAGAVHDVDHPGFTNQYLINSNNELAIMYNDESVLEQHHLAVAFKLLQDSNCDFLANLSRKQRLQFRKIVIDMVLATDMSKHMSLLADLKTMVEAKKVAGNNVIVLDKYNDKIQVLQSMIHLADLSNPTKPIELYQQWNQRIMEEYWRQGDKEKELGLEISPMCDRGNVTIEKSQVGFIDYIVHPLYETWADLVYPDAQNILDQLEENREWYQSRI 607          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-4 (Probable 3',5'-cyclic phosphodiesterase pde-4 [Source:UniProtKB/Swiss-Prot;Acc:Q22000])

HSP 1 Score: 459.144 bits (1180), Expect = 1.049e-151
Identity = 238/539 (44.16%), Postives = 353/539 (65.49%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKK--ILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDY-IKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSS--QISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQFQL 2258
            IVTP A +LA L  VR N++++T  ++S+     N   K+  + N+++ +D++  +H          ++LEEL+WCL QL  +QT +SV +++  KF+++L++EL + A   K+ ++V  + I ++++  + E S+++++               P     P   G   + + K +++  M    NK S   ++  PS   HD  +    G+    +I ++      L  WG  +F+ D L+  HSL V+T  +L +R L   F I   T++ Y L +E +Y R+  YHN +HAADV QS+HVLL +  L ++FT+LE+LA IFA A+HDV HPG TNQYLIN  +ELAIMYND SVLE HHLAVAF+ LQ   C+  A+L++ QR   RKIVID+VLATDMSKHMSLL++LK MVE KK++G+ V+  + Y+D++++LQ+M+H ADLSNPTKP+ LYQ+W QRIMEE++RQGDKE++  +EISPMCDR   +IEKSQV FID+IV PL+ TWA+LVYP+AQ +L+ LE N++WYQ ++
Sbjct:  108 IVTPFAQLLASLRNVRSNLISITNIQNSDDSRHANRSAKRPPLHNIELPDDVVHCAH----------DTLEELDWCLDQLETIQTHRSVSEMASSKFRKMLNKELSHFAESSKSGTQVSKFLITTYMDKEEDEPSIEIEV---------------PTEVQGPSTSGPMTLSILKKAQTAAM----NKISGVRKLRAPS---HDGHV-PEYGVNCAREIAVHM---QRLDDWGPDVFKIDELSKNHSLTVVTFSLLRQRNLFKTFEIHQSTLVTYLLNLEHHY-RNNHYHNFIHAADVAQSMHVLLMSPVLTEVFTDLEVLAAIFAGAVHDVDHPGFTNQYLINSNNELAIMYNDESVLEQHHLAVAFKLLQDSNCDFLANLSRKQRLQFRKIVIDMVLATDMSKHMSLLADLKTMVEAKKVAGNNVIVLDKYNDKIQVLQSMIHLADLSNPTKPIELYQQWNQRIMEEYWRQGDKEKELGLEISPMCDRGNVTIEKSQVGFIDYIVHPLYETWADLVYPDAQNILDQLEENREWYQSRI 609          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: dnc (gene:FBgn0000479 transcript:FBtr0070518)

HSP 1 Score: 455.292 bits (1170), Expect = 6.143e-150
Identity = 240/544 (44.12%), Postives = 344/544 (63.24%), Query Frame = 3
Query:  645 SESSIVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYI-KSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLH-----DHEIYRNLGICPKNDIKINNTLDSFLG---SWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
             E  IVTP A ILA L  VR N+++LT   +SN+    N       +       +  S  ++ +  +A +++EEL+WCL QL  +QT +SV D++  KFK +L++EL + +   ++ +++ +YI  +FL+  Q     + D+  + V       +  P++ +     G         S SP+   +     SQIS     L        E     G+    +    N L + LG   +WG+QIF     +    L  +   I + R+L++   I P T + +   +E +Y +  P+HN++HAADVTQS +VLL+  ALE +FT LE+   +FA  IHDV HPG+TNQ+L+N   ELA+MYND SVLENHHLAVAF+ LQ  GC+IF ++ K QR +LRK+VID+VL+TDMSKHMSLL++LK MVE KK++GSGVL  ++Y+DR+++L+N+VHCADLSNPTKPL LY+ W   +MEEFF QGDKER+S ++ISPMCDR  A+IEKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N+D+YQ
Sbjct:   31 GEDLIVTPFAQILASLRSVRNNLLSLTNVPASNKSRRPNQSSSASRSGNPPGAPL--SQGEEAYTRLATDTIEELDWCLDQLETIQTHRSVSDMASLKFKRMLNKELSHFSESSRSGNQISEYICSTFLDKQQ-----EFDLPSLRV-------EDNPELVAANAAAGQQSAGQYARSRSPRGPPM-----SQISGVKRPLSHTNSFTGERLPTFGV----ETPRENELGTLLGELDTWGIQIFSIGEFSVNRPLTCVAYTIFQSRELLTSLMIPPKTFLNFMSTLEDHYVKDNPFHNSLHAADVTQSTNVLLNTPALEGVFTPLEVGGALFAACIHDVDHPGLTNQFLVNSSSELALMYNDESVLENHHLAVAFKLLQNQGCDIFCNMQKKQRQTLRKMVIDIVLSTDMSKHMSLLADLKTMVETKKVAGSGVLLLDNYTDRIQVLENLVHCADLSNPTKPLPLYKRWVALLMEEFFLQGDKERESGMDISPMCDRHNATIEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEENRDYYQ 551          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: dnc (gene:FBgn0000479 transcript:FBtr0333312)

HSP 1 Score: 455.292 bits (1170), Expect = 6.143e-150
Identity = 240/544 (44.12%), Postives = 344/544 (63.24%), Query Frame = 3
Query:  645 SESSIVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYI-KSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLH-----DHEIYRNLGICPKNDIKINNTLDSFLG---SWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
             E  IVTP A ILA L  VR N+++LT   +SN+    N       +       +  S  ++ +  +A +++EEL+WCL QL  +QT +SV D++  KFK +L++EL + +   ++ +++ +YI  +FL+  Q     + D+  + V       +  P++ +     G         S SP+   +     SQIS     L        E     G+    +    N L + LG   +WG+QIF     +    L  +   I + R+L++   I P T + +   +E +Y +  P+HN++HAADVTQS +VLL+  ALE +FT LE+   +FA  IHDV HPG+TNQ+L+N   ELA+MYND SVLENHHLAVAF+ LQ  GC+IF ++ K QR +LRK+VID+VL+TDMSKHMSLL++LK MVE KK++GSGVL  ++Y+DR+++L+N+VHCADLSNPTKPL LY+ W   +MEEFF QGDKER+S ++ISPMCDR  A+IEKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N+D+YQ
Sbjct:   31 GEDLIVTPFAQILASLRSVRNNLLSLTNVPASNKSRRPNQSSSASRSGNPPGAPL--SQGEEAYTRLATDTIEELDWCLDQLETIQTHRSVSDMASLKFKRMLNKELSHFSESSRSGNQISEYICSTFLDKQQ-----EFDLPSLRV-------EDNPELVAANAAAGQQSAGQYARSRSPRGPPM-----SQISGVKRPLSHTNSFTGERLPTFGV----ETPRENELGTLLGELDTWGIQIFSIGEFSVNRPLTCVAYTIFQSRELLTSLMIPPKTFLNFMSTLEDHYVKDNPFHNSLHAADVTQSTNVLLNTPALEGVFTPLEVGGALFAACIHDVDHPGLTNQFLVNSSSELALMYNDESVLENHHLAVAFKLLQNQGCDIFCNMQKKQRQTLRKMVIDIVLSTDMSKHMSLLADLKTMVETKKVAGSGVLLLDNYTDRIQVLENLVHCADLSNPTKPLPLYKRWVALLMEEFFLQGDKERESGMDISPMCDRHNATIEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEENRDYYQ 551          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: dnc (gene:FBgn0000479 transcript:FBtr0070521)

HSP 1 Score: 455.292 bits (1170), Expect = 1.052e-149
Identity = 240/544 (44.12%), Postives = 344/544 (63.24%), Query Frame = 3
Query:  645 SESSIVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYI-KSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCL-----HDHEIYRNLGICPKNDIKINNTLDSFLG---SWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
             E  IVTP A ILA L  VR N+++LT   +SN+    N       +       +  S  ++ +  +A +++EEL+WCL QL  +QT +SV D++  KFK +L++EL + +   ++ +++ +YI  +FL+  Q     + D+  + V       +  P++ +     G         S SP+   +     SQIS     L        E     G+    +    N L + LG   +WG+QIF     +    L  +   I + R+L++   I P T + +   +E +Y +  P+HN++HAADVTQS +VLL+  ALE +FT LE+   +FA  IHDV HPG+TNQ+L+N   ELA+MYND SVLENHHLAVAF+ LQ  GC+IF ++ K QR +LRK+VID+VL+TDMSKHMSLL++LK MVE KK++GSGVL  ++Y+DR+++L+N+VHCADLSNPTKPL LY+ W   +MEEFF QGDKER+S ++ISPMCDR  A+IEKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N+D+YQ
Sbjct:   51 GEDLIVTPFAQILASLRSVRNNLLSLTNVPASNKSRRPNQSSSASRSGNPPGAPL--SQGEEAYTRLATDTIEELDWCLDQLETIQTHRSVSDMASLKFKRMLNKELSHFSESSRSGNQISEYICSTFLDKQQ-----EFDLPSLRV-------EDNPELVAANAAAGQQSAGQYARSRSPRGPPM-----SQISGVKRPLSHTNSFTGERLPTFGV----ETPRENELGTLLGELDTWGIQIFSIGEFSVNRPLTCVAYTIFQSRELLTSLMIPPKTFLNFMSTLEDHYVKDNPFHNSLHAADVTQSTNVLLNTPALEGVFTPLEVGGALFAACIHDVDHPGLTNQFLVNSSSELALMYNDESVLENHHLAVAFKLLQNQGCDIFCNMQKKQRQTLRKMVIDIVLSTDMSKHMSLLADLKTMVETKKVAGSGVLLLDNYTDRIQVLENLVHCADLSNPTKPLPLYKRWVALLMEEFFLQGDKERESGMDISPMCDRHNATIEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEENRDYYQ 571          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: dnc (gene:FBgn0000479 transcript:FBtr0070517)

HSP 1 Score: 455.292 bits (1170), Expect = 3.917e-149
Identity = 240/544 (44.12%), Postives = 344/544 (63.24%), Query Frame = 3
Query:  645 SESSIVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYI-KSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLH-----DHEIYRNLGICPKNDIKINNTLDSFLG---SWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
             E  IVTP A ILA L  VR N+++LT   +SN+    N       +       +  S  ++ +  +A +++EEL+WCL QL  +QT +SV D++  KFK +L++EL + +   ++ +++ +YI  +FL+  Q     + D+  + V       +  P++ +     G         S SP+   +     SQIS     L        E     G+    +    N L + LG   +WG+QIF     +    L  +   I + R+L++   I P T + +   +E +Y +  P+HN++HAADVTQS +VLL+  ALE +FT LE+   +FA  IHDV HPG+TNQ+L+N   ELA+MYND SVLENHHLAVAF+ LQ  GC+IF ++ K QR +LRK+VID+VL+TDMSKHMSLL++LK MVE KK++GSGVL  ++Y+DR+++L+N+VHCADLSNPTKPL LY+ W   +MEEFF QGDKER+S ++ISPMCDR  A+IEKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N+D+YQ
Sbjct:   90 GEDLIVTPFAQILASLRSVRNNLLSLTNVPASNKSRRPNQSSSASRSGNPPGAPL--SQGEEAYTRLATDTIEELDWCLDQLETIQTHRSVSDMASLKFKRMLNKELSHFSESSRSGNQISEYICSTFLDKQQ-----EFDLPSLRV-------EDNPELVAANAAAGQQSAGQYARSRSPRGPPM-----SQISGVKRPLSHTNSFTGERLPTFGV----ETPRENELGTLLGELDTWGIQIFSIGEFSVNRPLTCVAYTIFQSRELLTSLMIPPKTFLNFMSTLEDHYVKDNPFHNSLHAADVTQSTNVLLNTPALEGVFTPLEVGGALFAACIHDVDHPGLTNQFLVNSSSELALMYNDESVLENHHLAVAFKLLQNQGCDIFCNMQKKQRQTLRKMVIDIVLSTDMSKHMSLLADLKTMVETKKVAGSGVLLLDNYTDRIQVLENLVHCADLSNPTKPLPLYKRWVALLMEEFFLQGDKERESGMDISPMCDRHNATIEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEENRDYYQ 610          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: dnc (gene:FBgn0000479 transcript:FBtr0333317)

HSP 1 Score: 455.677 bits (1171), Expect = 4.124e-149
Identity = 240/544 (44.12%), Postives = 344/544 (63.24%), Query Frame = 3
Query:  645 SESSIVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYI-KSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLH-----DHEIYRNLGICPKNDIKINNTLDSFLG---SWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
             E  IVTP A ILA L  VR N+++LT   +SN+    N       +       +  S  ++ +  +A +++EEL+WCL QL  +QT +SV D++  KFK +L++EL + +   ++ +++ +YI  +FL+  Q     + D+  + V       +  P++ +     G         S SP+   +     SQIS     L        E     G+    +    N L + LG   +WG+QIF     +    L  +   I + R+L++   I P T + +   +E +Y +  P+HN++HAADVTQS +VLL+  ALE +FT LE+   +FA  IHDV HPG+TNQ+L+N   ELA+MYND SVLENHHLAVAF+ LQ  GC+IF ++ K QR +LRK+VID+VL+TDMSKHMSLL++LK MVE KK++GSGVL  ++Y+DR+++L+N+VHCADLSNPTKPL LY+ W   +MEEFF QGDKER+S ++ISPMCDR  A+IEKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N+D+YQ
Sbjct:  104 GEDLIVTPFAQILASLRSVRNNLLSLTNVPASNKSRRPNQSSSASRSGNPPGAPL--SQGEEAYTRLATDTIEELDWCLDQLETIQTHRSVSDMASLKFKRMLNKELSHFSESSRSGNQISEYICSTFLDKQQ-----EFDLPSLRV-------EDNPELVAANAAAGQQSAGQYARSRSPRGPPM-----SQISGVKRPLSHTNSFTGERLPTFGV----ETPRENELGTLLGELDTWGIQIFSIGEFSVNRPLTCVAYTIFQSRELLTSLMIPPKTFLNFMSTLEDHYVKDNPFHNSLHAADVTQSTNVLLNTPALEGVFTPLEVGGALFAACIHDVDHPGLTNQFLVNSSSELALMYNDESVLENHHLAVAFKLLQNQGCDIFCNMQKKQRQTLRKMVIDIVLSTDMSKHMSLLADLKTMVETKKVAGSGVLLLDNYTDRIQVLENLVHCADLSNPTKPLPLYKRWVALLMEEFFLQGDKERESGMDISPMCDRHNATIEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEENRDYYQ 624          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde4d (phosphodiesterase 4D, cAMP-specific [Source:ZFIN;Acc:ZDB-GENE-081105-16])

HSP 1 Score: 471.47 bits (1212), Expect = 1.022e-155
Identity = 252/539 (46.75%), Postives = 343/539 (63.64%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLTGT---RSSNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKS-FLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRN----LGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            IVTP A +LA L  VR N   LT     RS+N+ +        + N      I  +S+ ++ ++ +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL +++   ++ ++V +YI S FL+                     +N    P   SQ            KD E  K      +  SQIS      H   +  +     G+  + + ++   L+  +  WGL +F+    +    L V+   I ++R L+  F I   T I Y + +E +Y   + YHN +HAADVTQS HVLLS  ALE +FT+LEILA IFA AIHDV HPGV+NQ+LIN   ELA+MYND+SVLENHHLAV F+ LQ+  C+IF +L K QR SLRK+VID+VLATDMSKHM+LL++LK MVE KK++ SGVL  ++YSDR+++LQNMVHCADLSNPTKPL LY++WT RIMEEFF QGD+ER+  +EISPMCD+  AS+EKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:   71 IVTPFAQVLASLRTVRNNFAALTNVQQERSNNKRS-------PMCN---PPPITKTSYTEEAYQKLATETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISSTFLDK--------------------QNEVEMPSPQSQ------------KDKEKKK------RPMSQISGVKKLTHSSSLTNSNIPRFGVKTETEDELAKELED-VNKWGLNVFKVSEFSGNRPLTVMMYTIFQERDLLKTFKIPLDTFITYLMTLEDHYHADVAYHNNIHAADVTQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFSQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQ 560          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde4d (phosphodiesterase 4D, cAMP-specific [Source:ZFIN;Acc:ZDB-GENE-081105-16])

HSP 1 Score: 472.241 bits (1214), Expect = 1.557e-155
Identity = 252/539 (46.75%), Postives = 343/539 (63.64%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLTGT---RSSNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKS-FLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRN----LGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            IVTP A +LA L  VR N   LT     RS+N+ +        + N      I  +S+ ++ ++ +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL +++   ++ ++V +YI S FL+                     +N    P   SQ            KD E  K      +  SQIS      H   +  +     G+  + + ++   L+  +  WGL +F+    +    L V+   I ++R L+  F I   T I Y + +E +Y   + YHN +HAADVTQS HVLLS  ALE +FT+LEILA IFA AIHDV HPGV+NQ+LIN   ELA+MYND+SVLENHHLAV F+ LQ+  C+IF +L K QR SLRK+VID+VLATDMSKHM+LL++LK MVE KK++ SGVL  ++YSDR+++LQNMVHCADLSNPTKPL LY++WT RIMEEFF QGD+ER+  +EISPMCD+  AS+EKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:   90 IVTPFAQVLASLRTVRNNFAALTNVQQERSNNKRS-------PMCN---PPPITKTSYTEEAYQKLATETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISSTFLDK--------------------QNEVEMPSPQSQ------------KDKEKKK------RPMSQISGVKKLTHSSSLTNSNIPRFGVKTETEDELAKELED-VNKWGLNVFKVSEFSGNRPLTVMMYTIFQERDLLKTFKIPLDTFITYLMTLEDHYHADVAYHNNIHAADVTQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFSQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQ 579          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: BX510928.2 (phosphodiesterase 4D, cAMP-specific [Source:NCBI gene;Acc:566998])

HSP 1 Score: 469.929 bits (1208), Expect = 8.034e-155
Identity = 251/539 (46.57%), Postives = 340/539 (63.08%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLTGT---RSSNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKS-FLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRN----LGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            IVTP A +LA L  VR N   LT     RS+N+                S+ +  S   ++ ++ +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL +++   ++ ++V +YI S FL+                     +N    P   SQ            KD E  K      +  SQIS      H   +  +     G+  + + ++   L+  +  WGL +F+    +    L V+   I ++R L+  F I   T I Y + +E +Y   + YHN +HAADVTQS HVLLS  ALE +FT+LEILA IFA AIHDV HPGV+NQ+LIN   ELA+MYND+SVLENHHLAV F+ LQ+  C+IF +L K QR SLRK+VID+VLATDMSKHM+LL++LK MVE KK++ SGVL  ++YSDR+++LQNMVHCADLSNPTKPL LY++WT RIMEEFF QGD+ER+  +EISPMCD+  AS+EKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:   90 IVTPFAQVLASLRTVRNNFAALTNVQQERSNNK----------------SDRLPPSLPPEEAYQKLATETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISSTFLDK--------------------QNEVEMPSPQSQ------------KDKEKKK------RPMSQISGVKKLTHSSSLTNSNIPRFGVKTETEDELAKELED-VNKWGLNVFKVSEFSGNRPLTVMMYTIFQERDLLKTFKIPLDTFITYLMTLEDHYHADVAYHNNIHAADVTQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFSQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQ 573          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde4ca (phosphodiesterase 4C, cAMP-specific a [Source:ZFIN;Acc:ZDB-GENE-070912-373])

HSP 1 Score: 463.766 bits (1192), Expect = 4.799e-152
Identity = 254/548 (46.35%), Postives = 337/548 (61.50%), Query Frame = 3
Query:  615 RHSMSVCTKVSESSIVTPLAIILARLGRVRQNIMTLTGTRS---SNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            R+S +      E  IVTP A +LA L  VR N   LT  +    S + T  N              +  +S  ++ ++ +A E+L+EL+WCL QL  ++T+ SV +++  KFK +L+ EL  ++   K+ ++V +YI S      LE+   MDI  MS     K     P           SQI           V  P   SS I+  S+           G+    +  +   L+ F   WG+ +F+    +    L V      ++R L+  F I   T I Y   +E NY   + YHN++HAADV QS HVLLS  ALE +FT+LEILA +FA AIHDV HPGV+NQ+LIN   ELA+MYND+SVLENHHLAV F+ LQ+  C+IF +L K QR SLRK+VID+VLATDMSKHM+LL++LK MVE KK++  GVL  ++YSDR+++LQNMVHCADLSNPTKPL LY++WT RIM EFF QGD+ERD  +EISPMCD+  ASIEKSQV FID+IV PLW TWA+LV+P+AQE+L+TLE N++WYQ
Sbjct:  101 RNSSTASELHGEDMIVTPFAQVLASLRTVRSNFAVLTHQQDRVPSKKSTGNN-----------PPSMCKTSLPEEPFQKLAVETLDELDWCLEQLETLKTRHSVSEMASNKFKRMLNRELTQLSETSKSGNQVSEYISSTF----LEKQHDMDI--MSTPSKEKEKKKRPM----------SQI---------SGVKKPTH-SSNIAPSSIP--------RFGVSTNREDLLAKELEDF-DRWGVDMFKISECSGNRPLTVAMYTTFQERDLLKSFKIPVDTFINYMTALEENYRSDVAYHNSIHAADVVQSTHVLLSTPALEAVFTDLEILAAMFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDMVLATDMSKHMNLLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLELYRQWTDRIMVEFFTQGDRERDKGMEISPMCDKHNASIEKSQVGFIDYIVHPLWETWADLVHPDAQEILDTLEDNREWYQ 602          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde4ca (phosphodiesterase 4C, cAMP-specific a [Source:ZFIN;Acc:ZDB-GENE-070912-373])

HSP 1 Score: 462.611 bits (1189), Expect = 5.381e-152
Identity = 255/548 (46.53%), Postives = 336/548 (61.31%), Query Frame = 3
Query:  615 RHSMSVCTKVSESSIVTPLAIILARLGRVRQNIMTLTGTRS---SNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            R+S +      E  IVTP A +LA L  VR N   LT  +    SN     NV+L                  ++ ++ +A E+L+EL+WCL QL  ++T+ SV +++  KFK +L+ EL  ++   K+ ++V +YI S      LE+   MDI  MS     K     P           SQI           V  P   SS I+  S+           G+    +  +   L+ F   WG+ +F+    +    L V      ++R L+  F I   T I Y   +E NY   + YHN++HAADV QS HVLLS  ALE +FT+LEILA +FA AIHDV HPGV+NQ+LIN   ELA+MYND+SVLENHHLAV F+ LQ+  C+IF +L K QR SLRK+VID+VLATDMSKHM+LL++LK MVE KK++  GVL  ++YSDR+++LQNMVHCADLSNPTKPL LY++WT RIM EFF QGD+ERD  +EISPMCD+  ASIEKSQV FID+IV PLW TWA+LV+P+AQE+L+TLE N++WYQ
Sbjct:   99 RNSSTASELHGEDMIVTPFAQVLASLRTVRSNFAVLTHQQDRVPSNGHEYINVLLY---------------FAEEPFQKLAVETLDELDWCLEQLETLKTRHSVSEMASNKFKRMLNRELTQLSETSKSGNQVSEYISSTF----LEKQHDMDI--MSTPSKEKEKKKRPM----------SQI---------SGVKKPTH-SSNIAPSSIP--------RFGVSTNREDLLAKELEDF-DRWGVDMFKISECSGNRPLTVAMYTTFQERDLLKSFKIPVDTFINYMTALEENYRSDVAYHNSIHAADVVQSTHVLLSTPALEAVFTDLEILAAMFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDMVLATDMSKHMNLLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLELYRQWTDRIMVEFFTQGDRERDKGMEISPMCDKHNASIEKSQVGFIDYIVHPLWETWADLVHPDAQEILDTLEDNREWYQ 596          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: PDE4D (phosphodiesterase 4D [Source:NCBI gene;Acc:100496479])

HSP 1 Score: 470.7 bits (1210), Expect = 6.952e-155
Identity = 251/539 (46.57%), Postives = 345/539 (64.01%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLTG--TRSSNRFTSTN---VILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIK-SFLNSNQLEESLKMDIKQMSVAQFYKNADATP--QIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            IVTP A +LA L  VR N   LT    R+ N  TS +   +  + I N+K            + ++ +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL +++   ++ ++V +YI  +FL+          +++  S AQ  K     P  QI     L+ SS +    +S  P+                            G+  +N+  +   L+  +  WGL IF+    +    L V+   I ++R+++  F I   T+I Y + +E +Y   + YHN +HAADV QS HVLLS+ ALE +FT+LEILA IFA AIHDV HPGV+NQ+LIN   ELA+MYND+SVLENHHLAV F+ LQ+  C+IF +L K QR  LRK+VID+VLATDMSKHM+LL++LK MVE KK++ SGVL  ++YSDR+++LQNMVHCADLSNPTKPL LY+ WT RIMEEFFRQGD+ER+  +EISPMCD+  AS+EKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:  117 IVTPFAQVLASLRTVRNNFAALTNLQDRAPNCATSDSPPTMCKRNIKNIK------------EAYQKLAGETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQH-------EVEMPSPAQKEKEKKKRPMSQISGVKKLMHSSSLT---NSNIPR---------------------------FGVKSENEECLAKELED-VNKWGLNIFKVAEFSGNRPLTVVMHTIFQEREMLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVAQSTHVLLSSPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQLLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLPLYRHWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQ 605          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: PDE4D (phosphodiesterase 4D [Source:NCBI gene;Acc:100496479])

HSP 1 Score: 468.003 bits (1203), Expect = 3.752e-154
Identity = 251/535 (46.92%), Postives = 343/535 (64.11%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLTGTRS---SNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIK-SFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            IVTP A +LA L  VR N   LT  +    S R T  N     I    I E         + ++ +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL +++   ++ ++V +YI  +FL+          +++  S AQ  K     P               M++ S   K+++            S  L +  I R  G+  +N+  +   L+  +  WGL IF+    +    L V+   I ++R+++  F I   T+I Y + +E +Y   + YHN +HAADV QS HVLLS+ ALE +FT+LEILA IFA AIHDV HPGV+NQ+LIN   ELA+MYND+SVLENHHLAV F+ LQ+  C+IF +L K QR  LRK+VID+VLATDMSKHM+LL++LK MVE KK++ SGVL  ++YSDR+++LQNMVHCADLSNPTKPL LY+ WT RIMEEFFRQGD+ER+  +EISPMCD+  AS+EKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:   92 IVTPFAQVLASLRTVRNNFAALTNLQDRAPSKRSTMCNQ--PSINKATIPE---------EAYQKLAGETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQH-------EVEMPSPAQKEKEKKKRP---------------MSQISGVKKLMH------------SSSLTNSNIPR-FGVKSENEECLAKELED-VNKWGLNIFKVAEFSGNRPLTVVMHTIFQEREMLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVAQSTHVLLSSPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQLLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLPLYRHWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQ 579          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: PDE4D (phosphodiesterase 4D [Source:NCBI gene;Acc:100496479])

HSP 1 Score: 468.389 bits (1204), Expect = 5.220e-154
Identity = 251/535 (46.92%), Postives = 343/535 (64.11%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLTGTRS---SNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIK-SFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            IVTP A +LA L  VR N   LT  +    S R T  N     I    I E         + ++ +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL +++   ++ ++V +YI  +FL+          +++  S AQ  K     P               M++ S   K+++            S  L +  I R  G+  +N+  +   L+  +  WGL IF+    +    L V+   I ++R+++  F I   T+I Y + +E +Y   + YHN +HAADV QS HVLLS+ ALE +FT+LEILA IFA AIHDV HPGV+NQ+LIN   ELA+MYND+SVLENHHLAV F+ LQ+  C+IF +L K QR  LRK+VID+VLATDMSKHM+LL++LK MVE KK++ SGVL  ++YSDR+++LQNMVHCADLSNPTKPL LY+ WT RIMEEFFRQGD+ER+  +EISPMCD+  AS+EKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:  112 IVTPFAQVLASLRTVRNNFAALTNLQDRAPSKRSTMCNQ--PSINKATIPE---------EAYQKLAGETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQH-------EVEMPSPAQKEKEKKKRP---------------MSQISGVKKLMH------------SSSLTNSNIPR-FGVKSENEECLAKELED-VNKWGLNIFKVAEFSGNRPLTVVMHTIFQEREMLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVAQSTHVLLSSPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQLLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLPLYRHWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQ 599          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: PDE4D (phosphodiesterase 4D [Source:NCBI gene;Acc:100496479])

HSP 1 Score: 465.692 bits (1197), Expect = 6.247e-154
Identity = 246/534 (46.07%), Postives = 339/534 (63.48%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIK-SFLNSNQLEESLKMDIKQMSVAQFYKNADATP--QIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            IVTP A +LA L  VR N   LT  +    F                   +L+   ++ ++ +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL +++   ++ ++V +YI  +FL+          +++  S AQ  K     P  QI     L+ SS +    +S  P+                            G+  +N+  +   L+  +  WGL IF+    +    L V+   I ++R+++  F I   T+I Y + +E +Y   + YHN +HAADV QS HVLLS+ ALE +FT+LEILA IFA AIHDV HPGV+NQ+LIN   ELA+MYND+SVLENHHLAV F+ LQ+  C+IF +L K QR  LRK+VID+VLATDMSKHM+LL++LK MVE KK++ SGVL  ++YSDR+++LQNMVHCADLSNPTKPL LY+ WT RIMEEFFRQGD+ER+  +EISPMCD+  AS+EKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:   54 IVTPFAQVLASLRTVRNNFAALTNLQDRYPFP-----------------YLLT---EEAYQKLAGETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQH-------EVEMPSPAQKEKEKKKRPMSQISGVKKLMHSSSLT---NSNIPR---------------------------FGVKSENEECLAKELED-VNKWGLNIFKVAEFSGNRPLTVVMHTIFQEREMLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVAQSTHVLLSSPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQLLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLPLYRHWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQ 529          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: PDE4D (phosphodiesterase 4D [Source:NCBI gene;Acc:100496479])

HSP 1 Score: 467.233 bits (1201), Expect = 7.474e-154
Identity = 251/535 (46.92%), Postives = 343/535 (64.11%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLTGTRS---SNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIK-SFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            IVTP A +LA L  VR N   LT  +    S R T  N     I    I E         + ++ +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL +++   ++ ++V +YI  +FL+          +++  S AQ  K     P               M++ S   K+++            S  L +  I R  G+  +N+  +   L+  +  WGL IF+    +    L V+   I ++R+++  F I   T+I Y + +E +Y   + YHN +HAADV QS HVLLS+ ALE +FT+LEILA IFA AIHDV HPGV+NQ+LIN   ELA+MYND+SVLENHHLAV F+ LQ+  C+IF +L K QR  LRK+VID+VLATDMSKHM+LL++LK MVE KK++ SGVL  ++YSDR+++LQNMVHCADLSNPTKPL LY+ WT RIMEEFFRQGD+ER+  +EISPMCD+  AS+EKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:   97 IVTPFAQVLASLRTVRNNFAALTNLQDRAPSKRSTMCNQ--PSINKATIPE---------EAYQKLAGETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQH-------EVEMPSPAQKEKEKKKRP---------------MSQISGVKKLMH------------SSSLTNSNIPR-FGVKSENEECLAKELED-VNKWGLNIFKVAEFSGNRPLTVVMHTIFQEREMLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVAQSTHVLLSSPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQLLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLPLYRHWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQ 584          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde4d (phosphodiesterase 4D, cAMP specific [Source:MGI Symbol;Acc:MGI:99555])

HSP 1 Score: 467.618 bits (1202), Expect = 3.813e-154
Identity = 246/532 (46.24%), Postives = 339/532 (63.72%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILN-VKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            IVTP A +LA L  VR N   LT  +       + +  +  +N   I+E         + ++ +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL +++   ++ ++V +YI +      L++  +++I   +  +  K      QI     L+ SS +  +          +P +F  +  Q  V   + E                      +  WGL +F    L+    L VI   I ++R L+  F I   T+I Y + +E +Y   + YHN +HAADV QS HVLLS  ALE +FT+LEILA IFA AIHDV HPGV+NQ+LIN   ELA+MYND+SVLENHHLAV F+ LQ+  C+IF +L K QR SLRK+VID+VLATDMSKHM+LL++LK MVE KK++ SGVL  ++YSDR+++LQNMVHCADLSNPTKPL LY++WT RIMEEFFRQGD+ER+  +EISPMCD+  AS+EKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:   92 IVTPFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITE---------EAYQKLASETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTF----LDKQHEVEIPSPTQKEKEKKKRPMSQISGVKKLMHSSSLTNS---------CIP-RFGVKTEQEDVLAKELED---------------------VNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQ 579          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde4d (phosphodiesterase 4D, cAMP specific [Source:MGI Symbol;Acc:MGI:99555])

HSP 1 Score: 467.618 bits (1202), Expect = 8.308e-154
Identity = 246/532 (46.24%), Postives = 339/532 (63.72%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILN-VKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            IVTP A +LA L  VR N   LT  +       + +  +  +N   I+E         + ++ +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL +++   ++ ++V +YI +      L++  +++I   +  +  K      QI     L+ SS +  +          +P +F  +  Q  V   + E                      +  WGL +F    L+    L VI   I ++R L+  F I   T+I Y + +E +Y   + YHN +HAADV QS HVLLS  ALE +FT+LEILA IFA AIHDV HPGV+NQ+LIN   ELA+MYND+SVLENHHLAV F+ LQ+  C+IF +L K QR SLRK+VID+VLATDMSKHM+LL++LK MVE KK++ SGVL  ++YSDR+++LQNMVHCADLSNPTKPL LY++WT RIMEEFFRQGD+ER+  +EISPMCD+  AS+EKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:  112 IVTPFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITE---------EAYQKLASETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTF----LDKQHEVEIPSPTQKEKEKKKRPMSQISGVKKLMHSSSLTNS---------CIP-RFGVKTEQEDVLAKELED---------------------VNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQ 599          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde4d (phosphodiesterase 4D, cAMP specific [Source:MGI Symbol;Acc:MGI:99555])

HSP 1 Score: 467.233 bits (1201), Expect = 1.399e-153
Identity = 246/532 (46.24%), Postives = 339/532 (63.72%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILN-VKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            IVTP A +LA L  VR N   LT  +       + +  +  +N   I+E         + ++ +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL +++   ++ ++V +YI +      L++  +++I   +  +  K      QI     L+ SS +  +          +P +F  +  Q  V   + E                      +  WGL +F    L+    L VI   I ++R L+  F I   T+I Y + +E +Y   + YHN +HAADV QS HVLLS  ALE +FT+LEILA IFA AIHDV HPGV+NQ+LIN   ELA+MYND+SVLENHHLAV F+ LQ+  C+IF +L K QR SLRK+VID+VLATDMSKHM+LL++LK MVE KK++ SGVL  ++YSDR+++LQNMVHCADLSNPTKPL LY++WT RIMEEFFRQGD+ER+  +EISPMCD+  AS+EKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:  114 IVTPFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITE---------EAYQKLASETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTF----LDKQHEVEIPSPTQKEKEKKKRPMSQISGVKKLMHSSSLTNS---------CIP-RFGVKTEQEDVLAKELED---------------------VNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQ 601          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde4d (phosphodiesterase 4D, cAMP specific [Source:MGI Symbol;Acc:MGI:99555])

HSP 1 Score: 466.848 bits (1200), Expect = 2.023e-153
Identity = 246/532 (46.24%), Postives = 339/532 (63.72%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILN-VKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            IVTP A +LA L  VR N   LT  +       + +  +  +N   I+E         + ++ +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL +++   ++ ++V +YI +      L++  +++I   +  +  K      QI     L+ SS +  +          +P +F  +  Q  V   + E                      +  WGL +F    L+    L VI   I ++R L+  F I   T+I Y + +E +Y   + YHN +HAADV QS HVLLS  ALE +FT+LEILA IFA AIHDV HPGV+NQ+LIN   ELA+MYND+SVLENHHLAV F+ LQ+  C+IF +L K QR SLRK+VID+VLATDMSKHM+LL++LK MVE KK++ SGVL  ++YSDR+++LQNMVHCADLSNPTKPL LY++WT RIMEEFFRQGD+ER+  +EISPMCD+  AS+EKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:  117 IVTPFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITE---------EAYQKLASETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTF----LDKQHEVEIPSPTQKEKEKKKRPMSQISGVKKLMHSSSLTNS---------CIP-RFGVKTEQEDVLAKELED---------------------VNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQ 604          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde4d (phosphodiesterase 4D, cAMP specific [Source:MGI Symbol;Acc:MGI:99555])

HSP 1 Score: 468.389 bits (1204), Expect = 2.140e-153
Identity = 246/532 (46.24%), Postives = 339/532 (63.72%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILN-VKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            IVTP A +LA L  VR N   LT  +       + +  +  +N   I+E         + ++ +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL +++   ++ ++V +YI +      L++  +++I   +  +  K      QI     L+ SS +  +          +P +F  +  Q  V   + E                      +  WGL +F    L+    L VI   I ++R L+  F I   T+I Y + +E +Y   + YHN +HAADV QS HVLLS  ALE +FT+LEILA IFA AIHDV HPGV+NQ+LIN   ELA+MYND+SVLENHHLAV F+ LQ+  C+IF +L K QR SLRK+VID+VLATDMSKHM+LL++LK MVE KK++ SGVL  ++YSDR+++LQNMVHCADLSNPTKPL LY++WT RIMEEFFRQGD+ER+  +EISPMCD+  AS+EKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:  168 IVTPFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITE---------EAYQKLASETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTF----LDKQHEVEIPSPTQKEKEKKKRPMSQISGVKKLMHSSSLTNS---------CIP-RFGVKTEQEDVLAKELED---------------------VNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQ 655          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|P14644|PDE4C_RAT (cAMP-specific 3',5'-cyclic phosphodiesterase 4C (Fragment) OS=Rattus norvegicus OX=10116 GN=Pde4c PE=2 SV=2)

HSP 1 Score: 465.692 bits (1197), Expect = 1.610e-154
Identity = 238/536 (44.40%), Postives = 335/536 (62.50%), Query Frame = 3
Query:  645 SESSIVTPLAIILARLGRVRQNIMTLT-GTRSSNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
             E  IVTP A +LA L  VR N+  L  G  S+ R        +       +E+  L          +A+E+LEEL+WCL QL  +QT++SVG+++  KFK +L+ EL +++   ++ ++V +YI       Q E  L                 A P                 +D   P       + S   S P+  +         G+    + ++   L+     WGL +F+   L+    L  +  ++L++R L+  F I   T+++Y L +E +Y  ++ YHN++HAADV QS HVLL   ALE +FT+LE+LA IFACAIHDV HPGV+NQ+LIN   ELA+MYND+SVLENHHLAV F+ LQ   C+IF +L+  Q+ SLR++VID+VLATDMSKHMSLL++LK MVE KK++  GVL  ++YSDR+++LQ++VHCADLSNP KPL LY++WT+RIM EFF+QGD+ER+S ++ISPMCD+ TAS+EKSQV FID+I  PLW TWA+LV+P+AQE+L+TLE N++WYQ
Sbjct:   14 GEDMIVTPFAQVLASLRTVRSNVAALAHGAGSATRQALLGTPPQSSQQAAPAEESGL---------QLAQETLEELDWCLEQLETLQTRRSVGEMASNKFKRMLNRELTHLSETSRSGNQVSEYISQTFLDQQAEVELP----------------APP----------------TEDHPWPMAQITGLRKSCHTSLPTAAI------PRFGVQTDQEEQLAKELED-TNKWGLDVFKVAELSGNRPLTAVIFRVLQERDLLKTFQIPADTLLRYLLTLEGHYHSNVAYHNSIHAADVVQSAHVLLGTPALEAVFTDLEVLAAIFACAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQGENCDIFQNLSTKQKLSLRRMVIDMVLATDMSKHMSLLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQSLVHCADLSNPAKPLPLYRQWTERIMAEFFQQGDRERESGLDISPMCDKHTASVEKSQVGFIDYIAHPLWETWADLVHPDAQELLDTLEDNREWYQ 501          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|Q01063|PDE4D_MOUSE (cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Mus musculus OX=10090 GN=Pde4d PE=1 SV=2)

HSP 1 Score: 468.003 bits (1203), Expect = 1.774e-152
Identity = 246/532 (46.24%), Postives = 339/532 (63.72%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILN-VKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            IVTP A +LA L  VR N   LT  +       + +  +  +N   I+E         + ++ +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL +++   ++ ++V +YI +      L++  +++I   +  +  K      QI     L+ SS +  +          +P +F  +  Q  V   + E                      +  WGL +F    L+    L VI   I ++R L+  F I   T+I Y + +E +Y   + YHN +HAADV QS HVLLS  ALE +FT+LEILA IFA AIHDV HPGV+NQ+LIN   ELA+MYND+SVLENHHLAV F+ LQ+  C+IF +L K QR SLRK+VID+VLATDMSKHM+LL++LK MVE KK++ SGVL  ++YSDR+++LQNMVHCADLSNPTKPL LY++WT RIMEEFFRQGD+ER+  +EISPMCD+  AS+EKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:  161 IVTPFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITE---------EAYQKLASETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTF----LDKQHEVEIPSPTQKEKEKKKRPMSQISGVKKLMHSSSLTNS---------CIP-RFGVKTEQEDVLAKELED---------------------VNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQ 648          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|Q3UEI1|PDE4C_MOUSE (cAMP-specific 3',5'-cyclic phosphodiesterase 4C OS=Mus musculus OX=10090 GN=Pde4c PE=1 SV=1)

HSP 1 Score: 464.151 bits (1193), Expect = 7.301e-152
Identity = 240/536 (44.78%), Postives = 333/536 (62.13%), Query Frame = 3
Query:  645 SESSIVTPLAIILARLGRVRQNIMTLT-GTRSSNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
             E  IVTP A +LA L  VR N+  L  G  S+ R                +ED  L          + +E+LEEL+WCL QL  +QT++SVG+++  KFK +L+ EL  ++   ++ ++V +YI       Q E  L                   PQ  ++ D    +QI   + S             S  S P+  +         G+    + ++   L+     WGL +F+   L+    L  +   + ++R L+  F I   T++ Y L +E +Y   + YHN++HAADV QS HVLL   ALE +FT+LE+LA IFACAIHDV HPGV+NQ+LIN   ELA+MYND+SVLENHHLAV F+ LQ   C+IF +L+  QR SLR++VID+VLATDMSKHMSLL++LK MVE KK++  GVL  ++YSDR+++LQ++VHCADLSNP KPL LY++WT+RIM EFF+QGD+ER+S ++ISPMCD+ TAS+EKSQV FID+I +PLW TWA+LV+P+AQE+L+TLE N++WYQ
Sbjct:  149 GEDMIVTPFAQVLASLRTVRNNVAALAHGPGSATRQVLLGTPPHSSQQAAPTEDSGL---------QLVQETLEELDWCLEQLETLQTRRSVGEMASNKFKRMLNRELSYLSETSRSGNQVSEYISQTFLDQQAEVEL-------------------PQPPTEDDPWPMAQITELRRS-------------SHTSLPTAAI------PRFGVQTDQEEQLAKELED-TNKWGLDVFKVAELSGNRPLTAVIFSVFQERDLLKTFQIPADTLLAYLLTLEGHYHSDVAYHNSMHAADVVQSAHVLLGTPALEAVFTDLEVLAAIFACAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQGENCDIFRNLSTKQRLSLRRMVIDMVLATDMSKHMSLLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQSLVHCADLSNPAKPLPLYRQWTERIMAEFFQQGDRERESGLDISPMCDKHTASMEKSQVGFIDYIAQPLWETWADLVHPDAQELLDTLEDNREWYQ 636          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|Q08499|PDE4D_HUMAN (cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Homo sapiens OX=9606 GN=PDE4D PE=1 SV=2)

HSP 1 Score: 468.003 bits (1203), Expect = 1.214e-151
Identity = 247/532 (46.43%), Postives = 340/532 (63.91%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILN-VKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            IVTP A +LA L  VR N   LT  +       + +  +  +N   I+E         + ++ +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL +++   ++ ++V ++I +      L++  +++I   +  +  K      QI     L+ SS +    +S  P+       F  +  Q  V   + E              +N         WGL +F    L+    L VI   I ++R L+  F I   T+I Y + +E +Y   + YHN +HAADV QS HVLLS  ALE +FT+LEILA IFA AIHDV HPGV+NQ+LIN   ELA+MYND+SVLENHHLAV F+ LQ+  C+IF +L K QR SLRK+VID+VLATDMSKHM+LL++LK MVE KK++ SGVL  ++YSDR+++LQNMVHCADLSNPTKPL LY++WT RIMEEFFRQGD+ER+  +EISPMCD+  AS+EKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:  222 IVTPFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITE---------EAYQKLASETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEFISNTF----LDKQHEVEIPSPTQKEKEKKKRPMSQISGVKKLMHSSSLT---NSSIPR-------FGVKTEQEDVLAKELE-------------DVNK--------WGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQ 709          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|P14270|PDE4D_RAT (cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Rattus norvegicus OX=10116 GN=Pde4d PE=1 SV=4)

HSP 1 Score: 466.463 bits (1199), Expect = 3.079e-151
Identity = 245/532 (46.05%), Postives = 338/532 (63.53%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILN-VKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            IVTP A +LA L  VR N   LT  +       + +  +  +N   I+E         + ++ +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL +++   ++ ++V +YI +      L++  +++I   +  +  K      QI     L+ SS +  +          +P +F  +  Q  V   + E                      +  WGL +F    L+    L VI   I ++R L+  F I   T+I Y + +E +Y   + YHN +HAADV QS HVLLS  ALE +FT+LEILA IFA AIHDV HPGV+NQ+LIN   ELA+MYND+SVLENHHLAV F+ LQ+  C+IF +L K QR SLRK+ ID+VLATDMSKHM+LL++LK MVE KK++ SGVL  ++YSDR+++LQNMVHCADLSNPTKPL LY++WT RIMEEFFRQGD+ER+  +EISPMCD+  AS+EKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:  217 IVTPFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITE---------EAYQKLASETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTF----LDKQHEVEIPSPTQKEKEKKKRPMSQISGVKKLMHSSSLTNS---------CIP-RFGVKTEQEDVLAKELED---------------------VNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMAIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQ 704          
BLAST of Phosphodiesterase vs. TrEMBL
Match: G7YDS5 (Phosphodiesterase OS=Clonorchis sinensis OX=79923 GN=CLF_105595 PE=3 SV=1)

HSP 1 Score: 511.146 bits (1315), Expect = 1.648e-165
Identity = 257/554 (46.39%), Postives = 366/554 (66.06%), Query Frame = 3
Query:  648 ESSIVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQM-----SVAQFYKNADATPQ----IHSQPDLIGSSQIM-MNKDSESPKMVYLPNKFSSQIS-QPSVCLHD--HEIYRNL-----GICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQFQ 2255
            E  IVTP A +L  L R+R   + LT  +S++RF    VI   +     SE ++  S +   +K +A E+LEELEWCL QL N+QTK+ V D++  KFK +L++EL +     K+  E+  YI      ++ +      I+QM     S  Q + +++   Q      S+   +G  +   +  D  + +++  P   S+ I   P   + D   ++ +++     GI   NDI+++      L +WG  IFE D L++ H+L     +I +KR L+  FSIDP T+++Y L++E NY   +PYHNA+HAADVTQ+ H LL  + LED+F++LEILAVIFA  +HDV HPG+TNQ+LIN GH+LA+ YND+SVLENHHL VAF+ L +P C+IF+SL   +R +LR++VI+LVLATDMSKHMSLL++L+ MVE KK+SGSGVLN ++YSDR++ILQNM+HCADLSNP KPL L ++WT R+MEEFFRQGDKER   +EISPMCDR + ++EKSQV+FIDF+  PL  +W +LV+P++Q +L+ L  N+DWY  Q
Sbjct:  268 EGVIVTPFAQVLVSLQRIRHAFIRLTSAQSTHRF---GVISSAVPEPTPSELLLPDSPE---YKAVAMETLEELEWCLKQLENIQTKRPVSDMAFSKFKRLLNKELNSFGETDKSRHEISAYICGTFLEDEKDTEANQQIEQMLERRRSSGQSHGSSNTAEQSTALAGSKSKPVGEKETSSLIPDGPTSELITRPPDSSANIQVAPDEGIDDGTKDVSKSIQMPVNGIVTPNDIELDERFTQTLDTWGADIFEIDRLSDGHALTTTAYRIFQKRDLLRTFSIDPATLVRYLLKVEANYHPDVPYHNALHAADVTQTSHFLLQAEPLEDVFSDLEILAVIFASIVHDVDHPGLTNQFLINSGHDLALQYNDSSVLENHHLYVAFKLLNQPDCDIFSSLGVKKRQTLRRMVIELVLATDMSKHMSLLADLRTMVEAKKVSGSGVLNLDNYSDRIQILQNMIHCADLSNPAKPLRLNRKWTSRLMEEFFRQGDKERSLNLEISPMCDRESVAVEKSQVTFIDFVAHPLLESWCDLVHPSSQLILDILADNRDWYDCQ 815          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A0L8HYP6 (Phosphodiesterase (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22001928mg PE=3 SV=1)

HSP 1 Score: 498.434 bits (1282), Expect = 6.550e-164
Identity = 260/546 (47.62%), Postives = 357/546 (65.38%), Query Frame = 3
Query:  645 SESSIVTPLAIILARLGRVRQNIMTLTGT----RSSNRFTSTNVILKKILNVKISE--DIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLD-----SFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            SE  IVTP A ILA L  VR N + LT        + R +ST     +  + + S+  +   S+++D+ +  +A E+LEEL+WCL QL  +QT +SV D++  KFK +L+ EL + A   K+ +++ +YI     S  L++  ++D+  + V                 D  G+  I   KD   P           QIS      H +      G+ PK+ ++  +  +     + +  WG+ +F+    +N   L  +T  IL++R L+  F I   TV+ Y + +E +Y R +PYHNA+HAADVTQS HVLLS  ALE++FT+LE+LA IFAC IHDV HPGVTNQYL+N   ELA+MYND SVLENHHLAVAF+ LQ+  C+IFA+L++ Q  SLRK+VID+VLATDMSKHMSLL++LK MVE KK++GSGVL  ++Y+DR+++LQNMVHC+DLSNPTKPL +Y++W  RIMEEFF QGD ER+  ++ISPMCDR  A+IEKSQV FID+IV PLW TWA+LVYP+AQ++L+TLE N+DWYQ
Sbjct:    2 SEDLIVTPFAQILASLRSVRNNYLNLTNVNLPKERTRRGSSTGPHSSQREHYQQSQAQNSQTSTNKDESYYKLALETLEELDWCLDQLETIQTHRSVSDMASSKFKRMLNRELSHFAESSKSGNQIAEYI----CSTYLDKQQELDVPTLKV--------------EDTDRPGNKDIF-QKDKNRPM---------CQISGVRKLKHTNSF---TGVVPKHGVETPHREELGKHLADIDKWGIDVFKISEYSNNRPLTCVTYTILQERNLLKTFQIPAQTVVTYLMHLEDHYHRDVPYHNAMHAADVTQSTHVLLSVSALENVFTDLEVLAAIFACTIHDVDHPGVTNQYLVNTSSELALMYNDESVLENHHLAVAFKLLQEENCDIFANLSRKQHQSLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVAGSGVLLLDNYTDRIQVLQNMVHCSDLSNPTKPLEVYRKWVDRIMEEFFIQGDMEREKGLDISPMCDRHNATIEKSQVGFIDYIVHPLWETWADLVYPSAQDILDTLEDNRDWYQ 516          
BLAST of Phosphodiesterase vs. TrEMBL
Match: G4VPI6 (Phosphodiesterase OS=Schistosoma mansoni OX=6183 GN=Smp_134140 PE=1 SV=1)

HSP 1 Score: 496.508 bits (1277), Expect = 1.130e-162
Identity = 251/535 (46.92%), Postives = 347/535 (64.86%), Query Frame = 3
Query:  648 ESSIVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYI-KSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            E  IVTP A +L  + R+R   + LT  + SN++  T V    +    ++ D          +K +A E+LEELEWCL QL N+QTK+ V D++  KFK +L++EL +     K+  ++  YI ++FL S        M  +    AQ                L  SS ++  K   S K   L ++     + P + +H        G+   ND ++       L  WG+ IFE D L+N H+L  +  +I +KR L+  F IDP   ++Y L++E  Y   +PYHN++HAADV Q+ H LL  +AL+D+F++LEILAV+FA AIHDV HPGVTNQ+LIN GHELA+ YND SVLENHHL +AF+ L +  C+IFA+L   +R +LR++VI+LVLATDMSKHMSLL++L+ MVE KK+SGSG+LN ++Y+DR++ILQNM+HCADLSNP KPL LY++WT R++EEFFRQGDKER+  +EISPMCDR +  +EKSQVSFIDF+  PLW TW +LV+P AQ +L+TLE N+DWY+
Sbjct:   97 EGVIVTPFAQVLVSMQRIRNAFIRLTAAQVSNKYNITTV-FDSVPTGNLTPD-------SSDYKIIANETLEELEWCLKQLENIQTKRPVSDMAFSKFKRLLNKELNSFGEADKSRHQISAYICETFLGSTG-----SMSTESRKSAQ----------------LNDSSGLLTTKLPSSSK---LTSQNVDDGNGPFLPIH--------GVETPNDNELEERFSLCLDEWGVDIFEIDRLSNGHALTTVAYRIFQKRDLLKTFCIDPHVFVRYLLRVESTYHADVPYHNSMHAADVLQTAHFLLQAEALDDVFSDLEILAVLFAAAIHDVDHPGVTNQFLINTGHELALQYNDASVLENHHLYMAFKILTEKDCDIFANLGGKKRQTLRRMVIELVLATDMSKHMSLLADLRTMVETKKVSGSGMLNLDNYADRIQILQNMIHCADLSNPAKPLRLYRKWTGRLIEEFFRQGDKERELSLEISPMCDRESVEVEKSQVSFIDFVCHPLWETWCDLVHPCAQLILDTLEDNRDWYE 591          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A3Q0KMA3 (Phosphodiesterase OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 495.352 bits (1274), Expect = 4.919e-162
Identity = 257/578 (44.46%), Postives = 363/578 (62.80%), Query Frame = 3
Query:  648 ESSIVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYI-KSFLNSNQL----EESLKMDIKQMSVAQFYKNA-------------------DATPQIHSQPDL------------IGSSQIMMNKDSESPKM--------VYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            E  IVTP A +L  + R+R   + LT  + SN++  T V    +    ++ D          +K +A E+LEELEWCL QL N+QTK+ V D++  KFK +L++EL +     K+  ++  YI ++FL + +     EE   M  ++ S  Q + +                    +A P     PD             IGS+  M  +  +S ++          LP+  SS+++  +V   +       G+   ND ++       L  WG+ IFE D L+N H+L  +  +I +KR L+  F IDP   ++Y L++E  Y   +PYHN++HAADV Q+ H LL  +AL+D+F++LEILAV+FA AIHDV HPGVTNQ+LIN GHELA+ YND SVLENHHL +AF+ L +  C+IFA+L   +R +LR++VI+LVLATDMSKHMSLL++L+ MVE KK+SGSG+LN ++Y+DR++ILQNM+HCADLSNP KPL LY++WT R++EEFFRQGDKER+  +EISPMCDR +  +EKSQVSFIDF+  PLW TW +LV+P AQ +L+TLE N+DWY+
Sbjct:   37 EGVIVTPFAQVLVSMQRIRNAFIRLTAAQVSNKYNITTV-FDSVPTGNLTPD-------SSDYKIIANETLEELEWCLKQLENIQTKRPVSDMAFSKFKRLLNKELNSFGEADKSRHQISAYICETFLETEKDVETNEEIDSMLERRRSSGQSHNSTSGQDTNTTSKRQASGTGDQNANPNTTRTPDTSSSVSSSVIKTRIGSTGSMSTESRKSAQLNDSSGLLTTKLPS--SSKLTSQNVDDGNGPFLPIHGVETPNDNELEERFSLCLDEWGVDIFEIDRLSNGHALTTVAYRIFQKRDLLKTFCIDPHVFVRYLLRVESTYHADVPYHNSMHAADVLQTAHFLLQAEALDDVFSDLEILAVLFAAAIHDVDHPGVTNQFLINTGHELALQYNDASVLENHHLYMAFKILTEKDCDIFANLGGKKRQTLRRMVIELVLATDMSKHMSLLADLRTMVETKKVSGSGMLNLDNYADRIQILQNMIHCADLSNPAKPLRLYRKWTGRLIEEFFRQGDKERELSLEISPMCDRESVEVEKSQVSFIDFVCHPLWETWCDLVHPCAQLILDTLEDNRDWYE 604          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A2T7NPC9 (Phosphodiesterase OS=Pomacea canaliculata OX=400727 GN=C0Q70_16290 PE=3 SV=1)

HSP 1 Score: 491.115 bits (1263), Expect = 4.731e-160
Identity = 262/564 (46.45%), Postives = 353/564 (62.59%), Query Frame = 3
Query:  645 SESSIVTPLAIILARLGRVRQNIMTLTGTRSS-----NRFTSTNVILKKILNVKISEDIILSSH-------------------QDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLD-----SFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            +E  IVTP A ILA L  VR N ++LT   SS      R +S       + N +         H                   QD+ +  +A E+LEEL+WC+ QL  +QT +SV D++  KFK +L+ EL + A   K+ +++ +YI     S  L++  ++D+  + V             H++P           ++   P+     N+  S+IS      H +      GI PK  ++  +  +     S L  WG+ +F+    +N   L  +T  IL++R+L+  F I P T++ Y + +E +Y R  PYHNA+HAADVTQS HVLLS  ALE++FT LE LA IFACAIHDV HPG+TNQYLIN   ELA+MYND SVLENHHLAVAF+ LQ+  C+IF +L+K QR SLRK+VID+VLATDMSKHMSLL++LK MVE KK++GSGVL  ++Y+DR+++LQNMVHCADLSNPTKPL +Y+ W  R+MEEFF QGD ER   ++ISPMCDR TA++EKSQV FID+IV PLW TWA+LVYP+A E+L+TLE N+DWY 
Sbjct:   49 AEDLIVTPFAQILASLRSVRNNYVSLTNVPSSAKERPRRGSSGPHAHGLLANAQAPGSPSPQHHLNAQDPASLSTLSPGTPRIQDEAYMKLAMETLEELDWCMEQLETIQTHRSVSDMASSKFKRMLNRELSHFAESSKSGNQIAEYI----CSTYLDKQQELDLPTVKVE------------HAEP----------IRERSVPEK----NRPMSEISGVRKLKHTNSF---TGIVPKYGVETPHMEELGKYLSNLDKWGVDLFKIAEYSNNRPLTCVTYTILQERELVKNFKIPPSTLVTYLMHLEDHYHRDTPYHNAIHAADVTQSTHVLLSATALENVFTSLETLAAIFACAIHDVDHPGLTNQYLINSSSELALMYNDESVLENHHLAVAFKLLQEDNCDIFINLSKKQRQSLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVAGSGVLLLDNYTDRIQVLQNMVHCADLSNPTKPLEIYRSWVDRLMEEFFHQGDLERQQGLDISPMCDRHTATVEKSQVGFIDYIVHPLWETWADLVYPDAAEILDTLEDNRDWYH 579          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: PDE4D (phosphodiesterase 4D [Source:HGNC Symbol;Acc:HGNC:8783])

HSP 1 Score: 461.455 bits (1186), Expect = 7.315e-151
Identity = 246/530 (46.42%), Postives = 342/530 (64.53%), Query Frame = 3
Query:  672 AIILARLGRVRQNIMTLTG---TRSSNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKS-FLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            +I+LA L  VR N   LT     R+SN+ +        + N      +  +S  ++ ++ +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL +++   ++ ++V ++I S FL+            KQ  V         TPQ   +       +  M++ S   K+++            S  L +  I R  G+  + +  +   L+  +  WGL +F+    +    L V+   I ++R L+  F I   T I Y + +E +Y   + YHN +HAADVTQS HVLLS  ALE +FT+LEILA IFA AIHDV HPGV+NQ+LIN   ELA+MYND+SVLENHHLAV F+ LQ+  C+IF +L K QR SLRK+VID+VLATDMSKHM+LL++LK MVE KK++ SGVL  ++YSDR+++LQNMVHCADLSNPTKPL LY++WT RIMEEFF QGD+ER+  +EISPMCD+  AS+EKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:  154 SIVLASLRTVRNNFAALTNLQQDRTSNKRS-------PMCNQPT---LTKASFTEEAYQKLATETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEFISSTFLD------------KQHDVEM------PTPQTQKE---KEKKKKPMSQISGVKKLMH------------STSLTNSNIPR-FGVKTETEESLAKELED-VNKWGLNVFKVTEFSGNRPLTVMMYTIFQERDLLKTFKIPLDTFITYLMTLEDHYHGDVAYHNNIHAADVTQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFSQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQ 638          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde4cb (phosphodiesterase 4C [Source:NCBI gene;Acc:103044346])

HSP 1 Score: 455.292 bits (1170), Expect = 3.745e-149
Identity = 246/545 (45.14%), Postives = 336/545 (61.65%), Query Frame = 3
Query:  624 MSVCTKVSESSIVTPLAIILARLGRVRQNIMTLTGTRSSN---RFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            +S   +  E  IVTP A +LA L  VR N   LT  +      R T +N              +   S  D  +  +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL  ++   ++ ++V ++I S     Q       D++ +S     K     P               M++ S   K+ + P+   + I +  V   +HE      +  K    IN         WGL IF+    +    L VI   I ++R L+  F I   T I + + +E +Y   + YHN +HAADV QS HVLLS+ ALE +FT+LEI+A +FA AIHDV HPGV+NQ+LIN   ELA+MYND SVLENHHLAV F+ LQ+  C+IF +L+K QR SLRK+VID+VLATDMSKHM+ L++LK MVE KK++  GVL  ++YSDR+++LQNMVHCADLSNPTKPL +Y++WT RIM E+F QGD+ERD  +EISPMCD+ TAS+EKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:   99 VSCLPRHGEDMIVTPFAQVLASLRTVRSNFAALTHLQDRGGCKRPTGSN-----------PPSMCKPSLPDDTYPKLAIETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTQLSETSRSGNQVSEFIASTFLEKQ------HDVEILSPPPKEKEKKRRP---------------MSQISGVKKLTHSPSLAPTCIPRFGVST-EHE-----SLLAKEVEDINR--------WGLDIFKIAEHSGNRPLTVIMYSIFQERDLLKSFKIPTDTFITFMMTLEDHYHADVAYHNNIHAADVVQSTHVLLSSPALEAVFTDLEIMAALFASAIHDVDHPGVSNQFLINTNSELALMYNDASVLENHHLAVGFKLLQEENCDIFQNLSKKQRQSLRKMVIDMVLATDMSKHMNFLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLEIYRQWTDRIMVEYFTQGDRERDRGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQ 597          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde4cb (phosphodiesterase 4C [Source:NCBI gene;Acc:103044346])

HSP 1 Score: 456.833 bits (1174), Expect = 5.211e-149
Identity = 246/545 (45.14%), Postives = 336/545 (61.65%), Query Frame = 3
Query:  624 MSVCTKVSESSIVTPLAIILARLGRVRQNIMTLTGTRSSN---RFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            +S   +  E  IVTP A +LA L  VR N   LT  +      R T +N              +   S  D  +  +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL  ++   ++ ++V ++I S     Q       D++ +S     K     P               M++ S   K+ + P+   + I +  V   +HE      +  K    IN         WGL IF+    +    L VI   I ++R L+  F I   T I + + +E +Y   + YHN +HAADV QS HVLLS+ ALE +FT+LEI+A +FA AIHDV HPGV+NQ+LIN   ELA+MYND SVLENHHLAV F+ LQ+  C+IF +L+K QR SLRK+VID+VLATDMSKHM+ L++LK MVE KK++  GVL  ++YSDR+++LQNMVHCADLSNPTKPL +Y++WT RIM E+F QGD+ERD  +EISPMCD+ TAS+EKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:  150 VSCLPRHGEDMIVTPFAQVLASLRTVRSNFAALTHLQDRGGCKRPTGSN-----------PPSMCKPSLPDDTYPKLAIETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTQLSETSRSGNQVSEFIASTFLEKQ------HDVEILSPPPKEKEKKRRP---------------MSQISGVKKLTHSPSLAPTCIPRFGVST-EHE-----SLLAKEVEDINR--------WGLDIFKIAEHSGNRPLTVIMYSIFQERDLLKSFKIPTDTFITFMMTLEDHYHADVAYHNNIHAADVVQSTHVLLSSPALEAVFTDLEIMAALFASAIHDVDHPGVSNQFLINTNSELALMYNDASVLENHHLAVGFKLLQEENCDIFQNLSKKQRQSLRKMVIDMVLATDMSKHMNFLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLEIYRQWTDRIMVEYFTQGDRERDRGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQ 648          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde4cb (phosphodiesterase 4C [Source:NCBI gene;Acc:103044346])

HSP 1 Score: 455.292 bits (1170), Expect = 6.554e-149
Identity = 246/545 (45.14%), Postives = 336/545 (61.65%), Query Frame = 3
Query:  624 MSVCTKVSESSIVTPLAIILARLGRVRQNIMTLTGTRSSN---RFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            +S   +  E  IVTP A +LA L  VR N   LT  +      R T +N              +   S  D  +  +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL  ++   ++ ++V ++I S     Q       D++ +S     K     P               M++ S   K+ + P+   + I +  V   +HE      +  K    IN         WGL IF+    +    L VI   I ++R L+  F I   T I + + +E +Y   + YHN +HAADV QS HVLLS+ ALE +FT+LEI+A +FA AIHDV HPGV+NQ+LIN   ELA+MYND SVLENHHLAV F+ LQ+  C+IF +L+K QR SLRK+VID+VLATDMSKHM+ L++LK MVE KK++  GVL  ++YSDR+++LQNMVHCADLSNPTKPL +Y++WT RIM E+F QGD+ERD  +EISPMCD+ TAS+EKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:  115 VSCLPRHGEDMIVTPFAQVLASLRTVRSNFAALTHLQDRGGCKRPTGSN-----------PPSMCKPSLPDDTYPKLAIETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTQLSETSRSGNQVSEFIASTFLEKQ------HDVEILSPPPKEKEKKRRP---------------MSQISGVKKLTHSPSLAPTCIPRFGVST-EHE-----SLLAKEVEDINR--------WGLDIFKIAEHSGNRPLTVIMYSIFQERDLLKSFKIPTDTFITFMMTLEDHYHADVAYHNNIHAADVVQSTHVLLSSPALEAVFTDLEIMAALFASAIHDVDHPGVSNQFLINTNSELALMYNDASVLENHHLAVGFKLLQEENCDIFQNLSKKQRQSLRKMVIDMVLATDMSKHMNFLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLEIYRQWTDRIMVEYFTQGDRERDRGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQ 613          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde4cb (phosphodiesterase 4C [Source:NCBI gene;Acc:103044346])

HSP 1 Score: 455.677 bits (1171), Expect = 9.658e-149
Identity = 246/545 (45.14%), Postives = 336/545 (61.65%), Query Frame = 3
Query:  624 MSVCTKVSESSIVTPLAIILARLGRVRQNIMTLTGTRSSN---RFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            +S   +  E  IVTP A +LA L  VR N   LT  +      R T +N              +   S  D  +  +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL  ++   ++ ++V ++I S     Q       D++ +S     K     P               M++ S   K+ + P+   + I +  V   +HE      +  K    IN         WGL IF+    +    L VI   I ++R L+  F I   T I + + +E +Y   + YHN +HAADV QS HVLLS+ ALE +FT+LEI+A +FA AIHDV HPGV+NQ+LIN   ELA+MYND SVLENHHLAV F+ LQ+  C+IF +L+K QR SLRK+VID+VLATDMSKHM+ L++LK MVE KK++  GVL  ++YSDR+++LQNMVHCADLSNPTKPL +Y++WT RIM E+F QGD+ERD  +EISPMCD+ TAS+EKSQV FID+IV PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:  144 VSCLPRHGEDMIVTPFAQVLASLRTVRSNFAALTHLQDRGGCKRPTGSN-----------PPSMCKPSLPDDTYPKLAIETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTQLSETSRSGNQVSEFIASTFLEKQ------HDVEILSPPPKEKEKKRRP---------------MSQISGVKKLTHSPSLAPTCIPRFGVST-EHE-----SLLAKEVEDINR--------WGLDIFKIAEHSGNRPLTVIMYSIFQERDLLKSFKIPTDTFITFMMTLEDHYHADVAYHNNIHAADVVQSTHVLLSSPALEAVFTDLEIMAALFASAIHDVDHPGVSNQFLINTNSELALMYNDASVLENHHLAVGFKLLQEENCDIFQNLSKKQRQSLRKMVIDMVLATDMSKHMNFLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLEIYRQWTDRIMVEYFTQGDRERDRGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQ 642          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007435.1 (pep scaffold:Pmarinus_7.0:GL486982:1709:8825:-1 gene:ENSPMAG00000006710.1 transcript:ENSPMAT00000007435.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 292.352 bits (747), Expect = 3.843e-94
Identity = 133/199 (66.83%), Postives = 170/199 (85.43%), Query Frame = 3
Query: 1578 IFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQ-VSFIDFIVRPLW 2171
            +FT+LEILA IFA AIHDV HPGV+NQ+LIN   ELA+MYND SVLENHHLAV F+ LQ+  C+IF +L+K QR +LRK+VID+VLATDMSKHM+LL++LK MVE KK++ SGVL  ++Y+DR+++LQNMVHCADLSNPTKPL +Y++WT+RIMEEFFRQGD+ER+  +EISPMCD+ +AS+EKSQ ++ IDF +   W
Sbjct:    7 VFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEENCDIFQNLSKKQRQTLRKMVIDMVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYTDRIQVLQNMVHCADLSNPTKPLDVYRQWTERIMEEFFRQGDRERERGMEISPMCDKHSASVEKSQRINAIDFSLHCWW 205          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: pde4ba (phosphodiesterase 4B, cAMP-specific a [Source:ZFIN;Acc:ZDB-GENE-030131-9570])

HSP 1 Score: 231.876 bits (590), Expect = 3.709e-69
Identity = 147/395 (37.22%), Postives = 214/395 (54.18%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLT---GTRSSNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLV 1832
            IVTP A +LA L  VR N   LT   GT S            +            ++  D+ ++ +A E++EEL+WCL QL  VQT +SV +++  KFK +L+ EL +++   ++ ++V ++I S     Q E    M++   S     K     P + S   +           S+    V       S IS     LH   I +   I       ++  L+  +  WG+ IF    L+N   L V+   I ++R+L+  F I   T + Y + +E ++   + YHN++HAADV QS HVLL++ AL+ +FT+LEILA IFA AIHDV HPGV+NQ+LI+   ELA+MYND SVLENHHLAV F+ LQ+  C+IF +L K QR +LRK+VID+V
Sbjct:    6 IVTPFAQVLASLRSVRNNFSALTNLQGTPSRRSPAGNQTSYPR------------AAPSDEGYQKLALETMEELDWCLDQLEAVQTHRSVSEMASNKFKRMLNRELSHLSEMSRSGNQVSEFISSTFMDKQHE----MEVP--SAGHKEKERQRRP-LASGGGVAAVGGAAPAVPSQLAAGV-------SHISGVQRLLHGAAILQRAMIFRD---ALSQELED-INKWGINIFRIAELSNNRPLTVLMYTIFQERELLKTFQIPADTFVTYMMTLE-DHHAGVAYHNSLHAADVAQSTHVLLASPALDAVFTDLEILAAIFASAIHDVDHPGVSNQFLISTNSELALMYNDESVLENHHLAVGFKLLQEDNCDIFQNLGKKQRQTLRKMVIDMV 369          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007498.1 (pep scaffold:Pmarinus_7.0:GL486417:1684:4657:1 gene:ENSPMAG00000006774.1 transcript:ENSPMAT00000007498.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 223.016 bits (567), Expect = 1.102e-68
Identity = 98/140 (70.00%), Postives = 124/140 (88.57%), Query Frame = 3
Query: 1830 VLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            VLATDMSKHM+LL +LK  VE KK++ SGVL  ++Y+DR+++LQNMVHCADLSNPTKPL LY++WT+RIMEEFF+QGD+ER+  ++ISPMCDR +AS+EKSQV FID+IV PLW TWA+LV P+AQEML+TLE N+D+YQ
Sbjct:    2 VLATDMSKHMNLLGDLKTTVETKKVTSSGVLLLDNYTDRIQVLQNMVHCADLSNPTKPLGLYRQWTERIMEEFFQQGDRERERGIDISPMCDRHSASVEKSQVGFIDYIVHPLWETWADLVQPDAQEMLDTLEENRDFYQ 141          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: pde1a (phosphodiesterase 1A, calmodulin-dependent [Source:ZFIN;Acc:ZDB-GENE-090831-2])

HSP 1 Score: 226.098 bits (575), Expect = 3.454e-65
Identity = 116/298 (38.93%), Postives = 178/298 (59.73%), Query Frame = 3
Query: 1332 WGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSI-PYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAEL----VYPNAQE 2210
            W   +F  +  + +H+L  +  ++L + +L+S + I    ++ +   +E  Y +   PYHN  HAADVTQ+VH LL    L    +ELE LAVIFA AIHD++H G TN + I    ++A++YND +VLENHH++ A+R +Q    NIF +L+K     LR +V+++VLATDMS H   +  +K          S +   ES  D+ + +  ++H  D+S+PTK   L+Q WT+ +MEEFFRQGD+E    +  SP+CDR +  + +SQ+ F+DFIV P +S   ++    V P A+E
Sbjct:  153 WSFDVFVLNEASGEHALKFVMHELLTRYELISRYKIPVAALVSFVEALEAGYSKHKNPYHNLAHAADVTQTVHYLLLQSGLMHWLSELETLAVIFAAAIHDLEHTGTTNNFHIQTRSDVALLYNDRAVLENHHVSAAYRLMQDDDMNIFINLSKDDWRELRALVVEMVLATDMSCHFQQIKTMK----------SALQQPESI-DKSKAMSLLLHAGDISHPTKEWPLHQRWTEALMEEFFRQGDREAKLGLPFSPLCDRNSTMVAQSQIGFMDFIVEPTFSVLTDMAEKVVVPLAEE 439          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: pde7a (phosphodiesterase 7A [Source:ZFIN;Acc:ZDB-GENE-031222-10])

HSP 1 Score: 214.927 bits (546), Expect = 3.402e-63
Identity = 116/312 (37.18%), Postives = 173/312 (55.45%), Query Frame = 3
Query: 1326 GSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELV-YPNAQEMLETLESNK-DWYQFQ 2255
             SW   +F FD LTN +SLV +T  +     L+  F +D + +  + + ++ +Y    PYHNAVHAADVTQ++H  L    L    T  +I+  + A + HDV HPGV   +LI   H LA +Y+++SVLENHH       L++ G  +FA L   +R  + + +  L+LATD+S+    LS+ K  ++       G L  E    R  ILQ  + CAD+ NP +     + W++++ EEFF+QGD ER  ++EISP+CDR T ++   Q+ F+ F+V PL+  WA  + Y +   ML  L  NK  W   Q
Sbjct:    6 ASWSFDMFLFDRLTNGNSLVSLTCHLFNFHGLIQHFQLDMVKLRGFLVMVQEDYHNQNPYHNAVHAADVTQAMHCYLREPKLAVHLTRRDIMLGLLAASAHDVDHPGVNQPFLIKTHHHLASLYHNSSVLENHHWRSTVGMLRESG--LFAHLPMDERLQMERDLGSLILATDISRQNEFLSQFKSHLD------KGDLCLEEAPHRHFILQIALKCADICNPCRVWDTSKRWSEKVCEEFFKQGDMERKWRLEISPLCDRYTQTVPNIQIGFMTFVVEPLFMEWARFMGYTHLSPMLGHLGLNKASWRGLQ 309          
BLAST of Phosphodiesterase vs. Ensembl Yeast
Match: PDE2 (High-affinity cyclic AMP phosphodiesterase; component of the cAMP-dependent protein kinase signaling system, protects the cell from extracellular cAMP, contains readthrough motif surrounding termination codon [Source:SGD;Acc:S000005887])

HSP 1 Score: 60.4622 bits (145), Expect = 5.744e-10
Identity = 52/192 (27.08%), Postives = 86/192 (44.79%), Query Frame = 3
Query: 1473 IEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEF 2048
            +E +Y +   +HN  HA DV Q+   L +   L+D    ++ L +  A   HDV HPG  NQ L N   E+A  + + S+LEN H  +  + L +    + +   K   +     + + +LATDM+ H      L                 E+   ++ ++  ++  AD+SN T+ LS+   W   I  EF
Sbjct:  254 LESSYHQVNKFHNFRHAIDVMQATWRLCTY-LLKD--NPVQTLLLCMAAIGHDVGHPGTNNQLLCNCESEVAQNFKNVSILENFHRELFQQLLSEHWPQLLSISKKKFDF-----ISEAILATDMALHSQYEDRLMH---------------ENPMKQITLISLIIKAADISNVTRTLSISARWAYLITLEF 422          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO46133 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM4])

HSP 1 Score: 434.491 bits (1116), Expect = 7.836e-144
Identity = 232/553 (41.95%), Postives = 336/553 (60.76%), Query Frame = 3
Query:  612 RRHSMSVCTKVSESSIVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLI-GSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLS--GSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERD-SKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQFQL 2258
            R HS S  T+V E  +VTP A IL+ L  VR   +TLT  +   +F  +     K             SH    W  +A  +L+EL+W L QL  +QT  SV +++  KFK +L+ EL + +   ++ ++V  ++ +     QLE                     T Q  ++ D I   S+ M+N   +  ++    + FS  + +              G+  +N+ ++   L++ +  W    F     TN H ++ ++  IL+ R L+ IF I P T I Y   +E +Y + +P+HN +HAADVTQ+ HVLLS  A +++FT+LEIL+ I A A+HDV HPGV N +L+    E+A+MYND SVLENHHLAVAF+ LQ   C+IF +L+K +R + R+++I++VLATD +KHMSLL+ LK MVE KK++  GSGVL  E+Y+DR+++L+++VHCADLSNPTKPL +Y++W  R+MEEFFRQGDKERD   +EISPM DR  ASIEKSQV FIDF+ +PLW TW ELV P+AQ++L+T+E N+ WY  Q+
Sbjct:   24 RHHSFSEGTRVEE--LVTPFAQILSSLRNVRNTFVTLTNAKKDKQFKHSCFCTSKC------------SHSFYSW--VANSTLDELDWVLYQLETLQTHTSVSEMASNKFKRLLNRELKDFSEANQSGNQVSAWVYNTFTDKQLEVE-------------------TAQSKTKRDCIRARSRSMVNGVRKLTRL----HSFSGSVPR-------------FGVEVQNESELATILEN-VNKWDFDAFALGEATNGHPMLAVSYTILQARDLLKIFKIKPTTFINYMTLVENHYLKDVPFHNCIHAADVTQTAHVLLSAQAFDNVFTDLEILSAIIASAVHDVDHPGVNNHFLVATNSEMALMYNDESVLENHHLAVAFQLLQHEDCDIFENLSKQERQTARRMIIEMVLATDNAKHMSLLASLKTMVETKKVAGTGSGVLCLENYTDRMQVLKSLVHCADLSNPTKPLPIYRKWVDRLMEEFFRQGDKERDIDGMEISPMMDRHNASIEKSQVVFIDFVAQPLWETWGELVQPDAQDLLDTIEDNRQWYNSQI 523          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO37301 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGA1])

HSP 1 Score: 228.024 bits (580), Expect = 1.513e-67
Identity = 116/288 (40.28%), Postives = 173/288 (60.07%), Query Frame = 3
Query: 1332 WGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDR-SIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELV 2192
            W   +F        H L  I  ++L +R ++  F I  MT+ ++   +E  Y R S PYHN  HAADVT +VH  L    +    ++LE+  ++ +  IHD++H G TN + IN   +LA++YND SVLENHH++ AFR LQ    NI + LN  Q   +R ++ID VLATDMS H   L  +K  +    ++GS + N E       ++Q ++H AD+SNPTK  +++++WT +IMEEFF QGD E +  +++SP+CDR+T  I +SQ+ FIDFIV P     +E++
Sbjct:   81 WTFDVFALSESCEGHPLRYIGYEVLHRRDMLRNFKIHAMTLDRFLQDVETGYKRHSNPYHNDCHAADVTHTVHYFLECMGVSKYLSDLEVFGLLLSAIIHDLEHTGTTNAFHINSRSDLALLYNDRSVLENHHVSCAFRILQDDEKNILSGLNLEQYADVRSLMIDTVLATDMSSHFEQLRLMKVAL----VAGSPIENRE-------VVQLLLHVADISNPTKDWTIHRQWTTKIMEEFFTQGDMEIELGLDVSPLCDRSTTLIPESQIGFIDFIVSPALEVCSEVL 357          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO32142 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVX8])

HSP 1 Score: 206.838 bits (525), Expect = 5.429e-56
Identity = 108/314 (34.39%), Postives = 178/314 (56.69%), Query Frame = 3
Query: 1332 WGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPG-CNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYS------DRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEIS-PMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            W   I + +  +N   L  + LKIL + ++    +I    V  +   IE NY R   YHN+ HAADV  +  V L+ + ++ +   L+ +A + A  +HDV HPG TN +L N G ELAI+YND +VLE+HH A+AF+   +    NIF++L+  +  ++R+ +ID+V+AT+M++H   LS+    +  ++ S +   N  + +      +R  I + ++ CAD++NP +P  L +EW  RI EE+F Q D+E+   + +  P+ DRAT ++ +SQV FID+ V  L+  W    Y    E +  L  N D+++
Sbjct:  523 WDFDILKLEKASNHRPLYFLGLKILNRFRVCEKLNISEDYVKNWLQLIEANYHRKNAYHNSTHAADVLHATAVFLAKERVKAVLEPLDEVASLIAAIVHDVDHPGYTNSFLCNAGSELAILYNDIAVLESHHAALAFKLTARDDKSNIFSNLDVEEFRTVRQAIIDMVMATEMTRHFEHLSKFVNSINKRRSSSTPDSNTSTSTALNTPENRTLIKRMLIKCADIANPARPRYLCKEWAYRIAEEYFSQTDEEKRRGLPVVMPVFDRATCNVPRSQVWFIDYFVSDLYDAWDAFAY--VPETIRHLTDNYDYWK 834          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO43748 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXZ4])

HSP 1 Score: 179.104 bits (453), Expect = 8.971e-50
Identity = 106/333 (31.83%), Postives = 161/333 (48.35%), Query Frame = 3
Query: 1332 WGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSN------------------------------------------------DALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQK-PGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWA 2183
            W   IF  D   + + LV ++ +I +      IF I     + YF  +E  Y  SIPYHN++HA+DV Q V+ L +                                                  AL D+   LE+L++  A A+HD  HPG TN +L+      A++YND SVLENHH A AF  L   P  N    L+  +    R + I+ +LATD+ +H  +LS+          +  G +N++S +DRL  LQ  +  +D+S P+K   ++  WT+RI+EEF+ QGD ER   + +SP  DR    + + Q SFI+ +V PL++++A
Sbjct:   26 WNFPIF--DACEHGNILVQVSYRIFQNAGFFEIFKIPERKFLNYFFALESGY-HSIPYHNSIHASDVLQGVYFLTTAKIPGFCPPGTPQKLGDNESDSDSDSGITSGVLGEGEEDKKDDDGGGDYGALVDVIPLLELLSLYTAAAMHDYDHPGRTNAFLVATLSHQALLYNDRSVLENHHAAAAFTLLMSDPKYNFLCELSPAEFKRFRFLAIEAILATDLKRHFDILSDFNAK------TAEGGVNWDSEADRLLTLQFCIKMSDISGPSKRRDIHTLWTERIVEEFYEQGDDERARGMAVSPYMDRQQPHVAQLQDSFINHLVAPLYNSYA 349          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO32179 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVS5])

HSP 1 Score: 146.362 bits (368), Expect = 2.872e-37
Identity = 78/257 (30.35%), Postives = 146/257 (56.81%), Query Frame = 3
Query: 1419 LMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAEL 2189
            L+  F I+   +  +  ++  +Y+ + P+HN  HA  VTQ ++ L+    + +  T+ ++L ++ +   HD+ HPG  N Y IN   ELA+ YND S LENHH AVAF  +++   NI  +++      +R+ +I  +L+TDM++H  +L++ K++++    SG     F+  + +  ++Q M+  +D+SN  +P+ + + W   +++EFF Q D E+   + ++P  DR   +   +Q+ FI F++ PL+    EL
Sbjct:  197 LLDEFKIERSKLQHFLFEVYRHYNPT-PFHNFRHAFCVTQMMYGLIWLTEIFNKITKQDLLIMLTSALCHDLDHPGYNNAYQINARTELALRYNDISPLENHHCAVAFDIMKQDKSNILQNVSAETFKKIREGMIKCILSTDMARHSDILNKFKELLK----SG---FKFDDEAHKSMLMQIMIKVSDVSNEARPMDVAEPWLDCLLQEFFIQSDVEKLEGLPVAPFMDRDKVTKPSAQIGFIKFVLVPLFEALGEL 445          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde4d (phosphodiesterase 4D [Source:NCBI gene;Acc:101167796])

HSP 1 Score: 466.848 bits (1200), Expect = 1.882e-153
Identity = 249/536 (46.46%), Postives = 338/536 (63.06%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQIS-----QPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            IVTP A +LA L  VR N   LT  +     T  + +            I  ++  ++ ++ +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL +++   ++ ++V ++I S     Q E  +                  TPQ                K+ E        NK  SQIS     Q S  L +  I R  G+  + + ++   L+  +  WGL +F+    +    L V+   I ++R L+  F I   T I Y L +E +Y   + YHN +HAADVTQS HVLLS  ALE +FT+LEILA IFA AIHDV HPGV+NQ+LI+   ELA+MYND+SVLENHHLAV F+ LQ+  C+IF +L K QR SLRK+VID+VLATDMSKHM+LL++LK MVE KK++ SGVL  ++YSDR+++LQNMVHCADLSNPTKPL LY++WT RIMEEFF QGD+ER+  +EISPMCD+  AS+EKSQV FID+I  PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:   97 IVTPFAQVLASLRTVRNNFGALTNVQQERASTKRSPMCNP-------PPITKTTFTEEAYQKLATETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEFISSTFLDKQHEVEM-----------------PTPQTQ--------------KEKEKK------NKPMSQISGVKKLQHSSSLTNSNIPR-FGVKTETEDELAKELE-HVNKWGLNVFKITEFSGNRPLTVMMHTIFQERDLLKTFKIPLDTFITYLLTLEDHYHGDVAYHNNIHAADVTQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLISTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFSQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIAHPLWETWADLVHPDAQDILDTLEDNREWYQ 586          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde4ca (cAMP-specific 3',5'-cyclic phosphodiesterase 4C [Source:NCBI gene;Acc:101161266])

HSP 1 Score: 466.077 bits (1198), Expect = 5.453e-153
Identity = 254/549 (46.27%), Postives = 342/549 (62.30%), Query Frame = 3
Query:  609 PRRHSMSVCTKVSESSIVTPLAIILARLGRVRQNIMTLTGT--RSSNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            P R+  S     SE  IVTP A +LA L  VR N  T+TG   R+ ++  S+N       N        L+   DQ+   +A E+L+EL+WCL QL  ++T+ SV +++  KFK +L+ EL  ++   ++ ++V ++I S      LE+S  MDI  MS     K+    P           SQI                   S + +P+  L    I R  G+    +  +   L+  +  WG+ IF+    +    L V    I ++R L+  F I     I + + +E +Y   + YHN +HAADV QS+HVLLS  ALE +FT+LEILA +FA AIHDV HPGV+NQ+LIN   ELA+MYND SVLENHHLAV F+ LQ+  C+IF  L+K QR SLRK+VID+VLATDMSKHM+LL++LK MVE KK++  GVL  ++YSDR+++LQNMVHCADLSNPTKPL LY++WT RIM EFF QGD+ERD  +EISPMCD+  ASIEK+QV FID+I  PLW TWA+LV+P+AQE+L+TLE N++WYQ
Sbjct:  104 PTRNPSSASDLHSEDMIVTPFAQVLASLRTVRNNFSTITGQQDRTVSKMRSSN-------NPPSVSKTSLAEEPDQQ---LAIETLDELDWCLEQLETLKTRHSVSEMASNKFKRMLNRELTQLSETSRSGNQVSEFISSTF----LEKSHDMDI--MSPPSKEKDKRKRPM----------SQI-------------------SGVRKPTYSLAPSSIPR-FGVNASQEGLLAKQLED-INRWGIDIFKVAEYSGTRPLTVTMYSIFQERDLLKTFKIPVDIFINFVMTLEDHYHSEVAYHNNIHAADVVQSMHVLLSTPALEAVFTDLEILAALFASAIHDVDHPGVSNQFLINTNSELALMYNDMSVLENHHLAVGFKLLQEDQCDIFQDLSKKQRQSLRKMVIDMVLATDMSKHMNLLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLELYRKWTDRIMVEFFTQGDRERDKGMEISPMCDKHNASIEKNQVGFIDYIAHPLWETWADLVHPDAQEILDTLEDNREWYQ 605          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde4d (phosphodiesterase 4D [Source:NCBI gene;Acc:101167796])

HSP 1 Score: 465.692 bits (1197), Expect = 6.335e-153
Identity = 249/536 (46.46%), Postives = 338/536 (63.06%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQIS-----QPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            IVTP A +LA L  VR N   LT  +     T  + +            I  ++  ++ ++ +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL +++   ++ ++V ++I S     Q E  +                  TPQ                K+ E        NK  SQIS     Q S  L +  I R  G+  + + ++   L+  +  WGL +F+    +    L V+   I ++R L+  F I   T I Y L +E +Y   + YHN +HAADVTQS HVLLS  ALE +FT+LEILA IFA AIHDV HPGV+NQ+LI+   ELA+MYND+SVLENHHLAV F+ LQ+  C+IF +L K QR SLRK+VID+VLATDMSKHM+LL++LK MVE KK++ SGVL  ++YSDR+++LQNMVHCADLSNPTKPL LY++WT RIMEEFF QGD+ER+  +EISPMCD+  AS+EKSQV FID+I  PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:  100 IVTPFAQVLASLRTVRNNFGALTNVQQERASTKRSPMCNP-------PPITKTTFTEEAYQKLATETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEFISSTFLDKQHEVEM-----------------PTPQTQ--------------KEKEKK------NKPMSQISGVKKLQHSSSLTNSNIPR-FGVKTETEDELAKELE-HVNKWGLNVFKITEFSGNRPLTVMMHTIFQERDLLKTFKIPLDTFITYLLTLEDHYHGDVAYHNNIHAADVTQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLISTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFSQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIAHPLWETWADLVHPDAQDILDTLEDNREWYQ 589          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde4ca (cAMP-specific 3',5'-cyclic phosphodiesterase 4C [Source:NCBI gene;Acc:101161266])

HSP 1 Score: 463.381 bits (1191), Expect = 2.386e-152
Identity = 251/542 (46.31%), Postives = 341/542 (62.92%), Query Frame = 3
Query:  630 VCTKVSESSIVTPLAIILARLGRVRQNIMTLTGT--RSSNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            + ++ SE  IVTP A +LA L  VR N  T+TG   R+ ++  S+N       N        L+   DQ+   +A E+L+EL+WCL QL  ++T+ SV +++  KFK +L+ EL  ++   ++ ++V ++I S      LE+S  MDI  MS     K+    P           SQI                   S + +P+  L    I R  G+    +  +   L+  +  WG+ IF+    +    L V    I ++R L+  F I     I + + +E +Y   + YHN +HAADV QS+HVLLS  ALE +FT+LEILA +FA AIHDV HPGV+NQ+LIN   ELA+MYND SVLENHHLAV F+ LQ+  C+IF  L+K QR SLRK+VID+VLATDMSKHM+LL++LK MVE KK++  GVL  ++YSDR+++LQNMVHCADLSNPTKPL LY++WT RIM EFF QGD+ERD  +EISPMCD+  ASIEK+QV FID+I  PLW TWA+LV+P+AQE+L+TLE N++WYQ
Sbjct:   82 LSSRHSEDMIVTPFAQVLASLRTVRNNFSTITGQQDRTVSKMRSSN-------NPPSVSKTSLAEEPDQQ---LAIETLDELDWCLEQLETLKTRHSVSEMASNKFKRMLNRELTQLSETSRSGNQVSEFISSTF----LEKSHDMDI--MSPPSKEKDKRKRPM----------SQI-------------------SGVRKPTYSLAPSSIPR-FGVNASQEGLLAKQLED-INRWGIDIFKVAEYSGTRPLTVTMYSIFQERDLLKTFKIPVDIFINFVMTLEDHYHSEVAYHNNIHAADVVQSMHVLLSTPALEAVFTDLEILAALFASAIHDVDHPGVSNQFLINTNSELALMYNDMSVLENHHLAVGFKLLQEDQCDIFQDLSKKQRQSLRKMVIDMVLATDMSKHMNLLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLELYRKWTDRIMVEFFTQGDRERDKGMEISPMCDKHNASIEKNQVGFIDYIAHPLWETWADLVHPDAQEILDTLEDNREWYQ 576          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde4d (phosphodiesterase 4D [Source:NCBI gene;Acc:101167796])

HSP 1 Score: 466.848 bits (1200), Expect = 3.029e-152
Identity = 249/536 (46.46%), Postives = 338/536 (63.06%), Query Frame = 3
Query:  657 IVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQIS-----QPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQ 2249
            IVTP A +LA L  VR N   LT  +     T  + +            I  ++  ++ ++ +A E+LEEL+WCL QL  +QT+ SV +++  KFK +L+ EL +++   ++ ++V ++I S     Q E  +                  TPQ                K+ E        NK  SQIS     Q S  L +  I R  G+  + + ++   L+  +  WGL +F+    +    L V+   I ++R L+  F I   T I Y L +E +Y   + YHN +HAADVTQS HVLLS  ALE +FT+LEILA IFA AIHDV HPGV+NQ+LI+   ELA+MYND+SVLENHHLAV F+ LQ+  C+IF +L K QR SLRK+VID+VLATDMSKHM+LL++LK MVE KK++ SGVL  ++YSDR+++LQNMVHCADLSNPTKPL LY++WT RIMEEFF QGD+ER+  +EISPMCD+  AS+EKSQV FID+I  PLW TWA+LV+P+AQ++L+TLE N++WYQ
Sbjct:  162 IVTPFAQVLASLRTVRNNFGALTNVQQERASTKRSPMCNP-------PPITKTTFTEEAYQKLATETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEFISSTFLDKQHEVEM-----------------PTPQTQ--------------KEKEKK------NKPMSQISGVKKLQHSSSLTNSNIPR-FGVKTETEDELAKELE-HVNKWGLNVFKITEFSGNRPLTVMMHTIFQERDLLKTFKIPLDTFITYLLTLEDHYHGDVAYHNNIHAADVTQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLISTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFSQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIAHPLWETWADLVHPDAQDILDTLEDNREWYQ 651          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000058236.1 (SMESG000058236.1)

HSP 1 Score: 1595.48 bits (4130), Expect = 0.000e+0
Identity = 767/771 (99.48%), Postives = 770/771 (99.87%), Query Frame = 3
Query:   93 MWCLCGCPQKPNDHISLSKKKTDSSAADLHANVCELFEGRRRSSAGYVQLLHQDLHHSSDESRTQNVSTIPIKTHRRHFKSCFPNRKRQVVFNLTTARTNLDKNITLAETNLCNESTPLTNDNSIVEANHIIEEEKDSHIKETLGSVEKNCLIDNQMMNFNMTISPINSRGYPRRHSMSVCTKVSESSIVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQFQLSMLKKNQEQSSDTSKSNTTLKQKPKLFKIKSMSVNTHSSIEEERDENVR 2405
            MWCLCGCPQKPNDHISLSKKKTDSSAADLHANVCELFEGRRRSSAGYVQLLHQDLHHSSDESRTQNVSTIP+KTHRRHFKSCFPNRKRQ+VFNLTTARTNLDKNITLAETNLCNESTPLTNDNSIVEANHIIEEEKDSHIKETL SVEKNCLIDNQMMNFNMTISPINSRGYPRRHSMSVCTKVSESSIVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIE+NYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQFQLSMLKKNQEQSSDTSKSNTTLKQKPKLFKIKSMSVNTHSSIEEERDENVR
Sbjct:    1 MWCLCGCPQKPNDHISLSKKKTDSSAADLHANVCELFEGRRRSSAGYVQLLHQDLHHSSDESRTQNVSTIPMKTHRRHFKSCFPNRKRQIVFNLTTARTNLDKNITLAETNLCNESTPLTNDNSIVEANHIIEEEKDSHIKETLASVEKNCLIDNQMMNFNMTISPINSRGYPRRHSMSVCTKVSESSIVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEVNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQFQLSMLKKNQEQSSDTSKSNTTLKQKPKLFKIKSMSVNTHSSIEEERDENVR 771          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000032148.1 (SMESG000032148.1)

HSP 1 Score: 503.056 bits (1294), Expect = 6.623e-169
Identity = 263/559 (47.05%), Postives = 372/559 (66.55%), Query Frame = 3
Query:  645 SESSIVTPLAIILARLGRVRQNIMTLTGTRSSN--RFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYI-KSFLNS---NQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLH-----------DHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQFQLSMLK 2270
            S+  IVTP A ILA L  VR N + +T  +SS   RF S +     +     SED+ +    D   +++  E+LEELEWCL +L ++QT +SV D++  KFK++L++EL   A++ K+ +++ DYI  +FL++   N L+++ +           Y++ D        P   GSS+  +++ SE+ +     +   S IS     +H           D E     GI    ++++   +++ L +WG+ IF    L++ + L VI+  +  K +L   FSI     + +  +IE  Y + +PYHN+ HAADVTQS +VLL   +LE++F++LEI+AVIFAC IHDV HPGVTNQYLIN   +LA+MYND SVLENHHL+VAF  L  P C+I  +L K QR S RK+VID+VLATDMSKHMSLL++LK MVE KK++GSG+LN ++Y+DR++ILQNMVHCADLSNPTKPL+LY+ WT++IM+EFFRQGDKER+  +EISPMCDR TA++EKSQVSFIDFIV PLW TW++LVYP AQ++L+TLE N++WY  Q+S ++
Sbjct:   72 SDDLIVTPFAQILASLRNVRANFILITNVQSSREARFGSISASSHTLR----SEDLKIEG--DDSQRSLTMETLEELEWCLERLESMQTHRSVSDMASSKFKKILNKELSQYADQSKSGNQISDYICTTFLDADGDNSLDQTSE-----------YEDTD--------PPRRGSSREELDEHSETDESERYADGAPSLISNEHQKIHKQTISFKPIFVDIENVSTFGINSTRNVEMTEIIETTLDTWGMDIFLVSTLSDNNPLTVISFALFRKYKLFEKFSIQSSIFLSFITEIENKYHKDVPYHNSTHAADVTQSTNVLLGALSLENVFSDLEIMAVIFACIIHDVDHPGVTNQYLINTNDQLALMYNDASVLENHHLSVAFTVLSLPNCDIITNLTKKQRQSFRKMVIDMVLATDMSKHMSLLADLKTMVETKKVAGSGILNLDNYNDRIQILQNMVHCADLSNPTKPLNLYRSWTEKIMQEFFRQGDKEREKNLEISPMCDRETATVEKSQVSFIDFIVHPLWETWSDLVYPEAQDILDTLEKNREWYFSQISKIE 605          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000032148.1 (SMESG000032148.1)

HSP 1 Score: 505.368 bits (1300), Expect = 1.080e-168
Identity = 267/578 (46.19%), Postives = 380/578 (65.74%), Query Frame = 3
Query:  588 PINSRGYPRRHSMSVCTKVSESSIVTPLAIILARLGRVRQNIMTLTGTRSSN--RFTSTNVILKKILNVKISEDIILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYI-KSFLNS---NQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLH-----------DHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQFQLSMLK 2270
            P  +    RR S+ +  + S+  IVTP A ILA L  VR N + +T  +SS   RF S +     +     SED+ +    D   +++  E+LEELEWCL +L ++QT +SV D++  KFK++L++EL   A++ K+ +++ DYI  +FL++   N L+++ +           Y++ D        P   GSS+  +++ SE+ +     +   S IS     +H           D E     GI    ++++   +++ L +WG+ IF    L++ + L VI+  +  K +L   FSI     + +  +IE  Y + +PYHN+ HAADVTQS +VLL   +LE++F++LEI+AVIFAC IHDV HPGVTNQYLIN   +LA+MYND SVLENHHL+VAF  L  P C+I  +L K QR S RK+VID+VLATDMSKHMSLL++LK MVE KK++GSG+LN ++Y+DR++ILQNMVHCADLSNPTKPL+LY+ WT++IM+EFFRQGDKER+  +EISPMCDR TA++EKSQVSFIDFIV PLW TW++LVYP AQ++L+TLE N++WY  Q+S ++
Sbjct:  136 PTTTVAASRRGSLYIF-RHSDDLIVTPFAQILASLRNVRANFILITNVQSSREARFGSISASSHTLR----SEDLKIEG--DDSQRSLTMETLEELEWCLERLESMQTHRSVSDMASSKFKKILNKELSQYADQSKSGNQISDYICTTFLDADGDNSLDQTSE-----------YEDTD--------PPRRGSSREELDEHSETDESERYADGAPSLISNEHQKIHKQTISFKPIFVDIENVSTFGINSTRNVEMTEIIETTLDTWGMDIFLVSTLSDNNPLTVISFALFRKYKLFEKFSIQSSIFLSFITEIENKYHKDVPYHNSTHAADVTQSTNVLLGALSLENVFSDLEIMAVIFACIIHDVDHPGVTNQYLINTNDQLALMYNDASVLENHHLSVAFTVLSLPNCDIITNLTKKQRQSFRKMVIDMVLATDMSKHMSLLADLKTMVETKKVAGSGILNLDNYNDRIQILQNMVHCADLSNPTKPLNLYRSWTEKIMQEFFRQGDKEREKNLEISPMCDRETATVEKSQVSFIDFIVHPLWETWSDLVYPEAQDILDTLEKNREWYFSQISKIE 687          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000077093.1 (SMESG000077093.1)

HSP 1 Score: 492.271 bits (1266), Expect = 1.245e-163
Identity = 267/607 (43.99%), Postives = 396/607 (65.24%), Query Frame = 3
Query:  537 KNCLIDNQMMNFN--MTISPINSR------GYPRRHSMSVCTKVSESSIVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILNVKISEDI------ILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYI-KSFLNSNQLEESL------KMDIKQMSVAQFYKNADATPQI--HSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQFQLSMLKKNQEQS 2288
            K+   D++ M++N   ++   NSR         RR S+ +  + ++  I+TP A ILA L +VR N M +T   S++   +    L  I + KI E+       I  SH+      +A+E+L ELEWCL +L N+QT +SV D++  KFK++++ EL   A+  K+  ++ DYI K+FL+S QL++S+      + DI        +++   + ++   S   ++ +S ++ +    +  ++  P   + + S+  V LH        G+   N+ +++  LDS L  WG+ +F F  +T    L V++  I +   L++ F ID  T++++ ++ E +Y  ++PYHN +HAADVTQS +VLL+  ALE++F++LEIL+VIFA  IHD+ HPGVTNQYL+N  +ELA +YND SVLENHHLA+AF  L K  C+  A+L+K  R S+R++VID+VLATDMSKHM+LL++LK MVE KK++GSG+L  ++Y+DR++ILQN+VHCADLSNPTKPL +YQ+W  R+MEEF+ QGDKER+S++EISPMCDR TAS+EKSQVSFIDFIV PLW TW+ELVYP+ Q MLE LE N+ +Y        K+QE+S
Sbjct:  110 KSIRFDDENMDYNSSFSVKRQNSRFRKPFVATSRRGSLYIF-RNADDVIITPFAQILASLRKVRANFMLITNITSNDEKKNK---LDSINSPKIEENCSTNNKNITESHE-----KVAQETLNELEWCLNRLENIQTHRSVSDMASTKFKQIINRELSQFADSSKSGHQISDYICKTFLDS-QLDDSIPEASSFERDIDDRKGKGKFESVRRSTKLVKASTEPVLNNSNLVTDSVLNASFVIEAPE--NDEDSETDVPLH--------GVHVANEEEVSKILDSDLKKWGMNLFSFADVTADQPLAVVSYTIFKDLNLINKFQIDSKTLVQFLIKAERSYRNTVPYHNNMHAADVTQSANVLLAGQALENVFSDLEILSVIFASIIHDMDHPGVTNQYLVNTNNELATLYNDNSVLENHHLAMAFSLLAKEECDFLATLSKRHRQSMRRMVIDMVLATDMSKHMTLLADLKTMVETKKVAGSGILTLDTYTDRIQILQNLVHCADLSNPTKPLHIYQKWIDRVMEEFYLQGDKERESELEISPMCDRQTASLEKSQVSFIDFIVHPLWETWSELVYPDTQGMLEALEENRQFY------FNKSQEKS 690          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000077093.1 (SMESG000077093.1)

HSP 1 Score: 492.271 bits (1266), Expect = 1.325e-163
Identity = 267/607 (43.99%), Postives = 396/607 (65.24%), Query Frame = 3
Query:  537 KNCLIDNQMMNFN--MTISPINSR------GYPRRHSMSVCTKVSESSIVTPLAIILARLGRVRQNIMTLTGTRSSNRFTSTNVILKKILNVKISEDI------ILSSHQDQKWKNMARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKTCSEVVDYI-KSFLNSNQLEESL------KMDIKQMSVAQFYKNADATPQI--HSQPDLIGSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKNDIKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSIDPMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTELEILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAFRFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVEGKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIMEEFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELVYPNAQEMLETLESNKDWYQFQLSMLKKNQEQS 2288
            K+   D++ M++N   ++   NSR         RR S+ +  + ++  I+TP A ILA L +VR N M +T   S++   +    L  I + KI E+       I  SH+      +A+E+L ELEWCL +L N+QT +SV D++  KFK++++ EL   A+  K+  ++ DYI K+FL+S QL++S+      + DI        +++   + ++   S   ++ +S ++ +    +  ++  P   + + S+  V LH        G+   N+ +++  LDS L  WG+ +F F  +T    L V++  I +   L++ F ID  T++++ ++ E +Y  ++PYHN +HAADVTQS +VLL+  ALE++F++LEIL+VIFA  IHD+ HPGVTNQYL+N  +ELA +YND SVLENHHLA+AF  L K  C+  A+L+K  R S+R++VID+VLATDMSKHM+LL++LK MVE KK++GSG+L  ++Y+DR++ILQN+VHCADLSNPTKPL +YQ+W  R+MEEF+ QGDKER+S++EISPMCDR TAS+EKSQVSFIDFIV PLW TW+ELVYP+ Q MLE LE N+ +Y        K+QE+S
Sbjct:  112 KSIRFDDENMDYNSSFSVKRQNSRFRKPFVATSRRGSLYIF-RNADDVIITPFAQILASLRKVRANFMLITNITSNDEKKNK---LDSINSPKIEENCSTNNKNITESHE-----KVAQETLNELEWCLNRLENIQTHRSVSDMASTKFKQIINRELSQFADSSKSGHQISDYICKTFLDS-QLDDSIPEASSFERDIDDRKGKGKFESVRRSTKLVKASTEPVLNNSNLVTDSVLNASFVIEAPE--NDEDSETDVPLH--------GVHVANEEEVSKILDSDLKKWGMNLFSFADVTADQPLAVVSYTIFKDLNLINKFQIDSKTLVQFLIKAERSYRNTVPYHNNMHAADVTQSANVLLAGQALENVFSDLEILSVIFASIIHDMDHPGVTNQYLVNTNNELATLYNDNSVLENHHLAMAFSLLAKEECDFLATLSKRHRQSMRRMVIDMVLATDMSKHMTLLADLKTMVETKKVAGSGILTLDTYTDRIQILQNLVHCADLSNPTKPLHIYQKWIDRVMEEFYLQGDKERESELEISPMCDRQTASLEKSQVSFIDFIVHPLWETWSELVYPDTQGMLEALEENRQFY------FNKSQEKS 692          
The following BLAST results are available for this feature:
BLAST of Phosphodiesterase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDE4D1.044e-15346.24phosphodiesterase 4D [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE4D1.588e-15346.24phosphodiesterase 4D [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE4D1.684e-15346.24phosphodiesterase 4D [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE4D1.798e-15346.24phosphodiesterase 4D [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE4D1.821e-15346.24phosphodiesterase 4D [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde-41.875e-15343.64Probable 3',5'-cyclic phosphodiesterase pde-4 [So... [more]
pde-46.259e-15244.16Probable 3',5'-cyclic phosphodiesterase pde-4 [So... [more]
pde-46.341e-15244.16Probable 3',5'-cyclic phosphodiesterase pde-4 [So... [more]
pde-48.034e-15244.16Probable 3',5'-cyclic phosphodiesterase pde-4 [So... [more]
pde-41.049e-15144.16Probable 3',5'-cyclic phosphodiesterase pde-4 [So... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnc6.143e-15044.12gene:FBgn0000479 transcript:FBtr0070518[more]
dnc6.143e-15044.12gene:FBgn0000479 transcript:FBtr0333312[more]
dnc1.052e-14944.12gene:FBgn0000479 transcript:FBtr0070521[more]
dnc3.917e-14944.12gene:FBgn0000479 transcript:FBtr0070517[more]
dnc4.124e-14944.12gene:FBgn0000479 transcript:FBtr0333317[more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde4d1.022e-15546.75phosphodiesterase 4D, cAMP-specific [Source:ZFIN;A... [more]
pde4d1.557e-15546.75phosphodiesterase 4D, cAMP-specific [Source:ZFIN;A... [more]
BX510928.28.034e-15546.57phosphodiesterase 4D, cAMP-specific [Source:NCBI g... [more]
pde4ca4.799e-15246.35phosphodiesterase 4C, cAMP-specific a [Source:ZFIN... [more]
pde4ca5.381e-15246.53phosphodiesterase 4C, cAMP-specific a [Source:ZFIN... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDE4D6.952e-15546.57phosphodiesterase 4D [Source:NCBI gene;Acc:1004964... [more]
PDE4D3.752e-15446.92phosphodiesterase 4D [Source:NCBI gene;Acc:1004964... [more]
PDE4D5.220e-15446.92phosphodiesterase 4D [Source:NCBI gene;Acc:1004964... [more]
PDE4D6.247e-15446.07phosphodiesterase 4D [Source:NCBI gene;Acc:1004964... [more]
PDE4D7.474e-15446.92phosphodiesterase 4D [Source:NCBI gene;Acc:1004964... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pde4d3.813e-15446.24phosphodiesterase 4D, cAMP specific [Source:MGI Sy... [more]
Pde4d8.308e-15446.24phosphodiesterase 4D, cAMP specific [Source:MGI Sy... [more]
Pde4d1.399e-15346.24phosphodiesterase 4D, cAMP specific [Source:MGI Sy... [more]
Pde4d2.023e-15346.24phosphodiesterase 4D, cAMP specific [Source:MGI Sy... [more]
Pde4d2.140e-15346.24phosphodiesterase 4D, cAMP specific [Source:MGI Sy... [more]
back to top
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P14644|PDE4C_RAT1.610e-15444.40cAMP-specific 3',5'-cyclic phosphodiesterase 4C (F... [more]
sp|Q01063|PDE4D_MOUSE1.774e-15246.24cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS... [more]
sp|Q3UEI1|PDE4C_MOUSE7.301e-15244.78cAMP-specific 3',5'-cyclic phosphodiesterase 4C OS... [more]
sp|Q08499|PDE4D_HUMAN1.214e-15146.43cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS... [more]
sp|P14270|PDE4D_RAT3.079e-15146.05cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS... [more]
back to top
BLAST of Phosphodiesterase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7YDS51.648e-16546.39Phosphodiesterase OS=Clonorchis sinensis OX=79923 ... [more]
A0A0L8HYP66.550e-16447.62Phosphodiesterase (Fragment) OS=Octopus bimaculoid... [more]
G4VPI61.130e-16246.92Phosphodiesterase OS=Schistosoma mansoni OX=6183 G... [more]
A0A3Q0KMA34.919e-16244.46Phosphodiesterase OS=Schistosoma mansoni OX=6183 P... [more]
A0A2T7NPC94.731e-16046.45Phosphodiesterase OS=Pomacea canaliculata OX=40072... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDE4D7.315e-15146.42phosphodiesterase 4D [Source:HGNC Symbol;Acc:HGNC:... [more]
pde4cb3.745e-14945.14phosphodiesterase 4C [Source:NCBI gene;Acc:1030443... [more]
pde4cb5.211e-14945.14phosphodiesterase 4C [Source:NCBI gene;Acc:1030443... [more]
pde4cb6.554e-14945.14phosphodiesterase 4C [Source:NCBI gene;Acc:1030443... [more]
pde4cb9.658e-14945.14phosphodiesterase 4C [Source:NCBI gene;Acc:1030443... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007435.13.843e-9466.83pep scaffold:Pmarinus_7.0:GL486982:1709:8825:-1 ge... [more]
pde4ba3.709e-6937.22phosphodiesterase 4B, cAMP-specific a [Source:ZFIN... [more]
ENSPMAT00000007498.11.102e-6870.00pep scaffold:Pmarinus_7.0:GL486417:1684:4657:1 gen... [more]
pde1a3.454e-6538.93phosphodiesterase 1A, calmodulin-dependent [Source... [more]
pde7a3.402e-6337.18phosphodiesterase 7A [Source:ZFIN;Acc:ZDB-GENE-031... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PDE25.744e-1027.08High-affinity cyclic AMP phosphodiesterase; compon... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461337.836e-14441.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373011.513e-6740.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO321425.429e-5634.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437488.971e-5031.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO321792.872e-3730.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde4d1.882e-15346.46phosphodiesterase 4D [Source:NCBI gene;Acc:1011677... [more]
pde4ca5.453e-15346.27cAMP-specific 3',5'-cyclic phosphodiesterase 4C [S... [more]
pde4d6.335e-15346.46phosphodiesterase 4D [Source:NCBI gene;Acc:1011677... [more]
pde4ca2.386e-15246.31cAMP-specific 3',5'-cyclic phosphodiesterase 4C [S... [more]
pde4d3.029e-15246.46phosphodiesterase 4D [Source:NCBI gene;Acc:1011677... [more]
back to top
BLAST of Phosphodiesterase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058236.10.000e+099.48SMESG000058236.1[more]
SMESG000032148.16.623e-16947.05SMESG000032148.1[more]
SMESG000032148.11.080e-16846.19SMESG000032148.1[more]
SMESG000077093.11.245e-16343.99SMESG000077093.1[more]
SMESG000077093.11.325e-16343.99SMESG000077093.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020724 ID=SMED30020724|Name=Phosphodiesterase|organism=Schmidtea mediterranea sexual|type=transcript|length=2501bp
CTTCCGATCTTTTTCTTTTAATTTACATTTTCTGTTGATTAAACTGATTT
TTAGTGGAATTTCAAAGTGGAAAACCTCACTATAAAAGGACTATGTGGTG
CCTCTGTGGATGTCCACAAAAGCCTAATGACCATATATCGTTATCAAAAA
AGAAAACTGATTCTTCTGCTGCAGATCTTCATGCAAATGTCTGTGAATTA
TTCGAAGGCCGTCGGCGCTCGTCAGCTGGATATGTTCAACTTCTTCATCA
AGATCTTCACCATTCATCGGATGAAAGCCGTACACAAAACGTTTCGACAA
TTCCAATAAAAACCCATAGGCGACACTTCAAATCATGTTTTCCGAATCGT
AAACGGCAAGTCGTATTTAATTTGACAACGGCCAGAACTAATTTAGACAA
AAACATCACTTTAGCTGAGACCAATTTATGCAACGAATCAACCCCTTTGA
CAAATGACAATTCAATAGTCGAAGCCAATCACATCATAGAAGAAGAAAAA
GACAGTCATATCAAAGAAACTCTTGGGTCTGTGGAAAAGAACTGTTTAAT
AGATAATCAAATGATGAACTTCAATATGACGATCAGTCCGATAAATTCTC
GCGGATATCCCCGACGACATTCAATGTCAGTTTGCACAAAGGTTTCTGAA
TCTTCTATTGTCACTCCATTAGCCATCATCCTGGCCAGACTGGGACGCGT
ACGACAAAATATAATGACACTTACAGGAACTCGCTCATCTAACAGATTTA
CTTCCACTAACGTTATTTTGAAGAAAATTCTCAATGTAAAAATCAGTGAA
GACATTATATTGTCTTCTCATCAAGATCAGAAATGGAAAAACATGGCTAG
GGAATCACTAGAAGAATTGGAATGGTGCCTGCTTCAGTTGACAAATGTTC
AAACCAAACAATCAGTTGGAGATATTTCAATGGAAAAGTTTAAAGAAGTC
CTTGATGAAGAACTCATGAATGTTGCCAACAAATTCAAGACCTGTTCAGA
GGTTGTTGATTACATCAAATCATTTTTAAATTCTAATCAATTGGAAGAAT
CCCTCAAAATGGATATAAAACAAATGTCAGTCGCACAATTTTATAAGAAT
GCGGACGCAACTCCTCAAATACATTCCCAGCCGGATCTGATCGGAAGTAG
TCAGATTATGATGAATAAAGATTCCGAATCGCCAAAAATGGTATATTTGC
CAAATAAATTCTCCAGTCAGATATCCCAACCATCAGTATGTTTGCATGAC
CATGAAATCTATCGCAATCTTGGAATTTGTCCAAAAAACGACATAAAAAT
TAATAATACTCTGGATTCATTTTTGGGTTCATGGGGCTTGCAGATCTTTG
AATTCGACGTCCTTACTAATCAGCACTCTTTAGTTGTTATTACATTGAAA
ATTCTAGAAAAGCGTCAACTGATGAGCATTTTCTCCATTGACCCCATGAC
AGTTATAAAATATTTCTTGCAAATTGAAATGAATTATGATAGATCAATTC
CTTATCACAATGCGGTCCATGCCGCAGATGTTACGCAATCAGTACATGTC
CTGCTGTCCAACGACGCTTTAGAAGATATCTTCACAGAATTGGAAATTCT
TGCTGTTATATTTGCGTGCGCAATTCATGACGTCCAGCATCCAGGAGTGA
CGAACCAATATCTCATTAATATAGGTCACGAATTAGCTATTATGTACAAT
GATACTTCCGTTCTCGAAAATCATCATTTGGCCGTCGCATTCAGATTTCT
TCAAAAGCCCGGATGCAATATTTTTGCTTCTTTGAATAAAACTCAGAGAT
ATTCACTAAGGAAAATCGTTATAGATTTAGTTCTTGCCACTGATATGTCA
AAACACATGTCATTGCTGTCGGAGCTCAAACAAATGGTCGAAGGGAAAAA
ATTATCCGGATCTGGAGTATTGAATTTTGAAAGCTATTCAGACAGATTGC
GAATTTTACAAAATATGGTTCACTGTGCTGATCTTAGCAATCCAACTAAA
CCATTGTCACTATATCAAGAATGGACTCAAAGAATTATGGAAGAATTCTT
TCGACAAGGCGACAAAGAAAGAGATTCGAAAGTAGAGATCAGTCCAATGT
GTGATAGAGCAACTGCGTCGATTGAGAAGTCTCAAGTTAGCTTTATTGAT
TTTATTGTGCGACCTTTATGGTCGACCTGGGCCGAATTGGTGTACCCGAA
TGCTCAAGAAATGCTCGAGACATTAGAATCAAACAAGGATTGGTATCAGT
TTCAACTTTCGATGTTAAAAAAAAATCAAGAACAATCGAGTGATACATCA
AAATCGAACACAACATTAAAACAAAAACCAAAATTATTTAAAATCAAATC
TATGTCGGTAAATACGCATTCTTCAATAGAAGAGGAAAGAGATGAAAACG
TTCGTTGAATTGTGACCTGTGAATAATTTGTGGTATAAATAGTTTGTTAG
AGATCATTTTGCTTTGTAAATGGTTTTGTTTAGTCCAGTCTTCATTGAGA
T
back to top

protein sequence of SMED30020724-orf-1

>SMED30020724-orf-1 ID=SMED30020724-orf-1|Name=SMED30020724-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=772bp
MWCLCGCPQKPNDHISLSKKKTDSSAADLHANVCELFEGRRRSSAGYVQL
LHQDLHHSSDESRTQNVSTIPIKTHRRHFKSCFPNRKRQVVFNLTTARTN
LDKNITLAETNLCNESTPLTNDNSIVEANHIIEEEKDSHIKETLGSVEKN
CLIDNQMMNFNMTISPINSRGYPRRHSMSVCTKVSESSIVTPLAIILARL
GRVRQNIMTLTGTRSSNRFTSTNVILKKILNVKISEDIILSSHQDQKWKN
MARESLEELEWCLLQLTNVQTKQSVGDISMEKFKEVLDEELMNVANKFKT
CSEVVDYIKSFLNSNQLEESLKMDIKQMSVAQFYKNADATPQIHSQPDLI
GSSQIMMNKDSESPKMVYLPNKFSSQISQPSVCLHDHEIYRNLGICPKND
IKINNTLDSFLGSWGLQIFEFDVLTNQHSLVVITLKILEKRQLMSIFSID
PMTVIKYFLQIEMNYDRSIPYHNAVHAADVTQSVHVLLSNDALEDIFTEL
EILAVIFACAIHDVQHPGVTNQYLINIGHELAIMYNDTSVLENHHLAVAF
RFLQKPGCNIFASLNKTQRYSLRKIVIDLVLATDMSKHMSLLSELKQMVE
GKKLSGSGVLNFESYSDRLRILQNMVHCADLSNPTKPLSLYQEWTQRIME
EFFRQGDKERDSKVEISPMCDRATASIEKSQVSFIDFIVRPLWSTWAELV
YPNAQEMLETLESNKDWYQFQLSMLKKNQEQSSDTSKSNTTLKQKPKLFK
IKSMSVNTHSSIEEERDENVR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036971PDEase_catalytic_dom_sf
IPR040844PDE4_UCR
IPR023088PDEase
IPR003607HD/PDEase_dom
IPR002073PDEase_catalytic_dom
IPR023174PDEase_CS
Vocabulary: molecular function
TermDefinition
GO:0008081phosphoric diester hydrolase activity
GO:00041143',5'-cyclic-nucleotide phosphodiesterase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR0230883'5'-cyclic nucleotide phosphodiesterasePRINTSPR00387PDIESTERASE1coord: 626..639
score: 56.29
coord: 498..511
score: 55.86
coord: 467..480
score: 54.29
coord: 643..659
score: 57.06
coord: 512..527
score: 49.88
coord: 539..555
score: 55.53
IPR003607HD/PDEase domainSMARTSM00471hd_13coord: 469..644
e-value: 2.2E-4
score: 30.5
IPR003607HD/PDEase domainCDDcd00077HDccoord: 471..653
e-value: 1.31214E-12
score: 63.8977
IPR0369713'5'-cyclic nucleotide phosphodiesterase, catalytic domain superfamilyGENE3DG3DSA:1.10.1300.10coord: 402..751
e-value: 2.0E-132
score: 443.5
IPR0020733'5'-cyclic nucleotide phosphodiesterase, catalytic domainPFAMPF00233PDEase_Icoord: 471..712
e-value: 8.3E-90
score: 300.7
IPR0020733'5'-cyclic nucleotide phosphodiesterase, catalytic domainPROSITEPS51845PDEASE_I_2coord: 375..725
score: 129.318
IPR040844Phosphodiesterase 4 upstream conserved regions (UCR)PFAMPF18100PDE4_UCRcoord: 190..312
e-value: 3.2E-22
score: 79.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 729..758
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 729..771
NoneNo IPR availablePANTHERPTHR11347:SF135CAMP-SPECIFIC 3',5'-CYCLIC PHOSPHODIESTERASE 4Ccoord: 184..319
NoneNo IPR availablePANTHERPTHR11347:SF135CAMP-SPECIFIC 3',5'-CYCLIC PHOSPHODIESTERASE 4Ccoord: 413..744
NoneNo IPR availablePANTHERPTHR11347CYCLIC NUCLEOTIDE PHOSPHODIESTERASEcoord: 184..319
NoneNo IPR availablePANTHERPTHR11347CYCLIC NUCLEOTIDE PHOSPHODIESTERASEcoord: 413..744
NoneNo IPR availableSUPERFAMILYSSF109604HD-domain/PDEase-likecoord: 409..753
IPR0231743'5'-cyclic nucleotide phosphodiesterase, conserved sitePROSITEPS00126PDEASE_I_1coord: 512..523