slc7a-4

Overview
Nameslc7a-4 (AKN21448.1)
Smed IDSMED30020714
Length (bp)2995
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc7a-4 (SMED30020714) t-SNE clustered cells

Violin plots show distribution of expression levels for slc7a-4 (SMED30020714) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc7a-4 (SMED30020714) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc7a-4 (SMED30020714) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020714

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30020714h1SMcG0020798 SmedASXL_071241SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30020714h1SMcG0020798 Contig54107uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020714h1SMcG0020798 Contig54107newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30020714h1SMcG0020798 dd_Smed_v4_4211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020714h1SMcG0020798 dd_Smed_v4_4211_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc7a-4 vs. Ensembl Human
Match: SLC7A11 (solute carrier family 7 member 11 [Source:HGNC Symbol;Acc:HGNC:11059])

HSP 1 Score: 211.46 bits (537), Expect = 1.094e-58
Identity = 134/311 (43.09%), Postives = 199/311 (63.99%), Query Frame = 3
Query:  921 INCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKIT 1853
            +N  +V W+ ++ I  T  K+ A+LIIIV G + LI+G T++F D FSG       +P+AFY G +AY+GW YLNF+T E++NPEK +PLAI +S+ ++T+ Y+L NVAY   ++ +E+LL    S AVAV F++R +G  S  +PIFV +S FGSMN  + ++SRL    + E  +PE+L+M+  +  TP+PAVI++  LT++  F  +   L+    FA  +   +AV  L+YLRYKCPD+ RPFK+P+ +P LF    LF+  L++Y  PF + I   + L  +P Y +FI W KKPR    +  KIT
Sbjct:  179 LNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLL----SNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKIT 485          
BLAST of slc7a-4 vs. Ensembl Human
Match: SLC7A5 (solute carrier family 7 member 5 [Source:HGNC Symbol;Acc:HGNC:11063])

HSP 1 Score: 186.808 bits (473), Expect = 5.550e-50
Identity = 126/315 (40.00%), Postives = 206/315 (65.40%), Query Frame = 3
Query:  918 AINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDP---FSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKIT 1853
            A+NCY+V+ AT++   F  +K+LAL +II++G V + +G+  + +DP   F G+     +I +A Y G +AY GWNYLNF+T EM NP +NLPLAII+SL ++T+VY+L N+AY   LS +++L    SS AVAV+F +  +GVMSW++P+FVG+S FGS+N  L + SRL   G+ E  +P +L+M+  + LTP+P+++   ++T+L+ F ++ F +I    F   +  A+A+  +++LR++ P+L RP K+ + +PV F+LA LF+  ++ ++ P +  I   ++L  +PVY   + W  KP+ L   I   T
Sbjct:  184 AVNCYSVKAATRVQDAFAAAKLLALALIILLGFVQIGKGDVSN-LDPNFSFEGTKLDVGNIVLALYSGLFAYGGWNYLNFVTEEMINPYRNLPLAIIISLPIVTLVYVLTNLAYFTTLSTEQML----SSEAVAVDFGNYHLGVMSWIIPVFVGLSCFGSVNGSLFTSSRLFFVGSREGHLPSILSMIHPQLLTPVPSLVFTCVMTLLYAFSKDIFSVINFFSFFNWLCVALAIIGMIWLRHRKPELERPIKVNLALPVFFILACLFLIAVSFWKTPVECGIGFTIILSGLPVYFFGVWWKNKPKWLLQGIFSTT 493          
BLAST of slc7a-4 vs. Ensembl Human
Match: SLC7A8 (solute carrier family 7 member 8 [Source:HGNC Symbol;Acc:HGNC:11066])

HSP 1 Score: 182.57 bits (462), Expect = 2.503e-49
Identity = 124/320 (38.75%), Postives = 194/320 (60.62%), Query Frame = 3
Query:  921 INCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNT---------ESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKIT 1853
            +NC +V+WAT++  +FT  K+LAL +II++G V + +G           E+F +P  G       + +AF QG +AY GWN+LN++T E+ +P KNLP AI +S+ L+T VY+  NVAY+  +SPQE+L    +S AVAV F ++ +GVM+W+MPI V +S FG +N  L + SRL   GA E  +P VLAM+  K  TP+PA++   + T+L     + + LI   GF   +   + V   + LR+K PD+PRP K+ ++ P+++LL   F+   +++ +P    I L +ML  +PVY + + W  KP+  +D I  +T
Sbjct:   70 VNCSSVRWATRVQDIFTAGKLLALALIIIMGIVQICKGEYFWLEPKNAFENFQEPDIGL------VALAFLQGSFAYGGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVYVFANVAYVTAMSPQELL----ASNAVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSVLAMIHVKRCTPIPALLFTCISTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDIPRPIKINLLFPIIYLLFWAFLLVFSLWSEPVVCGIGLAIMLTGVPVYFLGVYWQHKPKCFSDFIELLT 379          
BLAST of slc7a-4 vs. Ensembl Human
Match: SLC7A6 (solute carrier family 7 member 6 [Source:HGNC Symbol;Acc:HGNC:11064])

HSP 1 Score: 183.341 bits (464), Expect = 9.759e-49
Identity = 117/320 (36.56%), Postives = 201/320 (62.81%), Query Frame = 3
Query:  900 CVVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYI--IFIAWTKKPRSLTDLISKIT 1853
            C+  L  +NC  V+W T++   FT +KV+AL+ IIV+G V L +G++E F D F GS +   ++ +A Y   ++YSGW+ LNF+T E+KNPE+NLPLAI +S+ ++T++Y+L NVAY  VL+  ++L    SS AVAV FAD+T G+ SW +PI V +S FG +N+ + + SRL   G+ E  +P++L+M+  +  TP+PA++    + +++    + F LI    F++     ++V   LYLR+K P  PRP KL +  P++F +  +F+  + ++    +S I + + L  +P Y   +++  +++P  + ++++ IT
Sbjct:  173 CICLLTFVNCAYVKWGTRVQDTFTYAKVVALIAIIVMGLVKLCQGHSEHFQDAFEGSSWDMGNLSLALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTLIYILTNVAYYTVLNISDVL----SSDAVAVTFADQTFGMFSWTIPIAVALSCFGGLNASIFASSRLFFVGSREGHLPDLLSMIHIERFTPIPALLFNCTMALIYLIVEDVFQLINYFSFSYWFFVGLSVVGQLYLRWKEPKRPRPLKLSVFFPIVFCICSVFLVIVPLFTDTINSLIGIGIALSGVPFYFMGVYLPESRRPLFIRNVLAAIT 488          
BLAST of slc7a-4 vs. Ensembl Human
Match: SLC7A6 (solute carrier family 7 member 6 [Source:HGNC Symbol;Acc:HGNC:11064])

HSP 1 Score: 183.341 bits (464), Expect = 9.759e-49
Identity = 117/320 (36.56%), Postives = 201/320 (62.81%), Query Frame = 3
Query:  900 CVVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYI--IFIAWTKKPRSLTDLISKIT 1853
            C+  L  +NC  V+W T++   FT +KV+AL+ IIV+G V L +G++E F D F GS +   ++ +A Y   ++YSGW+ LNF+T E+KNPE+NLPLAI +S+ ++T++Y+L NVAY  VL+  ++L    SS AVAV FAD+T G+ SW +PI V +S FG +N+ + + SRL   G+ E  +P++L+M+  +  TP+PA++    + +++    + F LI    F++     ++V   LYLR+K P  PRP KL +  P++F +  +F+  + ++    +S I + + L  +P Y   +++  +++P  + ++++ IT
Sbjct:  173 CICLLTFVNCAYVKWGTRVQDTFTYAKVVALIAIIVMGLVKLCQGHSEHFQDAFEGSSWDMGNLSLALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTLIYILTNVAYYTVLNISDVL----SSDAVAVTFADQTFGMFSWTIPIAVALSCFGGLNASIFASSRLFFVGSREGHLPDLLSMIHIERFTPIPALLFNCTMALIYLIVEDVFQLINYFSFSYWFFVGLSVVGQLYLRWKEPKRPRPLKLSVFFPIVFCICSVFLVIVPLFTDTINSLIGIGIALSGVPFYFMGVYLPESRRPLFIRNVLAAIT 488          
BLAST of slc7a-4 vs. Ensembl Celegans
Match: aat-3 (Amino Acid Transporter [Source:UniProtKB/TrEMBL;Acc:A0A0K3AVL7])

HSP 1 Score: 181.8 bits (460), Expect = 8.003e-49
Identity = 125/314 (39.81%), Postives = 185/314 (58.92%), Query Frame = 3
Query:  924 NCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTE---SFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFY-LIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKIT 1853
            NC +V+WA+K+   F V+K  AL++II  G   ++ G  E   SF + F  +     +  +AFY G +AY GWNYLNF+  E++NP++NLPL+I +S +L T++Y L NVA    ++P E+L    +S AVAV FA++  G  ++ MPIFV  S  GS N  +L+ SRL   GA E QMP VL MV+    TP+PAVI+  LL++L+    N  Y LI     ++ +    A+  L Y R   PD PR  K PI+ P++F +  + +  + +   P D+ I + +ML  +PVY+IFIAW  KP+ +  L   +T
Sbjct:  168 NCISVKWASKVQDFFFVTKTAALVLIIFTGLWNMVSGKPEAFDSFENIFENTAKDLETASLAFYSGLFAYQGWNYLNFIVEELQNPKRNLPLSIAISCSLCTIIYTLTNVALYTSITPDEML----ASPAVAVLFAEKNYGWFAFCMPIFVACSTIGSANGVILTSSRLFYCGAREGQMPNVLTMVNKTTKTPIPAVILTGLLSLLYLLLSNNIYSLINYIQVSYWIAIGGAILALFYFRKTMPDAPRAVKAPIVFPIIFFIGCVLLVLVPVLGNPKDTAIGILIMLSGVPVYLIFIAWKGKPKCIDSLTDSVT 477          
BLAST of slc7a-4 vs. Ensembl Celegans
Match: aat-3 (Amino Acid Transporter [Source:UniProtKB/TrEMBL;Acc:A0A0K3AVL7])

HSP 1 Score: 181.8 bits (460), Expect = 1.696e-48
Identity = 125/314 (39.81%), Postives = 185/314 (58.92%), Query Frame = 3
Query:  924 NCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTE---SFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFY-LIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKIT 1853
            NC +V+WA+K+   F V+K  AL++II  G   ++ G  E   SF + F  +     +  +AFY G +AY GWNYLNF+  E++NP++NLPL+I +S +L T++Y L NVA    ++P E+L    +S AVAV FA++  G  ++ MPIFV  S  GS N  +L+ SRL   GA E QMP VL MV+    TP+PAVI+  LL++L+    N  Y LI     ++ +    A+  L Y R   PD PR  K PI+ P++F +  + +  + +   P D+ I + +ML  +PVY+IFIAW  KP+ +  L   +T
Sbjct:  204 NCISVKWASKVQDFFFVTKTAALVLIIFTGLWNMVSGKPEAFDSFENIFENTAKDLETASLAFYSGLFAYQGWNYLNFIVEELQNPKRNLPLSIAISCSLCTIIYTLTNVALYTSITPDEML----ASPAVAVLFAEKNYGWFAFCMPIFVACSTIGSANGVILTSSRLFYCGAREGQMPNVLTMVNKTTKTPIPAVILTGLLSLLYLLLSNNIYSLINYIQVSYWIAIGGAILALFYFRKTMPDAPRAVKAPIVFPIIFFIGCVLLVLVPVLGNPKDTAIGILIMLSGVPVYLIFIAWKGKPKCIDSLTDSVT 513          
BLAST of slc7a-4 vs. Ensembl Celegans
Match: aat-1 (Amino Acid Transporter [Source:UniProtKB/TrEMBL;Acc:Q19834])

HSP 1 Score: 175.637 bits (444), Expect = 8.404e-47
Identity = 125/321 (38.94%), Postives = 191/321 (59.50%), Query Frame = 3
Query:  903 VVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNT---ESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFY-RNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKIT 1853
            +V + AINC +V+ AT +   FT++KV+AL +II+ G   L  G +   +SF + F  +      + +AFY G +AYSGWN+LNF+  E++NP++NLPLAI +S+T  TV+Y+L NVA    +SP E+L     S AVAV FA++  G  +++MP+ V  S  GS N  + + +RL  +GA E QMP VL M++ K  TP+PAVI+   L+I +    ++ + LI     ++ +    A+  L +LR   PD  RP K+P+I P +FL   + +  + +   P D+ I L +ML ++PVY IFI W  KP+   + I   T
Sbjct:  161 IVLMTAINCISVRLATIVQDWFTIAKVVALCLIILTGLGLLFFGESQYKDSFENIFENTSQDFTKVSLAFYSGLFAYSGWNFLNFIVEELQNPKRNLPLAIAISITSCTVIYVLTNVALYTAISPDEML----ESPAVAVLFANKLYGKFAFIMPLCVACSTIGSANGVIFTSARLFYSGAREGQMPAVLTMINKKTKTPIPAVILTGALSIAYLLASKDVYQLINYIQISYWLAIGTAIAALFWLRRTMPDASRPIKVPLIWPAIFLAGCIALVLIPMVAAPRDTGIGLLIMLSAVPVYGIFIGWKNKPKWFNEFIDSST 477          
BLAST of slc7a-4 vs. Ensembl Celegans
Match: aat-1 (Amino Acid Transporter [Source:UniProtKB/TrEMBL;Acc:Q19834])

HSP 1 Score: 175.637 bits (444), Expect = 8.404e-47
Identity = 125/321 (38.94%), Postives = 191/321 (59.50%), Query Frame = 3
Query:  903 VVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNT---ESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFY-RNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKIT 1853
            +V + AINC +V+ AT +   FT++KV+AL +II+ G   L  G +   +SF + F  +      + +AFY G +AYSGWN+LNF+  E++NP++NLPLAI +S+T  TV+Y+L NVA    +SP E+L     S AVAV FA++  G  +++MP+ V  S  GS N  + + +RL  +GA E QMP VL M++ K  TP+PAVI+   L+I +    ++ + LI     ++ +    A+  L +LR   PD  RP K+P+I P +FL   + +  + +   P D+ I L +ML ++PVY IFI W  KP+   + I   T
Sbjct:  161 IVLMTAINCISVRLATIVQDWFTIAKVVALCLIILTGLGLLFFGESQYKDSFENIFENTSQDFTKVSLAFYSGLFAYSGWNFLNFIVEELQNPKRNLPLAIAISITSCTVIYVLTNVALYTAISPDEML----ESPAVAVLFANKLYGKFAFIMPLCVACSTIGSANGVIFTSARLFYSGAREGQMPAVLTMINKKTKTPIPAVILTGALSIAYLLASKDVYQLINYIQISYWLAIGTAIAALFWLRRTMPDASRPIKVPLIWPAIFLAGCIALVLIPMVAAPRDTGIGLLIMLSAVPVYGIFIGWKNKPKWFNEFIDSST 477          
BLAST of slc7a-4 vs. Ensembl Celegans
Match: aat-2 (Amino Acid Transporter [Source:UniProtKB/TrEMBL;Acc:Q19151])

HSP 1 Score: 142.51 bits (358), Expect = 1.067e-35
Identity = 123/316 (38.92%), Postives = 198/316 (62.66%), Query Frame = 3
Query:  900 CVVT-LGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHT--ASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMS--WVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPD---LPRPFKLPIIVPVLFLLADLFIGGLTIYQ-QPFDSFISLCLMLLSIPVYIIFIAWTKKP 1820
            C++  L  INC++V+ AT+    FT++K++AL +II  GG +L  G+ ++ V P    G  T  ++I MAFY G +++SG++YLNF+T E+KNP +NLP AI +S+ ++T+VY+LVN+AY +VL+  EIL     S AVA+ FAD+ +G      +MP+FV  S  GS+N  L++ SR+  +GA   Q+PE+ AM+S + LTP+P++I +   +I+  F  N F LI    FA +++   +V  LL LR+  P+     RP K+ ++ P+LF L  LF+  L  +   P++    + L+L  IP+Y++F+    +P
Sbjct:  145 CIIAVLTFINCWDVRMATRTNDFFTITKLIALTLIITCGGYWLSLGHIDNLVMPDVAEGSQTKLSAIAMAFYSGVFSFSGFSYLNFVTEELKNPFRNLPRAIYISIPIVTIVYMLVNIAYFSVLTVDEIL----DSDAVAITFADKILGTFGSKILMPLFVSFSCVGSLNGILITCSRMFFSGARNSQLPELFAMISIRQLTPIPSLIFLGGTSIVMLFIGNVFQLINYLSFAESLVVFSSVAGLLKLRFTMPENVLNARPIKISLLWPILFFLMCLFLLILPFFHSDPWELIYGVFLVLSGIPIYVLFVYNKYRP 456          
BLAST of slc7a-4 vs. Ensembl Fly
Match: CG1607 (gene:FBgn0039844 transcript:FBtr0085785)

HSP 1 Score: 220.32 bits (560), Expect = 5.075e-62
Identity = 133/307 (43.32%), Postives = 206/307 (67.10%), Query Frame = 3
Query:  900 CVVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKP 1820
            C++ L  INC++V+WAT +  +FT +K+LAL III  G   L  GNT+ F   F  +     SI ++FY G +AY+GWNYLNF+  E+K+P KNLP AI +S TL+T+VY++ NV++  +LSP E++     S+AVAV +A+R  G+++W +P+FV +S FG++N  LL+ SRL   GA   QMPE+L M+  +  TP PAV+ + LL++L+    + F LI   GFA  +   +AV CL +LR+  P+LPRP ++P++ P+++L+A +F+  + +Y  P ++   + ++L SIPVY++FIAW  KP
Sbjct:  177 CILVLTLINCWDVKWATAVQDIFTYAKLLALFIIIATGVYQLYLGNTQYFT--FENTDTKVTSIALSFYSGLFAYNGWNYLNFIIEELKDPVKNLPRAIAISCTLVTIVYVMANVSFYTILSPDEVM----GSSAVAVTYAERAFGMLAWTIPVFVALSTFGAVNGILLTSSRLFYAGANNGQMPEILTMIQIQRFTPTPAVLAMALLSMLYLTVSDIFALINYVGFATWLSIGVAVLCLPWLRWAQPNLPRPIRVPMVFPIVYLIATIFVTVVPMYASPVETGYGILMILSSIPVYLVFIAWKNKP 477          
BLAST of slc7a-4 vs. Ensembl Fly
Match: CG1607 (gene:FBgn0039844 transcript:FBtr0085786)

HSP 1 Score: 220.32 bits (560), Expect = 5.075e-62
Identity = 133/307 (43.32%), Postives = 206/307 (67.10%), Query Frame = 3
Query:  900 CVVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKP 1820
            C++ L  INC++V+WAT +  +FT +K+LAL III  G   L  GNT+ F   F  +     SI ++FY G +AY+GWNYLNF+  E+K+P KNLP AI +S TL+T+VY++ NV++  +LSP E++     S+AVAV +A+R  G+++W +P+FV +S FG++N  LL+ SRL   GA   QMPE+L M+  +  TP PAV+ + LL++L+    + F LI   GFA  +   +AV CL +LR+  P+LPRP ++P++ P+++L+A +F+  + +Y  P ++   + ++L SIPVY++FIAW  KP
Sbjct:  177 CILVLTLINCWDVKWATAVQDIFTYAKLLALFIIIATGVYQLYLGNTQYFT--FENTDTKVTSIALSFYSGLFAYNGWNYLNFIIEELKDPVKNLPRAIAISCTLVTIVYVMANVSFYTILSPDEVM----GSSAVAVTYAERAFGMLAWTIPVFVALSTFGAVNGILLTSSRLFYAGANNGQMPEILTMIQIQRFTPTPAVLAMALLSMLYLTVSDIFALINYVGFATWLSIGVAVLCLPWLRWAQPNLPRPIRVPMVFPIVYLIATIFVTVVPMYASPVETGYGILMILSSIPVYLVFIAWKNKP 477          
BLAST of slc7a-4 vs. Ensembl Fly
Match: CG1607 (gene:FBgn0039844 transcript:FBtr0334550)

HSP 1 Score: 220.32 bits (560), Expect = 5.861e-62
Identity = 133/307 (43.32%), Postives = 206/307 (67.10%), Query Frame = 3
Query:  900 CVVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKP 1820
            C++ L  INC++V+WAT +  +FT +K+LAL III  G   L  GNT+ F   F  +     SI ++FY G +AY+GWNYLNF+  E+K+P KNLP AI +S TL+T+VY++ NV++  +LSP E++     S+AVAV +A+R  G+++W +P+FV +S FG++N  LL+ SRL   GA   QMPE+L M+  +  TP PAV+ + LL++L+    + F LI   GFA  +   +AV CL +LR+  P+LPRP ++P++ P+++L+A +F+  + +Y  P ++   + ++L SIPVY++FIAW  KP
Sbjct:  177 CILVLTLINCWDVKWATAVQDIFTYAKLLALFIIIATGVYQLYLGNTQYFT--FENTDTKVTSIALSFYSGLFAYNGWNYLNFIIEELKDPVKNLPRAIAISCTLVTIVYVMANVSFYTILSPDEVM----GSSAVAVTYAERAFGMLAWTIPVFVALSTFGAVNGILLTSSRLFYAGANNGQMPEILTMIQIQRFTPTPAVLAMALLSMLYLTVSDIFALINYVGFATWLSIGVAVLCLPWLRWAQPNLPRPIRVPMVFPIVYLIATIFVTVVPMYASPVETGYGILMILSSIPVYLVFIAWKNKP 477          
BLAST of slc7a-4 vs. Ensembl Fly
Match: CG1607 (gene:FBgn0039844 transcript:FBtr0334549)

HSP 1 Score: 220.32 bits (560), Expect = 5.861e-62
Identity = 133/307 (43.32%), Postives = 206/307 (67.10%), Query Frame = 3
Query:  900 CVVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKP 1820
            C++ L  INC++V+WAT +  +FT +K+LAL III  G   L  GNT+ F   F  +     SI ++FY G +AY+GWNYLNF+  E+K+P KNLP AI +S TL+T+VY++ NV++  +LSP E++     S+AVAV +A+R  G+++W +P+FV +S FG++N  LL+ SRL   GA   QMPE+L M+  +  TP PAV+ + LL++L+    + F LI   GFA  +   +AV CL +LR+  P+LPRP ++P++ P+++L+A +F+  + +Y  P ++   + ++L SIPVY++FIAW  KP
Sbjct:  177 CILVLTLINCWDVKWATAVQDIFTYAKLLALFIIIATGVYQLYLGNTQYFT--FENTDTKVTSIALSFYSGLFAYNGWNYLNFIIEELKDPVKNLPRAIAISCTLVTIVYVMANVSFYTILSPDEVM----GSSAVAVTYAERAFGMLAWTIPVFVALSTFGAVNGILLTSSRLFYAGANNGQMPEILTMIQIQRFTPTPAVLAMALLSMLYLTVSDIFALINYVGFATWLSIGVAVLCLPWLRWAQPNLPRPIRVPMVFPIVYLIATIFVTVVPMYASPVETGYGILMILSSIPVYLVFIAWKNKP 477          
BLAST of slc7a-4 vs. Ensembl Fly
Match: mnd (gene:FBgn0002778 transcript:FBtr0075626)

HSP 1 Score: 191.045 bits (484), Expect = 7.067e-52
Identity = 128/301 (42.52%), Postives = 195/301 (64.78%), Query Frame = 3
Query:  900 CVVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFI 1802
            CV+TL  INCYNV+W T++  +FT +KV+ALL+I+  G  +L  GNTE + +PFSG       I +AFY G ++YSGWNYLNF+T E+K+P +NLP AI +S+ ++TV+Y++ N+AY +VLSP EIL    SS AVAV F D+ +G MSW+MP  V  S FGS+N  + + SRL   GA    +P  +++++   LTP+P++I + +LT+L  F  + + LI    +  A+   ++V  LL++RYK P   RP K+ + +P+++L+  LF+   +  Q P+   I   ++L  IPVY + I
Sbjct:  173 CVLTL--INCYNVKWVTRVTDIFTGTKVVALLVIVGAGVWWLFDGNTEHWDNPFSGGLQDPGYIALAFYSGLFSYSGWNYLNFVTEELKDPYRNLPKAICISMPVVTVIYMITNIAYFSVLSPDEIL----SSDAVAVTFGDKMLGYMSWIMPFAVACSTFGSLNGAIFASSRLFFVGARNGHLPAAISLINVNCLTPVPSLIFLGVLTLLLLFIEDVYVLINYVSYVEALFTLISVSGLLWMRYKQPKTERPIKVNLALPIIYLIVCLFLVIFSCTQTPYVVGIGTIIILSGIPVYYLTI 467          
BLAST of slc7a-4 vs. Ensembl Zebrafish
Match: slc7a6 (solute carrier family 7 member 6 [Source:NCBI gene;Acc:57957])

HSP 1 Score: 192.971 bits (489), Expect = 1.165e-52
Identity = 129/320 (40.31%), Postives = 200/320 (62.50%), Query Frame = 3
Query:  900 CVVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYI--IFIAWTKKPRSLTDLISKIT 1853
            C+  L  IN   V+W T++  VFT +KVLAL++II+ G V L +G T +F D F GS      I +A Y   ++YSGW+ LNF+T E+KNPE+NLPL+I +S+ ++T++Y+L NVAY AVL    IL    +S AVAV FAD T+GVMSW +PI V +S +G +NS +++ SRL   GA E  +P+ L+M+  +  TP+PA++    + +++    + F LI    F++     +++   +YLR+K PD PRP KL ++ P++F L  +F+  + +Y    +S I + + L  +PVY   I +  +K+P  +T L+S IT
Sbjct:  135 CICLLTFINSAYVKWGTRVQDVFTYAKVLALIVIIITGIVKLCQGFTINFEDSFQGSSRDPGGIALALYSALFSYSGWDTLNFVTEEIKNPERNLPLSIAISMPIVTIIYILTNVAYYAVLDMSAIL----ASDAVAVTFADHTLGVMSWTIPIAVALSCYGGLNSSIIAASRLFFVGAREGHLPDALSMIHIERFTPVPALLFNCAMALIYLTVEDVFQLINYYSFSYWFFVGLSIAGQIYLRWKEPDRPRPLKLSLVYPIIFCLCVVFLVAVPLYSDTLNSLIGIAIALSGVPVYFLGIHLPESKRPPIITKLLSAIT 450          
BLAST of slc7a-4 vs. Ensembl Zebrafish
Match: slc7a6 (solute carrier family 7 member 6 [Source:NCBI gene;Acc:57957])

HSP 1 Score: 192.971 bits (489), Expect = 1.998e-52
Identity = 129/320 (40.31%), Postives = 200/320 (62.50%), Query Frame = 3
Query:  900 CVVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYI--IFIAWTKKPRSLTDLISKIT 1853
            C+  L  IN   V+W T++  VFT +KVLAL++II+ G V L +G T +F D F GS      I +A Y   ++YSGW+ LNF+T E+KNPE+NLPL+I +S+ ++T++Y+L NVAY AVL    IL    +S AVAV FAD T+GVMSW +PI V +S +G +NS +++ SRL   GA E  +P+ L+M+  +  TP+PA++    + +++    + F LI    F++     +++   +YLR+K PD PRP KL ++ P++F L  +F+  + +Y    +S I + + L  +PVY   I +  +K+P  +T L+S IT
Sbjct:  161 CICLLTFINSAYVKWGTRVQDVFTYAKVLALIVIIITGIVKLCQGFTINFEDSFQGSSRDPGGIALALYSALFSYSGWDTLNFVTEEIKNPERNLPLSIAISMPIVTIIYILTNVAYYAVLDMSAIL----ASDAVAVTFADHTLGVMSWTIPIAVALSCYGGLNSSIIAASRLFFVGAREGHLPDALSMIHIERFTPVPALLFNCAMALIYLTVEDVFQLINYYSFSYWFFVGLSIAGQIYLRWKEPDRPRPLKLSLVYPIIFCLCVVFLVAVPLYSDTLNSLIGIAIALSGVPVYFLGIHLPESKRPPIITKLLSAIT 476          
BLAST of slc7a-4 vs. Ensembl Zebrafish
Match: slc7a11 (solute carrier family 7 member 11 [Source:ZFIN;Acc:ZDB-GENE-150416-1])

HSP 1 Score: 190.66 bits (483), Expect = 1.260e-51
Identity = 124/301 (41.20%), Postives = 189/301 (62.79%), Query Frame = 3
Query:  921 INCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPR 1823
            +N  +V W  ++ I  T SK+LA+ IIIV G   L +G T++F + F  +      +P+AFY G +AY+GW YLNF+T E++NPE+ +PLAI +S+ ++ + Y L NVAY  V+S  E+L    +S AVAV FA++ MG  S+ +P+FV +S FGSMN  L ++SR+    + E Q+PEVL+M+  +  TP+PAVI++  +T+L  F  + + L+    F   +   +AV  L+YLR+  PDLPRPFK+PI +P +F     F+  L++Y  P ++ I   + L  IP Y IFI   +KP+
Sbjct:  178 LNSMSVSWTARLQIFLTFSKLLAIAIIIVPGLYQLFKGETKNFENAFEVNTAQLTGLPLAFYSGMYAYAGWFYLNFVTEEVENPERTVPLAICISMVIVMICYTLTNVAYYTVMSADELL----ASNAVAVTFAEKLMGNFSYAVPVFVALSCFGSMNGCLFAISRMFFVASREGQLPEVLSMIHIRRHTPLPAVIVLYPITLLILFLGDIYSLLNFMSFLRWLFIGVAVVGLIYLRFTRPDLPRPFKVPIFIPAVFSFTCFFMVFLSLYSDPINTGIGFAISLTGIPAYYIFIHSKRKPK 474          
BLAST of slc7a-4 vs. Ensembl Zebrafish
Match: slc7a5 (solute carrier family 7 member 5 [Source:ZFIN;Acc:ZDB-GENE-080818-4])

HSP 1 Score: 187.963 bits (476), Expect = 1.034e-50
Identity = 130/316 (41.14%), Postives = 206/316 (65.19%), Query Frame = 3
Query:  900 CVVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFV--DPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLI 1841
            C++ L A+NCY+V+ AT++   F  +K+LAL +II+IG V + +G+T   +  + F GS     +I +A Y G +AY GWNYLNF+T EM  P KNLP AII+SL ++TVVY+L N+AY   LSP+++L    SS AVAV+F +  +G M+W++P+FVG+S FGS+N  L + SRL   G+ E  +P +L+M+    LTP+P++I   ++T+L+ F  + F +I    F   +  AMA+  +++LRYK P+L RP K+ I++P++F+LA LF+  ++ ++ P +  I   ++   +PVY   + W  KP+ L  +I
Sbjct:  168 CILLLTAVNCYSVKAATRVQDAFAAAKLLALGLIIIIGFVEIGKGDTVELLPENSFKGSNTDFGNIGLALYSGLFAYGGWNYLNFVTEEMIEPYKNLPRAIIISLPIVTVVYVLTNLAYFTTLSPEKML----SSEAVAVDFGNYHLGPMAWIIPVFVGLSCFGSVNGSLFTSSRLFFVGSREGHLPSLLSMIHPDLLTPLPSLIFTCIMTLLYAFSNDIFSVINFFSFFNWLCIAMAIVGMMWLRYKKPELERPIKVNILLPIVFVLACLFLIVVSFWKTPVECAIGFGIIATGVPVYFFGVWWQTKPKWLLQII 479          
BLAST of slc7a-4 vs. Ensembl Zebrafish
Match: slc7a5 (solute carrier family 7 member 5 [Source:ZFIN;Acc:ZDB-GENE-080818-4])

HSP 1 Score: 187.578 bits (475), Expect = 2.388e-50
Identity = 130/316 (41.14%), Postives = 206/316 (65.19%), Query Frame = 3
Query:  900 CVVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFV--DPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLI 1841
            C++ L A+NCY+V+ AT++   F  +K+LAL +II+IG V + +G+T   +  + F GS     +I +A Y G +AY GWNYLNF+T EM  P KNLP AII+SL ++TVVY+L N+AY   LSP+++L    SS AVAV+F +  +G M+W++P+FVG+S FGS+N  L + SRL   G+ E  +P +L+M+    LTP+P++I   ++T+L+ F  + F +I    F   +  AMA+  +++LRYK P+L RP K+ I++P++F+LA LF+  ++ ++ P +  I   ++   +PVY   + W  KP+ L  +I
Sbjct:  194 CILLLTAVNCYSVKAATRVQDAFAAAKLLALGLIIIIGFVEIGKGDTVELLPENSFKGSNTDFGNIGLALYSGLFAYGGWNYLNFVTEEMIEPYKNLPRAIIISLPIVTVVYVLTNLAYFTTLSPEKML----SSEAVAVDFGNYHLGPMAWIIPVFVGLSCFGSVNGSLFTSSRLFFVGSREGHLPSLLSMIHPDLLTPLPSLIFTCIMTLLYAFSNDIFSVINFFSFFNWLCIAMAIVGMMWLRYKKPELERPIKVNILLPIVFVLACLFLIVVSFWKTPVECAIGFGIIATGVPVYFFGVWWQTKPKWLLQII 505          
BLAST of slc7a-4 vs. Ensembl Xenopus
Match: SLC7A11 (solute carrier family 7 member 11 [Source:NCBI gene;Acc:100496726])

HSP 1 Score: 202.216 bits (513), Expect = 9.461e-56
Identity = 128/310 (41.29%), Postives = 198/310 (63.87%), Query Frame = 3
Query:  921 INCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKP---RSLTDLI 1841
            +N  +V W+ ++ I  T  K++A+LIIIV G + LI+G T++F D F G       +P+AFY G +AY+GW YLNF+T E++NPEKN+PLAI +S+ ++TV Y+L NVAY   +S +E++L    S+AVAV +A+R  G  S  +PIFV +S FGSMN  + ++SR+    + E  +PE+L+M+  +  TP+PAVI++  LT++  F  + + L+    F   +   +AV  L+YLRYK P++ RPFK+PI +P LF    LF+  L++Y  P ++ I   + L  +P Y +F+ W  KP   R+ T +I
Sbjct:  163 LNSVSVSWSARIQIFLTFCKLIAILIIIVPGVLQLIKGETQNFKDAFIGKDVSVMGLPLAFYSGMYAYAGWFYLNFVTEEVENPEKNVPLAICISMAIVTVGYVLTNVAYYTTISAEELVL----SSAVAVTYAERLFGSFSLAVPIFVALSCFGSMNGGVFAVSRMFYVASREGHLPEILSMIHVRKHTPLPAVIVLLPLTMVMLFTGDIYSLLNFFSFVRWLFIGLAVAGLIYLRYKRPEMHRPFKVPIFIPALFSFTCLFMVALSLYSDPINTGIGFAITLTGVPAYYLFVIWDNKPEWFRTFTGII 468          
BLAST of slc7a-4 vs. Ensembl Xenopus
Match: SLC7A11 (solute carrier family 7 member 11 [Source:NCBI gene;Acc:100496726])

HSP 1 Score: 202.986 bits (515), Expect = 9.563e-56
Identity = 128/308 (41.56%), Postives = 197/308 (63.96%), Query Frame = 3
Query:  921 INCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKP---RSLTD 1835
            +N  +V W+ ++ I  T  K++A+LIIIV G + LI+G T++F D F G       +P+AFY G +AY+GW YLNF+T E++NPEKN+PLAI +S+ ++TV Y+L NVAY   +S +E++L    S+AVAV +A+R  G  S  +PIFV +S FGSMN  + ++SR+    + E  +PE+L+M+  +  TP+PAVI++  LT++  F  + + L+    F   +   +AV  L+YLRYK P++ RPFK+PI +P LF    LF+  L++Y  P ++ I   + L  +P Y +F+ W  KP   R+ TD
Sbjct:  177 LNSVSVSWSARIQIFLTFCKLIAILIIIVPGVLQLIKGETQNFKDAFIGKDVSVMGLPLAFYSGMYAYAGWFYLNFVTEEVENPEKNVPLAICISMAIVTVGYVLTNVAYYTTISAEELVL----SSAVAVTYAERLFGSFSLAVPIFVALSCFGSMNGGVFAVSRMFYVASREGHLPEILSMIHVRKHTPLPAVIVLLPLTMVMLFTGDIYSLLNFFSFVRWLFIGLAVAGLIYLRYKRPEMHRPFKVPIFIPALFSFTCLFMVALSLYSDPINTGIGFAITLTGVPAYYLFVIWDNKPEWFRTFTD 480          
BLAST of slc7a-4 vs. Ensembl Xenopus
Match: SLC7A11 (solute carrier family 7 member 11 [Source:NCBI gene;Acc:100496726])

HSP 1 Score: 202.601 bits (514), Expect = 1.154e-55
Identity = 128/310 (41.29%), Postives = 198/310 (63.87%), Query Frame = 3
Query:  921 INCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKP---RSLTDLI 1841
            +N  +V W+ ++ I  T  K++A+LIIIV G + LI+G T++F D F G       +P+AFY G +AY+GW YLNF+T E++NPEKN+PLAI +S+ ++TV Y+L NVAY   +S +E++L    S+AVAV +A+R  G  S  +PIFV +S FGSMN  + ++SR+    + E  +PE+L+M+  +  TP+PAVI++  LT++  F  + + L+    F   +   +AV  L+YLRYK P++ RPFK+PI +P LF    LF+  L++Y  P ++ I   + L  +P Y +F+ W  KP   R+ T +I
Sbjct:  177 LNSVSVSWSARIQIFLTFCKLIAILIIIVPGVLQLIKGETQNFKDAFIGKDVSVMGLPLAFYSGMYAYAGWFYLNFVTEEVENPEKNVPLAICISMAIVTVGYVLTNVAYYTTISAEELVL----SSAVAVTYAERLFGSFSLAVPIFVALSCFGSMNGGVFAVSRMFYVASREGHLPEILSMIHVRKHTPLPAVIVLLPLTMVMLFTGDIYSLLNFFSFVRWLFIGLAVAGLIYLRYKRPEMHRPFKVPIFIPALFSFTCLFMVALSLYSDPINTGIGFAITLTGVPAYYLFVIWDNKPEWFRTFTGII 482          
BLAST of slc7a-4 vs. Ensembl Xenopus
Match: SLC7A11 (solute carrier family 7 member 11 [Source:NCBI gene;Acc:100496726])

HSP 1 Score: 201.06 bits (510), Expect = 3.558e-55
Identity = 125/301 (41.53%), Postives = 193/301 (64.12%), Query Frame = 3
Query:  921 INCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPR 1823
            +N  +V W+ ++ I  T  K++A+LIIIV G + LI+G T++F D F G       +P+AFY G +AY+GW YLNF+T E++NPEKN+PLAI +S+ ++TV Y+L NVAY   +S +E++L    S+AVAV +A+R  G  S  +PIFV +S FGSMN  + ++SR+    + E  +PE+L+M+  +  TP+PAVI++  LT++  F  + + L+    F   +   +AV  L+YLRYK P++ RPFK+PI +P LF    LF+  L++Y  P ++ I   + L  +P Y +F+ W  KP 
Sbjct:  177 LNSVSVSWSARIQIFLTFCKLIAILIIIVPGVLQLIKGETQNFKDAFIGKDVSVMGLPLAFYSGMYAYAGWFYLNFVTEEVENPEKNVPLAICISMAIVTVGYVLTNVAYYTTISAEELVL----SSAVAVTYAERLFGSFSLAVPIFVALSCFGSMNGGVFAVSRMFYVASREGHLPEILSMIHVRKHTPLPAVIVLLPLTMVMLFTGDIYSLLNFFSFVRWLFIGLAVAGLIYLRYKRPEMHRPFKVPIFIPALFSFTCLFMVALSLYSDPINTGIGFAITLTGVPAYYLFVIWDNKPE 473          
BLAST of slc7a-4 vs. Ensembl Xenopus
Match: SLC7A11 (solute carrier family 7 member 11 [Source:NCBI gene;Acc:100496726])

HSP 1 Score: 201.06 bits (510), Expect = 3.945e-55
Identity = 125/301 (41.53%), Postives = 193/301 (64.12%), Query Frame = 3
Query:  921 INCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPR 1823
            +N  +V W+ ++ I  T  K++A+LIIIV G + LI+G T++F D F G       +P+AFY G +AY+GW YLNF+T E++NPEKN+PLAI +S+ ++TV Y+L NVAY   +S +E++L    S+AVAV +A+R  G  S  +PIFV +S FGSMN  + ++SR+    + E  +PE+L+M+  +  TP+PAVI++  LT++  F  + + L+    F   +   +AV  L+YLRYK P++ RPFK+PI +P LF    LF+  L++Y  P ++ I   + L  +P Y +F+ W  KP 
Sbjct:  177 LNSVSVSWSARIQIFLTFCKLIAILIIIVPGVLQLIKGETQNFKDAFIGKDVSVMGLPLAFYSGMYAYAGWFYLNFVTEEVENPEKNVPLAICISMAIVTVGYVLTNVAYYTTISAEELVL----SSAVAVTYAERLFGSFSLAVPIFVALSCFGSMNGGVFAVSRMFYVASREGHLPEILSMIHVRKHTPLPAVIVLLPLTMVMLFTGDIYSLLNFFSFVRWLFIGLAVAGLIYLRYKRPEMHRPFKVPIFIPALFSFTCLFMVALSLYSDPINTGIGFAITLTGVPAYYLFVIWDNKPE 473          
BLAST of slc7a-4 vs. Ensembl Mouse
Match: Slc7a11 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 11 [Source:MGI Symbol;Acc:MGI:1347355])

HSP 1 Score: 206.838 bits (525), Expect = 3.787e-57
Identity = 134/312 (42.95%), Postives = 197/312 (63.14%), Query Frame = 3
Query:  921 INCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKP---RSLTDLISK 1847
            +N  +V W+ ++ I  T  K+ A+LIIIV G + LI+G T  F D FSG       +P+AFY G +AY+GW YLNF+T E+ NPEK +PLAI +S+ +ITV Y+L NVAY   +S +E+L     S+AVAV F++R +G  S  +PIFV +S FGSMN  + ++SRL    + E  +PE+L+M+     TP+PAVI++  LT++  F  + + L+    FA  +   +AV  L+YLRYK PD+ RPFK+P+ +P LF    LF+  L++Y  PF + +   + L  +P Y +FI W KKP   R L+D I++
Sbjct:  179 LNSTSVSWSARIQIFLTFCKLTAILIIIVPGVIQLIKGQTHHFKDAFSGRDTSLMGLPLAFYYGMYAYAGWFYLNFITEEVDNPEKTIPLAICISMAIITVGYVLTNVAYFTTISAEELL----QSSAVAVTFSERLLGKFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVHKHTPLPAVIVLHPLTMVMLFSGDLYSLLNFLSFARWLFMGLAVAGLIYLRYKRPDMHRPFKVPLFIPALFSFTCLFMVVLSLYSDPFSTGVGFLITLTGVPAYYLFIVWDKKPKWFRRLSDRITR 486          
BLAST of slc7a-4 vs. Ensembl Mouse
Match: Slc7a11 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 11 [Source:MGI Symbol;Acc:MGI:1347355])

HSP 1 Score: 203.371 bits (516), Expect = 4.796e-56
Identity = 130/301 (43.19%), Postives = 191/301 (63.46%), Query Frame = 3
Query:  921 INCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPR 1823
            +N  +V W+ ++ I  T  K+ A+LIIIV G + LI+G T  F D FSG       +P+AFY G +AY+GW YLNF+T E+ NPEK +PLAI +S+ +ITV Y+L NVAY   +S +E+L     S+AVAV F++R +G  S  +PIFV +S FGSMN  + ++SRL    + E  +PE+L+M+     TP+PAVI++  LT++  F  + + L+    FA  +   +AV  L+YLRYK PD+ RPFK+P+ +P LF    LF+  L++Y  PF + +   + L  +P Y +FI W KKP+
Sbjct:  179 LNSTSVSWSARIQIFLTFCKLTAILIIIVPGVIQLIKGQTHHFKDAFSGRDTSLMGLPLAFYYGMYAYAGWFYLNFITEEVDNPEKTIPLAICISMAIITVGYVLTNVAYFTTISAEELL----QSSAVAVTFSERLLGKFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVHKHTPLPAVIVLHPLTMVMLFSGDLYSLLNFLSFARWLFMGLAVAGLIYLRYKRPDMHRPFKVPLFIPALFSFTCLFMVVLSLYSDPFSTGVGFLITLTGVPAYYLFIVWDKKPK 475          
BLAST of slc7a-4 vs. Ensembl Mouse
Match: Slc7a6 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 6 [Source:MGI Symbol;Acc:MGI:2142598])

HSP 1 Score: 191.815 bits (486), Expect = 8.692e-52
Identity = 121/320 (37.81%), Postives = 203/320 (63.44%), Query Frame = 3
Query:  900 CVVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYI--IFIAWTKKPRSLTDLISKIT 1853
            CV  L  +NC  V+W T++   FT +KVLAL+ II++G V L +G+TE F D F GS ++   + +A Y   ++YSGW+ LNF+T E+KNPE+NLPLAI +S+ ++T++Y+L NVAY  VL+ Q++      S AVAV FAD+T G+ SW +PI V +S FG +N+ + + SRL   G+ E  +P +L+M+  +  TP+PA++    +T+++   ++ F LI    F++     ++V   LYLR+K PD PRP KL +  P++F +  LF+  + ++    +S I + + L  +PVY   +++  +++P  + ++++ +T
Sbjct:  173 CVCLLTFVNCAYVKWGTRVQDTFTYAKVLALIAIIIMGLVKLCQGHTEHFQDAFKGSSWNVGDLSLALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTLIYILTNVAYYTVLNIQDV----HKSDAVAVTFADQTFGMFSWTIPIAVALSCFGGLNASIFASSRLFFVGSREGHLPNLLSMIHIERFTPVPALLFNCTMTLIYLVVKDVFLLINYFSFSYWFFVGLSVVGQLYLRWKEPDWPRPLKLSLFFPIVFCVCSLFLVAVPLFSDTINSLIGIGIALSGVPVYFLGVYLPESRRPLFIRNVLATVT 488          
BLAST of slc7a-4 vs. Ensembl Mouse
Match: Slc7a7 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 7 [Source:MGI Symbol;Acc:MGI:1337120])

HSP 1 Score: 184.111 bits (466), Expect = 2.908e-49
Identity = 130/356 (36.52%), Postives = 213/356 (59.83%), Query Frame = 3
Query:  900 CVVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVY--IIFIAWTKKPRSLTDLISKITXXXXXXXXXXXXXXXSDELDAMLANKKSSQNDPSIK 1961
            C+  L  INC  V+W T +  +FT +KVLAL+ +I+ G V L +G T +F + F GS F    I +A Y   ++YSGW+ LN++T E++NPE+NLPL+I +S+ ++T++YLL NVAY +VL  +EIL    +S AVAV FAD+  GV +W++P+ V  S FG +N+ +++ SRL   G+ E  +P+ + MV  +  TP+P+++   +L++++    + F LI    F++     +++   LYLR+K PD PRP KL +  P++F L  +F+  + +Y    +S I + + L  +P Y  II +   K+P  L  +++ IT         +L   V+ E+D  L + + S+ DP  K
Sbjct:  166 CICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIIAGIVRLGQGATANFENSFEGSSFAMGDIALALYSALFSYSGWDTLNYVTEEIRNPERNLPLSIGISMPIVTIIYLLTNVAYYSVLDIKEIL----ASDAVAVTFADQIFGVFNWIIPVAVAFSCFGGLNASIVAASRLLFVGSREGHLPDAICMVHVERFTPVPSLLFNGVLSLVYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRWKDPDRPRPLKLSLFFPIIFCLCTIFLVAVPLYSDTINSLIGIGIALSGLPFYFFIIRVPEHKRPLFLRRIVASIT-----RYLQILCMSVAAEMD--LEDGELSKQDPKSK 510          
BLAST of slc7a-4 vs. Ensembl Mouse
Match: Slc7a7 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 7 [Source:MGI Symbol;Acc:MGI:1337120])

HSP 1 Score: 184.111 bits (466), Expect = 2.908e-49
Identity = 130/356 (36.52%), Postives = 213/356 (59.83%), Query Frame = 3
Query:  900 CVVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVY--IIFIAWTKKPRSLTDLISKITXXXXXXXXXXXXXXXSDELDAMLANKKSSQNDPSIK 1961
            C+  L  INC  V+W T +  +FT +KVLAL+ +I+ G V L +G T +F + F GS F    I +A Y   ++YSGW+ LN++T E++NPE+NLPL+I +S+ ++T++YLL NVAY +VL  +EIL    +S AVAV FAD+  GV +W++P+ V  S FG +N+ +++ SRL   G+ E  +P+ + MV  +  TP+P+++   +L++++    + F LI    F++     +++   LYLR+K PD PRP KL +  P++F L  +F+  + +Y    +S I + + L  +P Y  II +   K+P  L  +++ IT         +L   V+ E+D  L + + S+ DP  K
Sbjct:  166 CICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIIAGIVRLGQGATANFENSFEGSSFAMGDIALALYSALFSYSGWDTLNYVTEEIRNPERNLPLSIGISMPIVTIIYLLTNVAYYSVLDIKEIL----ASDAVAVTFADQIFGVFNWIIPVAVAFSCFGGLNASIVAASRLLFVGSREGHLPDAICMVHVERFTPVPSLLFNGVLSLVYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRWKDPDRPRPLKLSLFFPIIFCLCTIFLVAVPLYSDTINSLIGIGIALSGLPFYFFIIRVPEHKRPLFLRRIVASIT-----RYLQILCMSVAAEMD--LEDGELSKQDPKSK 510          
BLAST of slc7a-4 vs. UniProt/SwissProt
Match: sp|Q9UPY5|XCT_HUMAN (Cystine/glutamate transporter OS=Homo sapiens OX=9606 GN=SLC7A11 PE=1 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 5.255e-58
Identity = 134/311 (43.09%), Postives = 199/311 (63.99%), Query Frame = 3
Query:  921 INCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKIT 1853
            +N  +V W+ ++ I  T  K+ A+LIIIV G + LI+G T++F D FSG       +P+AFY G +AY+GW YLNF+T E++NPEK +PLAI +S+ ++T+ Y+L NVAY   ++ +E+LL    S AVAV F++R +G  S  +PIFV +S FGSMN  + ++SRL    + E  +PE+L+M+  +  TP+PAVI++  LT++  F  +   L+    FA  +   +AV  L+YLRYKCPD+ RPFK+P+ +P LF    LF+  L++Y  PF + I   + L  +P Y +FI W KKPR    +  KIT
Sbjct:  179 LNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLL----SNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKIT 485          
BLAST of slc7a-4 vs. UniProt/SwissProt
Match: sp|Q5RAG7|XCT_PONAB (Cystine/glutamate transporter OS=Pongo abelii OX=9601 GN=SLC7A11 PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 1.047e-57
Identity = 134/311 (43.09%), Postives = 199/311 (63.99%), Query Frame = 3
Query:  921 INCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKIT 1853
            +N  +V W+ ++ I  T  K+ A+LIIIV G + LI+G T++F D FSG       +P+AFY G +AY+GW YLNF+T E++NPEK +PLAI +S+ ++T+ Y+L NVAY   ++ +E+LL    S AVAV F++R +G  S  +PIFV +S FGSMN  + ++SRL    + E  +PE+L+M+  +  TP+PAVI++  LT++  F  +   L+    FA  +   +AV  L+YLRYKCPD+ RPFK+P+ +P LF    LF+  L++Y  PF + I   + L  +P Y +FI W KKPR    +  KIT
Sbjct:  179 LNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLL----SNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGSVITLTGVPAYYLFIIWDKKPRWFRIMSEKIT 485          
BLAST of slc7a-4 vs. UniProt/SwissProt
Match: sp|Q9WTR6|XCT_MOUSE (Cystine/glutamate transporter OS=Mus musculus OX=10090 GN=Slc7a11 PE=1 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 2.649e-56
Identity = 134/312 (42.95%), Postives = 197/312 (63.14%), Query Frame = 3
Query:  921 INCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKP---RSLTDLISK 1847
            +N  +V W+ ++ I  T  K+ A+LIIIV G + LI+G T  F D FSG       +P+AFY G +AY+GW YLNF+T E+ NPEK +PLAI +S+ +ITV Y+L NVAY   +S +E+L     S+AVAV F++R +G  S  +PIFV +S FGSMN  + ++SRL    + E  +PE+L+M+     TP+PAVI++  LT++  F  + + L+    FA  +   +AV  L+YLRYK PD+ RPFK+P+ +P LF    LF+  L++Y  PF + +   + L  +P Y +FI W KKP   R L+D I++
Sbjct:  179 LNSTSVSWSARIQIFLTFCKLTAILIIIVPGVIQLIKGQTHHFKDAFSGRDTSLMGLPLAFYYGMYAYAGWFYLNFITEEVDNPEKTIPLAICISMAIITVGYVLTNVAYFTTISAEELL----QSSAVAVTFSERLLGKFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVHKHTPLPAVIVLHPLTMVMLFSGDLYSLLNFLSFARWLFMGLAVAGLIYLRYKRPDMHRPFKVPLFIPALFSFTCLFMVVLSLYSDPFSTGVGFLITLTGVPAYYLFIVWDKKPKWFRRLSDRITR 486          
BLAST of slc7a-4 vs. UniProt/SwissProt
Match: sp|Q7YQK4|LAT1_RABIT (Large neutral amino acids transporter small subunit 1 OS=Oryctolagus cuniculus OX=9986 GN=SLC7A5 PE=1 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 1.171e-51
Identity = 131/315 (41.59%), Postives = 205/315 (65.08%), Query Frame = 3
Query:  918 AINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDP---FSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKIT 1853
            A+NCY+V+ AT++   F  +K+LAL +II++G V + +G   + +DP   F G+ +   +I +A Y G +AY GWNYLNF+T EM NP +NLPLAII+SL + T+VY+L N+AY   LSP+++L    +S AVAV+F +  +GVMSWV+P+FVG+S FGS+N  L + SRL   G+ E  +P VL+M+  + LTP+P+++    +T+L+ F R+ F +I    F   +  A+A+  +++LRYK P+L RP K+ + +PV F+LA LF+  ++ ++ P +  I   ++L  +PVY   + W  KP+ L   I   T
Sbjct:  180 AVNCYSVKAATRVQDAFAAAKLLALALIILLGFVQIGKGGVSN-LDPKFSFEGTNWDVGNIVLALYSGLFAYGGWNYLNFVTEEMINPYRNLPLAIIISLPICTLVYVLTNLAYFTTLSPEQML----ASEAVAVDFGNHHLGVMSWVIPVFVGLSCFGSVNGSLFTSSRLFFVGSREGHLPSVLSMIHPQLLTPVPSLVFTCAMTLLYAFSRDIFSVINFFSFFNWLCVALAIIGMMWLRYKKPELERPIKVNLALPVFFILACLFLIAVSFWKTPVECGIGFTIILSGLPVYFFGVWWKNKPKWLLQGIFSAT 489          
BLAST of slc7a-4 vs. UniProt/SwissProt
Match: sp|Q59I64|YLAT2_DANRE (Y+L amino acid transporter 2 OS=Danio rerio OX=7955 GN=slc7a6 PE=2 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 1.859e-51
Identity = 128/320 (40.00%), Postives = 200/320 (62.50%), Query Frame = 3
Query:  900 CVVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYI--IFIAWTKKPRSLTDLISKIT 1853
            C+  L  IN   V+W T++  VFT +KVLAL++II+ G V L +G T +F D F GS      I +A Y   ++YSGW+ LNF+T E+KNPE+NLPL+I +S+ ++T++Y+L NVAY AVL    IL    +S AVAV FAD T+GVMSW +PI V +S +G +NS +++ SRL   GA E  +P+ L+M+  +  TP+PA++    + +++    + F LI    F++     +++   +YLR+K PD PRP KL ++ P++F L  +F+  + +Y    ++ I + + L  +PVY   I +  +K+P  +T L+S IT
Sbjct:  135 CICLLTFINSAYVKWGTRVQDVFTYAKVLALIVIIITGIVKLCQGFTINFEDSFQGSSRDPGGIALALYSALFSYSGWDTLNFVTEEIKNPERNLPLSIAISMPIVTIIYILTNVAYYAVLDMSAIL----ASDAVAVTFADHTLGVMSWTIPIAVALSCYGGLNSSIIAASRLFFVGAREGHLPDALSMIHIERFTPVPALLFNCAMALIYLTVEDVFQLINYYSFSYWFFVGLSIAGQIYLRWKEPDRPRPLKLSLVYPIIFCLCVVFLVAVPLYSDTLNTLIGIAIALSGVPVYFLGIHLPESKRPPIITKLLSAIT 450          
BLAST of slc7a-4 vs. TrEMBL
Match: A0A0H3YK27 (Slc7a-4 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc7a-4 PE=2 SV=1)

HSP 1 Score: 503.056 bits (1294), Expect = 3.600e-165
Identity = 303/305 (99.34%), Postives = 305/305 (100.00%), Query Frame = 3
Query:  903 VVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKK 1817
            ++TLGAINCYNVQWATKMAIVFTVSKVLALLIIIVIGGVYLIRGNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITVVYLLVNVAYLAVLSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVIIITLLTILFQFYRNAFYLIELAGFAFAVIAAMAVCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKK
Sbjct:  175 IMTLGAINCYNVQWATKMAIVFTVSKVLALLIIIVIGGVYLIRGNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITVVYLLVNVAYLAVLSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVIIITLLTILFQFYRNAFYLIELAGFAFAVIAAMAVCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKK 479          
BLAST of slc7a-4 vs. TrEMBL
Match: A0A0H3YF65 (Slc7a-8 OS=Schmidtea mediterranea OX=79327 GN=slc7a-8 PE=2 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 9.182e-96
Identity = 193/315 (61.27%), Postives = 247/315 (78.41%), Query Frame = 3
Query:  909 TLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKIT 1853
            ++ AINCY+V+WAT+  + FT+SKVLALLIIIVIG   L RGN  SF DPF+ S     S+ +AFYQGFWAY+GWNYLNFLT+EM NP +NLP+AII SLT++TV+Y+  N+AYLAVLSP+E+L I   S AVAV FAD+TMG+ S +MPIFVG SVFGSMN E LS+SRLT T A +  +PE LAMVS K+LTPMPAVI +  L+++F F  +  YLIELAGF+F VI+ MAV CL+YLR KCP+LPR FKLP+++P++FLL DLFIG LT+Y++P DS I + ++ L IP+YIIF+ W  KP+S+T+L   +T
Sbjct:  149 SIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLTIVTVIYVTTNIAYLAVLSPREMLEISSKSVAVAVVFADQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKLPLVLPIMFLLLDLFIGILTVYEKPTDSLIGVAIIALGIPIYIIFVVWKSKPKSVTNLTESLT 463          
BLAST of slc7a-4 vs. TrEMBL
Match: A0A068YDY4 (Cationic amino acid transporter OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000913800 PE=4 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 8.368e-81
Identity = 172/312 (55.13%), Postives = 232/312 (74.36%), Query Frame = 3
Query:  918 AINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKIT 1853
            AINCY V+WAT++A++F+  K +ALL+II  G  YL  G+ E+F + F GS      + +AFYQGFWAYSGWNYLNFL  EMKNP +NLPLAI ++LTL+T +Y+L N+AY+AVLSP E+L  G  S+AVAV FA R M  +S +MP+FVG SVFGS+N   +S+SRLT TGA E  MP +LAM+ + +LTP+PA++I+ +L + +QFY + F LIELAGFAFA IAA+AV  LLYLRYK P+L   F+LPI+ P++FL  DL I  LTIYQQP +S  ++ LML+++P+Y + ++W  KP+S  ++I K T
Sbjct:   29 AINCYKVKWATRVAVIFSFGKGIALLLIIGFGLYYLATGHVENFHNAFEGSNVSPGYLALAFYQGFWAYSGWNYLNFLVEEMKNPGRNLPLAIGIALTLVTGLYMLTNIAYMAVLSPYEMLATGSGSSAVAVVFAKRAMPRISMLMPVFVGASVFGSINGLAMSMSRLTYTGAREGHMPSILAMIHHCNLTPIPAILILLVLAVGYQFYSDLFALIELAGFAFAFIAALAVTALLYLRYKEPNLRTSFQLPIVFPIVFLGCDLLILMLTIYQQPRESLSNVILMLVAVPIYWLGVSWENKPKSFQNVIYKGT 340          
BLAST of slc7a-4 vs. TrEMBL
Match: A0A183T5B4 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS11662 PE=4 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 9.519e-81
Identity = 174/310 (56.13%), Postives = 230/310 (74.19%), Query Frame = 3
Query:  924 NCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKIT 1853
            N Y V+WAT++A++FT+ K+LALL+II  G  YL +G+ +SF +PF GS      + +AFYQGFWA+ GWNYLNFL  E++NP +NLPLAI +SL L+T + ++ NVAYLAVLSP E++  G +S AVAV FA+R M   S  MPIFVG SVFGS+N E+LS+SRLT TGA E  MP +LA+V +K+LTP+P+++ I +L I FQFY + F LIEL GFAF++IAA+AV  LLY RYK P+L   FKLP+  P+ FLL DLFI  LTIYQQP +S  +L L+L +IP+YI+ I W +KP+S T  + K+T
Sbjct:  161 NAYKVKWATRVAVLFTICKMLALLLIIGFGIYYLAKGHVQSFQEPFEGSATSPGLLALAFYQGFWAFFGWNYLNFLVEEIENPGRNLPLAIAISLALVTCLNIMTNVAYLAVLSPYEMIASGDASVAVAVTFANRAMPWFSLAMPIFVGASVFGSINGEVLSMSRLTFTGAREGHMPSILALVHHKNLTPLPSILAIGILGIAFQFYSDIFALIELVGFAFSLIAALAVSSLLYFRYKEPNLKTTFKLPLFFPIAFLLGDLFILILTIYQQPKESLSNLILILSAIPIYIVGIGWKRKPKSWTRFMHKLT 470          
BLAST of slc7a-4 vs. TrEMBL
Match: A0A068X2Y4 (Cationic amino acid transporter OS=Echinococcus granulosus OX=6210 GN=EgrG_000913800 PE=4 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 7.740e-80
Identity = 171/312 (54.81%), Postives = 230/312 (73.72%), Query Frame = 3
Query:  918 AINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKIT 1853
            AINCY V+WAT++A++F+  K +ALL+II  G  YL  G+ E+F + F GS      + +AFYQGFWAYSGWNYLNFL  EMKNP +NLPLAI ++LTL+T +Y+L N+AY+AVLSP E+L  G  S+AVAV FA R M  +S +MP+FVG SVFGS+N   +S+SRLT TGA E  MP +LAM+ + +LTP+PA++I+ +L + +QFY + F LIELAGFAFA IAA+AV  LLYLRYK P+L   F+LPI+ P++FL  DL I  LTIYQQP +S  ++ LML+++P+Y + ++W  KP+   + I K T
Sbjct:   29 AINCYKVKWATRVAVIFSFGKGIALLLIIGFGLYYLATGHVENFHNAFEGSNVSPGYLALAFYQGFWAYSGWNYLNFLVEEMKNPGRNLPLAIGIALTLVTGLYMLTNIAYMAVLSPYEMLATGSGSSAVAVVFAKRAMPWISMLMPVFVGASVFGSINGLAMSMSRLTYTGAREGHMPSILAMIHHCNLTPIPAILILLVLAVSYQFYSDLFALIELAGFAFAFIAALAVTALLYLRYKEPNLKTSFQLPILFPIVFLGCDLLILMLTIYQQPRESLSNVILMLVAVPIYWLGVSWENKPKGFQNFIYKGT 340          
BLAST of slc7a-4 vs. Ensembl Cavefish
Match: slc7a11 (solute carrier family 7 member 11 [Source:NCBI gene;Acc:103037778])

HSP 1 Score: 194.512 bits (493), Expect = 3.545e-53
Identity = 127/307 (41.37%), Postives = 192/307 (62.54%), Query Frame = 3
Query:  903 VVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPR 1823
            + T+  IN  +V W  ++ I  T SK+LA+ IIIV G   L +G T++F + F         +P+AFY G +AY+GW YLNF+T E++NPE+N+PLAI +S+ ++TV Y L NVAY  V+S  ++L    +S AVAV FA++ MG  S  +P+FV MS FGSMN  L ++SR+    + E Q+PEVL+M+  +  TP+ AVI++  +T+L  F  + + L+    F   +   +AV  L+YLRY  PD+PRPFK+PI +P +F     F+  L++Y  P ++ I   ++L  IP Y I I + K+P+
Sbjct:  162 ITTVMYINSMSVSWTARLQIFLTFSKLLAIAIIIVPGLYQLFKGETKNFQNAFQVDSVQVTGLPLAFYSGMYAYAGWFYLNFVTEEVENPERNVPLAICISMVIVTVCYTLTNVAYYTVMSAADLL----ASDAVAVTFAEKLMGNFSMAVPLFVAMSCFGSMNGCLFAISRMFFVASREGQLPEVLSMIHVRRHTPIAAVIVLYPITLLNLFLGDIYSLLNFMSFLRWLFIGVAVLGLIYLRYTRPDMPRPFKVPIFIPAVFSFTSFFMVFLSLYSDPVNTGIGFAILLTGIPAYYILIVFNKRPK 464          
BLAST of slc7a-4 vs. Ensembl Cavefish
Match: slc7a10b (asc-type amino acid transporter 1-like [Source:NCBI gene;Acc:103033048])

HSP 1 Score: 184.882 bits (468), Expect = 1.016e-49
Identity = 121/321 (37.69%), Postives = 195/321 (60.75%), Query Frame = 3
Query:  900 CVVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVD----PFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKI 1850
            C++ L  +NC++V+ AT++  +FTV K++AL +II +G V + +GN E         FSG+      I +AF Q  +A+SGWN+LN++T E+ +P +NLP AI +S+ L+T VY L N+AY + +SP+E+L    SS AVAV F ++ +G+ S +MPI V +S FG +N  L + SRL  +GA E  +P +LAM+ +K  TP+PA+++    TI+         LI    F   +   + +  LLY R+K P+L RP K+ ++VP+ +LL    + G +++ +P    + L +ML  +PVY + + W  KP+ + D I K+
Sbjct:  171 CILFLTWVNCFSVRLATRIQDIFTVGKLMALGLIIAVGMVQIYKGNYEGLTPQIAFDFSGNSPSVGQIALAFLQASFAFSGWNFLNYVTEEVVDPRRNLPRAIYISIPLVTFVYTLTNIAYFSSMSPEELL----SSNAVAVTFGEKLLGMFSTIMPISVALSTFGGINGYLFTSSRLCFSGAREGHLPSLLAMIHFKSCTPIPALLVCCTATIVIMCIGETHNLINYVSFINYLSYGVTIAGLLYYRWKKPNLYRPIKVSLLVPMSYLLFWALLLGFSLHSEPVVCGVGLVIMLTGVPVYFLGVYWKDKPKCIYDFIGKL 487          
BLAST of slc7a-4 vs. Ensembl Cavefish
Match: slc7a8b (large neutral amino acids transporter small subunit 2 [Source:NCBI gene;Acc:103044995])

HSP 1 Score: 184.882 bits (468), Expect = 1.210e-49
Identity = 123/317 (38.80%), Postives = 192/317 (60.57%), Query Frame = 3
Query:  921 INCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXN------TESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKIT 1853
            +NC++V+WAT++  +FT  K+LAL +II++G V + +GN        +F +PF    +    I +AF QG +AY GWN+LN++T E+ +P +NLP AI +S+ L+T VY+  NVAY+  +SP E+L    +S AVAV F ++ +GVMSW+MPI V +S FG +N  L + SR+   GA E  +P +LAM+     TP+PA++   + T+L     + + LI   GF   +   + V   + LR + PDL RP K+ ++ PV++LL   F+   ++Y QP    I L +ML  +PVY + + W  KP+  T  + K+T
Sbjct:  168 VNCFSVRWATRVQDIFTAGKLLALGLIIIMGIVQMCKGNYYWLEPAHAF-EPFQD--YDVGRIALAFLQGSFAYGGWNFLNYVTEELIDPYRNLPRAIFISIPLVTFVYVFANVAYITAMSPTELL----ASNAVAVTFGEKLLGVMSWIMPISVALSTFGGINGSLFTSSRMFFAGAREGHLPRLLAMIHVNRFTPIPALLFTCISTLLMLCTSDMYTLINYVGFINYLFYGVTVAGQIVLRIRQPDLSRPIKVSLVWPVIYLLFWAFLLVFSLYSQPMVCCIGLAIMLTGVPVYYLGVYWENKPKKFTHFVGKMT 477          
BLAST of slc7a-4 vs. Ensembl Cavefish
Match: slc7a10b (asc-type amino acid transporter 1-like [Source:NCBI gene;Acc:103033048])

HSP 1 Score: 181.8 bits (460), Expect = 2.008e-48
Identity = 120/318 (37.74%), Postives = 193/318 (60.69%), Query Frame = 3
Query:  900 CVVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVD----PFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLI 1841
            C++ L  +NC++V+ AT++  +FTV K++AL +II +G V + +GN E         FSG+      I +AF Q  +A+SGWN+LN++T E+ +P +NLP AI +S+ L+T VY L N+AY + +SP+E+L    SS AVAV F ++ +G+ S +MPI V +S FG +N  L + SRL  +GA E  +P +LAM+ +K  TP+PA+++    TI+         LI    F   +   + +  LLY R+K P+L RP K+ ++VP+ +LL    + G +++ +P    + L +ML  +PVY + + W  KP+ + D I
Sbjct:  171 CILFLTWVNCFSVRLATRIQDIFTVGKLMALGLIIAVGMVQIYKGNYEGLTPQIAFDFSGNSPSVGQIALAFLQASFAFSGWNFLNYVTEEVVDPRRNLPRAIYISIPLVTFVYTLTNIAYFSSMSPEELL----SSNAVAVTFGEKLLGMFSTIMPISVALSTFGGINGYLFTSSRLCFSGAREGHLPSLLAMIHFKSCTPIPALLVCCTATIVIMCIGETHNLINYVSFINYLSYGVTIAGLLYYRWKKPNLYRPIKVSLLVPMSYLLFWALLLGFSLHSEPVVCGVGLVIMLTGVPVYFLGVYWKDKPKCIYDFI 484          
BLAST of slc7a-4 vs. Ensembl Cavefish
Match: slc7a10a (solute carrier family 7 member 10a [Source:ZFIN;Acc:ZDB-GENE-080116-1])

HSP 1 Score: 178.333 bits (451), Expect = 1.666e-47
Identity = 121/322 (37.58%), Postives = 197/322 (61.18%), Query Frame = 3
Query:  900 CVVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGF----HTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKIT 1853
            C++ L  +NC +V+WAT++   FT+ K+LAL++IIV+G V + +G+ ++ ++P +   F        I +AF Q  +A+SGWN+LN++T E+  P KNLP AI +S+ L+T+VY L N+AY + +SP+E+L    +S AVAV F  + +G+ SWVMPI V +S FG +N  L + SRL  +GA E  +P +LAM+  K+ TP+PA+++    TI+         LI    F   +   + +  LLY R+K P L RP K+ + VP+ +L+    + G ++Y +P    + L +ML  +P+Y I + W++KPR +   +  +T
Sbjct:  153 CILLLTWVNCSSVRWATRIQDFFTIGKLLALVLIIVVGLVQICKGHYDA-LEPQTAFEFIRDPSVGQIALAFLQASFAFSGWNFLNYVTEEVVEPRKNLPRAIYISIPLVTLVYTLTNIAYFSSMSPEELL----ASNAVAVTFGQKLLGMFSWVMPISVALSTFGGINGYLFTSSRLCFSGAREGHLPYLLAMIHLKNCTPIPALLVCCTATIVILCIGETHNLINYVSFINYLSYGVTIAGLLYYRWKKPKLVRPIKVKLTVPISYLIFWAVLLGFSLYSEPVVCGMGLVIMLTGVPIYFIGVHWSEKPRWIYSAVEYVT 469          
BLAST of slc7a-4 vs. Ensembl Sea Lamprey
Match: SLC7A11 (solute carrier family 7 member 11 [Source:HGNC Symbol;Acc:HGNC:11059])

HSP 1 Score: 189.504 bits (480), Expect = 6.687e-52
Identity = 123/311 (39.55%), Postives = 193/311 (62.06%), Query Frame = 3
Query:  921 INCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKIT 1853
            IN  +V W  ++    T SK+ A+ III+ G ++L +GNTE F D F G       +P+AFY G +AYSGW Y+NF+T E+ NPE+N+PLAI +S+ ++TV Y  +N+AY AV+S  E+L    +S AVAV FA+R +G  S  +P+FV +S  GS+N  + +++R+    + E  +P +L+M+  +  TP+PAVII+  LT+L  F  + + L+    FA  +  AMAV  L+Y+R+  P + RPFK+P+ +PV F L+ L +  L++Y  P +S I   + L  +PVY + + W  KP ++     ++T
Sbjct:  185 INSSSVSWTARLQTFLTFSKLAAVGIIIIPGIIHLAKGNTEHFQDSFVGKEVGLMGLPLAFYSGMYAYSGWFYMNFVTEEVDNPERNIPLAICISMGIVTVAYTFMNMAYFAVMSGAELL----ASKAVAVTFAERLLGNFSITVPVFVALSCLGSLNGGVFAIARMFFVASREGHLPHILSMIHIRKHTPLPAVIILYPLTMLMLFVGDIYSLLNFFSFARWLFIAMAVSGLVYMRFTRPHMHRPFKVPLFIPVFFSLSCLLVVALSLYSDPVNSGIGCAITLSGVPVYYLTVVWDGKPTAVKRATDRVT 491          
BLAST of slc7a-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002665.1 (pep scaffold:Pmarinus_7.0:GL476806:119517:143089:1 gene:ENSPMAG00000002414.1 transcript:ENSPMAT00000002665.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 143.665 bits (361), Expect = 4.566e-37
Identity = 102/255 (40.00%), Postives = 155/255 (60.78%), Query Frame = 3
Query:  903 VVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKL 1667
            ++ +G +NC +++WA +   V T+ K+LAL I+ V G V L  G T + +  F+G+    A I  +FYQG WAY GWN LN+ T E+K+  KN+   I++++ L+T  Y+LVN++Y+ VL+P+EI+    SSAAVAV + DR +G  SW++P+ V +S FGS+N     + RL    A E     +LAM+S +H TP PAV   TLL++ F    +   L    GF   ++  +    LL LRY+ PDL RP+++
Sbjct:  170 LLVVGILNCVSMKWAMRALDVLTLLKMLALAIVSVGGLVLLASGRTHNPLGSFAGAPPSPAQIGESFYQGLWAYGGWNALNYATEELKDVHKNITRCIVVAVPLVTAFYVLVNISYMTVLTPKEII----SSAAVAVTWGDRVLGSFSWIVPLSVAVSTFGSLNCSAFVMGRLNYAAAREGHALPLLAMLSVRHQTPTPAVAFSTLLSVAFVLPTDLIMLTNYFGFVTWLLVGLNCAGLLVLRYREPDLRRPYRV 420          
BLAST of slc7a-4 vs. Ensembl Sea Lamprey
Match: slc7a5 (solute carrier family 7 member 5 [Source:ZFIN;Acc:ZDB-GENE-080818-4])

HSP 1 Score: 116.316 bits (290), Expect = 6.738e-30
Identity = 69/182 (37.91%), Postives = 114/182 (62.64%), Query Frame = 3
Query: 1308 AVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKIT 1853
            A +F +  +GVMSW++P+FV +S FGS+N  L + SRL   GA E  +P +L+M+  +  TP+P+++   L+T+L+    + F +I    F   +  AMA+C +++LRYK P   RP K+ I++P+ F+LA +F+  +++   P +  I L ++L  IPVY + + W  KP SL +LIS +T
Sbjct:    1 AQDFGNYHLGVMSWIIPVFVSLSCFGSVNGSLFTSSRLFFVGAREGHLPNLLSMIHRRLFTPVPSLLFTCLMTLLYAISDDIFSVINFFSFFNWLCIAMAICGMMWLRYKEPQRDRPIKVNILLPISFVLACIFLIVVSVVVTPVECGIGLGIILTGIPVYFVGVRWQNKPPSLLNLISSMT 182          
BLAST of slc7a-4 vs. Ensembl Sea Lamprey
Match: slc7a7 (solute carrier family 7 member 7 [Source:ZFIN;Acc:ZDB-GENE-051127-5])

HSP 1 Score: 100.908 bits (250), Expect = 2.112e-24
Identity = 57/185 (30.81%), Postives = 106/185 (57.30%), Query Frame = 3
Query: 1314 NFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWT--KKP---RSLTDLISKIT 1853
             FAD+  G+ +W +P+ V +S FG +N+ +L+ SRL   G+ E Q+P+ + ++  +  TP+PA++   ++++++    + + LI    F++     +++   LYLR+K P+  RP KL II P++F    +F+  L +Y    +S + + + L  +PVY + I  +  K+P   R +TD I K T
Sbjct:    1 TFADQVFGIFNWTIPLAVALSCFGGLNASILAASRLFFVGSREGQLPDAICLIHMERYTPVPALLFNGMMSLIYLCVEDIYQLINYYSFSYWFFVGLSIAGQLYLRWKEPNRHRPLKLSIIFPIVFCCCTVFLVVLPLYSDTVNSLVGIAIALTGVPVYFVTIHLSEEKRPKILRKITDFIMKYT 185          
BLAST of slc7a-4 vs. Ensembl Sea Lamprey
Match: slc7a8b (solute carrier family 7 member 8b [Source:ZFIN;Acc:ZDB-GENE-030616-586])

HSP 1 Score: 85.8853 bits (211), Expect = 6.133e-19
Identity = 56/172 (32.56%), Postives = 93/172 (54.07%), Query Frame = 3
Query: 1314 NFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYII----FIAWTKK 1817
             F ++ +G +S +MP  V +S FG +N  L + SRL   GA E  +P +LAM+  +  TP+PA++   + T+L     + + LI   GF   +   +AV  LL LR+  PD+PRP K+ +  P+++LL   F+   ++  +P    + L +ML  +PVY +    +I W   
Sbjct:    1 TFGEKLLGPLSVLMPFSVALSTFGGVNGSLFTSSRLFFAGAREGHLPGLLAMIHVERCTPIPALLFTCVTTLLMLLTSDMYTLINYVGFINYLFYGVAVAGLLVLRWTKPDIPRPIKVSVAFPIIYLLFWAFLLVFSLVSEPVVCGVGLAIMLTGVPVYYMAVYYYIDWRHS 172          
BLAST of slc7a-4 vs. Ensembl Nematostella
Match: EDO41594 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3U0])

HSP 1 Score: 192.586 bits (488), Expect = 3.976e-53
Identity = 126/320 (39.38%), Postives = 196/320 (61.25%), Query Frame = 3
Query:  900 CVVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFY--LIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKIT 1853
            C+  +  +NC++V+ AT++ +VFT +K++A+ ++I+ G V L +G T SF D F G+      +  AFY G WAY GWN LN++T E+KNP ++LP +I+  + L TV Y+LVN+AYL VL+P E++    +S AVAV  ++R  GVM+W +PIFV  S FG+ N    S  RL    A E  +PE LAMV  K  TP+PA++  +++  L     ++ +  LI    FA  V     V  LL+LRY+ P++ RP+K+P++VP++ LLA L++     Y+ P +SF  L  +L  IP Y++F+ +   P+   + +  IT
Sbjct:  123 CIGVITYVNCFSVKLATRVQVVFTAAKLIAIAMLIITGLVRLGQGFTGSFDDAFKGTTTSIGMVGFAFYNGLWAYDGWNNLNYVTEELKNPYRDLPRSILFGIPLGTVCYVLVNIAYLTVLTPVEVM----ASGAVAVTLSNRLYGVMAWTIPIFVACSTFGAANGSAFSGGRLVYVAAREGHLPEFLAMVHTKRHTPLPAMLFNSIIAWLMLLPDSSSFETLINYFSFAAWVFYGSTVSALLWLRYRKPEMERPYKVPLLVPIMVLLASLYLIIAPFYEAPLESFYCLLFILAGIPFYLVFVYFKVAPKWFLNGVDSIT 438          
BLAST of slc7a-4 vs. Ensembl Nematostella
Match: EDO40551 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S703])

HSP 1 Score: 181.03 bits (458), Expect = 1.064e-48
Identity = 118/298 (39.60%), Postives = 185/298 (62.08%), Query Frame = 3
Query:  921 INCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFY--LIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAW 1808
            INC +V+WAT++   FT+ K++A+ I++++G + + +G  E   DPF  S  + A+I +AFY G WAY GWN LNF+T EMKNP ++LP A+I+ + L+T+ YLL N+AY+AV+  + IL    SS AVA+   D  +G MSW++PIFV  S FG +N  L S +RL    A    MP +LAM+  K  TPMP++I +  + ++      + +  L+    FA  +     +C LLYLR+K P+  RP+K+ +++PV+   A L++      ++P +S ++L  ++L IPVY +F  W
Sbjct:  175 INCASVRWATRIQDSFTLGKLIAIAILVILGIITIAKGQVEYLEDPFEKSTPNPAAIGLAFYSGLWAYDGWNALNFVTEEMKNPARDLPRALIIGIPLVTICYLLTNIAYIAVVGREGIL----SSGAVAMTVGDMYLGPMSWIIPIFVACSTFGCVNGLLFSGARLVYVSARNGHMPRLLAMIHNKCQTPMPSIIFMNTIALIMLIPDASEFGTLVNYFSFAAWLSYFAVICALLYLRWKRPNAHRPYKVWLVIPVIAACAALYLLITPFAKEPVESSMALIFIVLGIPVYFLFCKW 468          
BLAST of slc7a-4 vs. Ensembl Nematostella
Match: EDO41545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3T4])

HSP 1 Score: 176.407 bits (446), Expect = 4.060e-47
Identity = 117/320 (36.56%), Postives = 195/320 (60.94%), Query Frame = 3
Query:  900 CVVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFY--LIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKIT 1853
            C+V +  +NC++V+WAT++  VFT +K+L + ++ +IG V L RG TE F + FSGS  +   I +AFY G WA+ GWN LN+ T EMK+PE+++P AII+ ++LITV YLL+NVAY+ VL    IL     S AVAV+  +  +G + W++P+FV  S FG++N  +L+  RL    A +  MP +LAM+  K  TP+P+++  TL++++      + +  L++   FA  +        LL+LRYK P+  RP+++ ++VP++  ++ +++    I   PF S I+L ++   +P Y +F+     P+    ++   T
Sbjct:  173 CLVVVTGVNCWSVKWATRVQDVFTYAKLLCIAMLTIIGIVELCRGKTEHFQNGFSGSTTNIGQIGLAFYIGLWAFDGWNNLNYCTEEMKHPERDMPRAIIIGISLITVCYLLINVAYITVLGASGIL----ESEAVAVSVGNMYLGPVKWIVPLFVAASTFGAVNGMVLTNGRLLYVAARDNLMPSLLAMIHVKRFTPLPSLLFTTLVSVIMLIPETSSFTTLVDFFSFAAWLFYGGTFLSLLWLRYKRPNQHRPYRVWVVVPIIMSISSIYLIVAPITGDPFGSLIALAVIAAGLPFYFLFVYSNLTPKWFLRMVDSFT 488          
BLAST of slc7a-4 vs. Ensembl Nematostella
Match: EDO37074 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGV3])

HSP 1 Score: 175.252 bits (443), Expect = 7.026e-47
Identity = 117/302 (38.74%), Postives = 187/302 (61.92%), Query Frame = 3
Query:  900 CVVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQF--YRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIF 1799
            C+VT+  INC++V+WAT++  +FT +K+L + ++++IG V L +G TE+  + F GS    A I  AFY G WAY GWN LN+ T EMK+P +++P AII+ +++IT  YL+VN+AY+ VL    IL    +S AVAV+  D  +G M W++P+FV  S FG++N    +  RLT T A +  +P +LAM+  K LTP+P++++ + + I        N   L+    FA  +    +   LL+LRYK P++PRP+++PI++P+  LLA +++       +P  S I+  ++L  +P Y  F
Sbjct:  170 CIVTVTGINCWSVRWATRVQRIFTYAKLLCIAMLVIIGVVELCKGKTENLQNAFEGSETDPAKIGFAFYIGLWAYDGWNSLNYCTEEMKDPARDMPKAIIIGISIITGCYLMVNIAYITVLGGAGIL----ASEAVAVSIGDVYLGPMKWIIPVFVAASTFGTVNGVAFTSGRLTYTAARDGLLPSMLAMIQVKRLTPLPSMLLTSTIAICMLLPPGSNFMSLVGFFSFAAWLFYGGSFAALLWLRYKKPEMPRPYRVPIVIPIFMLLASMYLCIAPFVAKPIGSTIACLIILAGLPFYFFF 467          
BLAST of slc7a-4 vs. Ensembl Nematostella
Match: EDO41148 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S561])

HSP 1 Score: 174.481 bits (441), Expect = 1.308e-46
Identity = 111/313 (35.46%), Postives = 184/313 (58.79%), Query Frame = 3
Query:  921 INCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFY--LIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKIT 1853
            +NC +V+W++++ I FTV K++A+L++++ G V + +G+  S  D F G+      +  AFY G ++Y GWN LNF   E+K P + +P AI +++ L+T  Y+LVN+ YL+VL+P E+    ++S AVAV  A R  GVM+W +PI V  S FGS N    S  RL    A E  +PE+LAMV  K  TP+PA++  + ++ +     ++ +  L+    F   +   + +  ++++R +  D  RP+K+PII+P L  L  +++     YQ P  SF +L  +L  IPVY+ F+ +   P+ + D  ++IT
Sbjct:  175 VNCASVKWSSRIQIAFTVGKMIAILMLVLTGIVRIAQGHVSSLKDSFQGTATSLGMVGFAFYNGLFSYDGWNQLNFFVEEIKEPNRTVPRAIWIAIPLVTASYVLVNIGYLSVLTPDEL----RTSNAVAVTLASRMYGVMAWTIPILVAFSTFGSANGNFFSGGRLAYAAAREGHLPELLAMVHTKRHTPIPAILFSSTISCIMLIPDSSKFETLLNFGAFIVWLFYGVTMFSIIWMRVRQKDKTRPYKVPIILPCLMTLLSIYLVVAPFYQAPLPSFYALLAVLSGIPVYLFFVRYKVLPQCIMDRYARIT 483          
BLAST of slc7a-4 vs. Ensembl Medaka
Match: slc7a5 (solute carrier family 7 member 5 [Source:NCBI gene;Acc:101163489])

HSP 1 Score: 190.66 bits (483), Expect = 1.617e-51
Identity = 128/312 (41.03%), Postives = 204/312 (65.38%), Query Frame = 3
Query:  900 CVVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFV--DPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSL 1829
            C++ L  +NCY+V+ AT++   F  +K+LAL++II+IG V + +G+T+  +  + F GS +   +I +A Y G +AY GWNYLNF+T EM  P KNLP AII+SL ++T VY+L N+AY   LSPQ++L     S AVAV+F +  +G M+W++P+FVG+S FGS+N  L + SRL   GA E  +P +L+M+    LTP+P++I   L+T+L+ F  + F +I    F   +  A+A+  +++LR+K P+L RP K+ I++P+ F+LA LF+  ++ ++ P +  I   ++   +PVY I + W  KP+ L
Sbjct:  188 CILLLTFVNCYSVKAATRVQDFFAAAKLLALILIIIIGFVKIGQGDTDDLLPENSFKGSNYEFGNIGLALYSGLFAYGGWNYLNFVTEEMIEPYKNLPRAIIISLPIVTAVYVLTNLAYFTTLSPQQML----GSEAVAVDFGNHHLGPMAWIIPVFVGLSCFGSVNGSLFTSSRLFFVGAREGHLPNLLSMIHPTLLTPLPSLIFTCLMTLLYAFSNDIFSVINFFSFFNWLCIALAIIGMMWLRHKKPELERPIKVNILLPISFVLACLFLIIVSFWKTPIECAIGFGIIATGLPVYFIGVWWQNKPKWL 495          
BLAST of slc7a-4 vs. Ensembl Medaka
Match: slc7a10a (asc-type amino acid transporter 1 [Source:NCBI gene;Acc:101166040])

HSP 1 Score: 180.644 bits (457), Expect = 3.181e-48
Identity = 123/322 (38.20%), Postives = 198/322 (61.49%), Query Frame = 3
Query:  900 CVVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTAS----IPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKIT 1853
            CV+ L  +NC +V+WAT++  +FTV K+LAL +IIV+G V + RG+ ++ V P     F   S    I +AF Q  +AYSGWN+LN++T E+  P KNLP AI +S+ L+T+VY + N+AY + ++P+E+L    +S AVAV F ++ +G+ SWVMPI V +S FG +N  L + SRL  +GA E  +P +LAM+  K+ TP+PA+++    TI+         LI    F   +   + +  LLYLR   P+L RP ++ ++VP+ +L+    + G ++Y +P    + + +ML  +PVY + + W +KP+ +  L+ + T
Sbjct:  165 CVLFLTWVNCSSVRWATRIQDIFTVGKLLALALIIVVGLVQIFRGHYDALV-PSVAFEFQQDSSVGQIALAFLQASFAYSGWNFLNYVTEEVVEPRKNLPRAIYISIPLVTLVYTMTNIAYFSSMTPEELL----ASNAVAVTFGEKLLGMFSWVMPISVALSTFGGINGYLFTSSRLCFSGAREGHLPYLLAMIHLKNCTPIPALLVCCFATIVILCIGETHNLINYVSFINYLSYGVTIAGLLYLRKTRPNLARPIRVSLLVPISYLVFWAVLLGFSLYSEPVVCGLGMVIMLTGVPVYFVGVQWKEKPKWVYRLVERFT 481          
BLAST of slc7a-4 vs. Ensembl Medaka
Match: ENSORLT00000006048.2 (large neutral amino acids transporter small subunit 1 [Source:NCBI gene;Acc:101158196])

HSP 1 Score: 181.415 bits (459), Expect = 3.248e-48
Identity = 123/321 (38.32%), Postives = 198/321 (61.68%), Query Frame = 3
Query:  900 CVVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDP---FSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKIT 1853
            C+ +L  +NC +V+ ATK+  +FT SK+ AL III+ G + +  G+   ++ P   F GS     +I +A Y G +A+ GWNYLN++T EM NPE+NLPLAII+S+ ++TVVY+L N+AY   +SP+ ++     S AVAV F ++ +G MSW++P+FVGMS FG++N  L + +RL   GA E Q+P  L +V     TP+P++I    L++++   ++ F +I L  F   +   MA+  L++LR   PDL RP K+ + +PV F+L  +F+  ++ +  PF+  +   ++L  IP Y++   W KKP  +  ++   T
Sbjct:  197 CLTSLTFVNCISVRAATKVQDLFTASKLFALCIIILFGFIQIFTGDV-PYLTPEKSFEGSKMGVDNIVLALYSGLFAFGGWNYLNYVTEEMVNPERNLPLAIIISMPIVTVVYVLTNLAYFTTISPEVMV----ESEAVAVTFGEQHLGRMSWLIPVFVGMSCFGAVNGSLFTSARLFYAGAREGQLPAALGLVHTDLFTPVPSLIFTCFLSMMYTISQDIFSVINLFSFFTWLCVGMAIAGLVWLRLTKPDLRRPIKVYLFIPVTFVLGCIFMIVVSFWAAPFECLVGTSIILTGIPAYLLGYKW-KKPHMVQKMLEIFT 511          
BLAST of slc7a-4 vs. Ensembl Medaka
Match: slc7a6 (Y+L amino acid transporter 2 [Source:NCBI gene;Acc:101174987])

HSP 1 Score: 179.104 bits (453), Expect = 3.355e-48
Identity = 120/313 (38.34%), Postives = 194/313 (61.98%), Query Frame = 3
Query:  921 INCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYI--IFIAWTKKPRSLTDLISKIT 1853
            IN   V+W T++  +FT +KV AL++IIV G V L +G T +F   F GS      I +A Y   ++YSGW+ LNF+T E+KNPE+NLPLAI +S+ ++T +Y+L NVAY AVL    IL     S AVAV FAD T+G+MSW +PI V +S +G +N+ +++ SRL   G+ E  +P+ L+M+  +  TP+PA+I   ++++++    + F LI    F++     ++V   +YLR+K PD  RP KL ++ P++F +  +F+  + +Y    +S I + + L  +PVY   +++  +K+P  +T L+  +T
Sbjct:  121 INSAYVRWGTRVQDIFTYAKVAALIVIIVTGIVKLCQGYTNNFESAFQGSSADPGDIALALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTTIYILTNVAYYAVLDVGAIL----GSDAVAVTFADHTLGLMSWTIPIAVALSCYGGLNASIIAASRLFFVGSREGHLPDALSMIHIERFTPIPALIFNCIMSLIYLTVEDVFQLINYYSFSYWFFMGLSVAGQIYLRWKQPDRARPLKLTLVYPLVFCMCSVFLVAVPLYSNTVNSLIGIAIALSGVPVYFLGVYLPESKRPPIITKLLRSLT 429          
BLAST of slc7a-4 vs. Ensembl Medaka
Match: slc7a6 (Y+L amino acid transporter 2 [Source:NCBI gene;Acc:101174987])

HSP 1 Score: 179.104 bits (453), Expect = 8.078e-48
Identity = 120/313 (38.34%), Postives = 194/313 (61.98%), Query Frame = 3
Query:  921 INCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYI--IFIAWTKKPRSLTDLISKIT 1853
            IN   V+W T++  +FT +KV AL++IIV G V L +G T +F   F GS      I +A Y   ++YSGW+ LNF+T E+KNPE+NLPLAI +S+ ++T +Y+L NVAY AVL    IL     S AVAV FAD T+G+MSW +PI V +S +G +N+ +++ SRL   G+ E  +P+ L+M+  +  TP+PA+I   ++++++    + F LI    F++     ++V   +YLR+K PD  RP KL ++ P++F +  +F+  + +Y    +S I + + L  +PVY   +++  +K+P  +T L+  +T
Sbjct:  169 INSAYVRWGTRVQDIFTYAKVAALIVIIVTGIVKLCQGYTNNFESAFQGSSADPGDIALALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTTIYILTNVAYYAVLDVGAIL----GSDAVAVTFADHTLGLMSWTIPIAVALSCYGGLNASIIAASRLFFVGSREGHLPDALSMIHIERFTPIPALIFNCIMSLIYLTVEDVFQLINYYSFSYWFFMGLSVAGQIYLRWKQPDRARPLKLTLVYPLVFCMCSVFLVAVPLYSNTVNSLIGIAIALSGVPVYFLGVYLPESKRPPIITKLLRSLT 477          
BLAST of slc7a-4 vs. Planmine SMEST
Match: SMESG000017104.1 (SMESG000017104.1)

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 355/357 (99.44%), Postives = 357/357 (100.00%), Query Frame = 3
Query:  903 VVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKITXXXXXXXXXXXXXXXSDELDAMLANKKSSQNDPSIKNGKL 1973
            ++TLGAINCYNVQWATKMAIVFTVSKVLALLIIIVIGGVYLIRGNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITVVYLLVNVAYLAVLSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVIIITLLTILFQFYRNAFYLIELAGFAFAVIAAMAVCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKITVNLQKLLNVVLQDVVSDELDAMLANKKSSQNDPSIKNGKL
Sbjct:  166 IMTLGAINCYNVQWATKMAIVFTVSKVLALLIIIVIGGVYLIRGNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITVVYLLVNVAYLAVLSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVIIITLLTILFQFYRNAFYLIELAGFAFAVIAAMAVCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKITVNLQKLLNVVLQDVVSDELDAMLANKKSSQNDPSIKNGKL 522          
BLAST of slc7a-4 vs. Planmine SMEST
Match: SMESG000006721.1 (SMESG000006721.1)

HSP 1 Score: 322.013 bits (824), Expect = 1.535e-99
Identity = 194/315 (61.59%), Postives = 247/315 (78.41%), Query Frame = 3
Query:  909 TLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKIT 1853
            ++ AINCY+V+WAT+  + FT+SKVLALLIIIVIG   L RGN  SF DPF+ S     S+ +AFYQGFWAY+GWNYLNFLT+EM NP +NLP+AII SLT++TV+Y+  N+AYLAVLSP+E+L I   S AVAV FAD+TMG+ S +MPIFVG SVFGSMN E LS+SRLT T A +  +PE LAMVS K+LTPMPAVI +  L+++F F  +  YLIELAGF+F VI+ MAV CL+YLR KCP+LPR FKLP+I+P++FLL DLFIG LT+Y++P DS I + ++ L IP+YIIF+ W  KP+S+T+L   +T
Sbjct:  149 SIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLTIVTVIYVTTNIAYLAVLSPREMLEISSKSVAVAVVFADQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKLPLILPIMFLLLDLFIGILTVYEKPTDSLIGVAIIALGIPIYIIFVVWKSKPKSVTNLTESLT 463          
BLAST of slc7a-4 vs. Planmine SMEST
Match: SMESG000081276.1 (SMESG000081276.1)

HSP 1 Score: 313.153 bits (801), Expect = 4.109e-96
Identity = 176/319 (55.17%), Postives = 243/319 (76.18%), Query Frame = 3
Query:  897 FCVVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKIT 1853
            F V TL AINCYNV+WA K+AIVFTV KV ALL+II +G   +  G ++SF +PF+GS F+  S+ +AFY GFWA++GWNYLNFLT EMKNP +NLP+AI+LSL ++T VY++VNVAYL VL+P+E+L+ G+SS+A+AV FA+RTMG  SW+MPI V  SVFGSMN E+LS+SRLT  GA EK +P V++M+S  HLTPMP++II+ ++ I FQ   + FYLIELAGFA+ VI AMA C LLY+R+K  +    F+L II+P+ FL+ D+F+  L +YQQP +S I + +M+L +P++++ ++W  KP+S  +    +T
Sbjct:  147 FGVFTLLAINCYNVKWAAKLAIVFTVGKVSALLLIIGLGLFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTVISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLT 465          
BLAST of slc7a-4 vs. Planmine SMEST
Match: SMESG000051755.1 (SMESG000051755.1)

HSP 1 Score: 180.644 bits (457), Expect = 1.370e-48
Identity = 128/318 (40.25%), Postives = 204/318 (64.15%), Query Frame = 3
Query:  900 CVVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKIT 1853
            C+  L  INCY+V+W+T +  + + +KV ALLIII+ G V L +G+T ++ + F+ S  +     MAFY G +AY+GWNYLN L  EMKNP ++LPL+I++S+ LI  +Y+L N+AY  +L P EIL    ++ AVAV  A R  GVM W+MPIFV MS FG +N  LL+ SR+    A+E QMP +L  ++ K+ TP+P+V+ ++L+++++  + +   LI   GF   +   +AV  +++ RYK P  PRP ++ +  P+++ +A + +  L+    P++S + + ++L + PVY IF+ W KKP+S  D +  IT
Sbjct:  152 CIGILTFINCYSVRWSTLVQDILSYAKVFALLIIIMTGIVKLAQGDTGNWENAFADSSTNPGDYAMAFYAGLFAYNGWNYLNCLIEEMKNPRRDLPLSILISMILIIFIYVLTNMAYFTILLPSEIL----NTKAVAVTVAIRLYGVMWWIMPIFVAMSTFGGVNGNLLATSRIFFVAAQENQMPMILETINVKYYTPVPSVLFVSLVSLVYLCFSDINILINYMGFVNWLAIGVAVFTVIWFRYKDPSKPRPIRVHLAFPIIYCVATVILLILSFVGGPYESLMGIVIILTAAPVYWIFVLW-KKPKSFQDKLDNIT 464          
BLAST of slc7a-4 vs. Planmine SMEST
Match: SMESG000044247.1 (SMESG000044247.1)

HSP 1 Score: 171.014 bits (432), Expect = 3.784e-45
Identity = 125/320 (39.06%), Postives = 195/320 (60.94%), Query Frame = 3
Query:  900 CVVTLGAINCYNVQWATKMAIVFTVSKXXXXXXXXXXXXXXXXXXNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITXXXXXXXXXXXXXXSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVXXXXXXXXXFQFYRNAFYLIELXXXXXXXXXXXXXCCLLYLRY--KCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKIT 1853
            C++ L  INC++V+ +T++  +FT +K+LAL+I+I+ G V L  G T ++  PFS +      + M FY G +AY GWNYLN +  EMKNP K+LP A+++S +++TVVY+L NV+Y  +LSP EI L    + AVAV        VM WV+P+FV MS FG +N  +++ SR+    A+  QMP  LAM+S    TP+P+VI ++L+++++  Y + + L+   GF   +  A A+  LLY R+  K   L RPF + +I P+++LL   FI         ++S +   +ML ++PVY+I + W KKP+S    +   T
Sbjct:  155 CILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKL----TNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKW-KKPKSFNRKLGDFT 469          
The following BLAST results are available for this feature:
BLAST of slc7a-4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC7A111.094e-5843.09solute carrier family 7 member 11 [Source:HGNC Sym... [more]
SLC7A55.550e-5040.00solute carrier family 7 member 5 [Source:HGNC Symb... [more]
SLC7A82.503e-4938.75solute carrier family 7 member 8 [Source:HGNC Symb... [more]
SLC7A69.759e-4936.56solute carrier family 7 member 6 [Source:HGNC Symb... [more]
SLC7A69.759e-4936.56solute carrier family 7 member 6 [Source:HGNC Symb... [more]
back to top
BLAST of slc7a-4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aat-38.003e-4939.81Amino Acid Transporter [Source:UniProtKB/TrEMBL;A... [more]
aat-31.696e-4839.81Amino Acid Transporter [Source:UniProtKB/TrEMBL;A... [more]
aat-18.404e-4738.94Amino Acid Transporter [Source:UniProtKB/TrEMBL;A... [more]
aat-18.404e-4738.94Amino Acid Transporter [Source:UniProtKB/TrEMBL;A... [more]
aat-21.067e-3538.92Amino Acid Transporter [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of slc7a-4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG16075.075e-6243.32gene:FBgn0039844 transcript:FBtr0085785[more]
CG16075.075e-6243.32gene:FBgn0039844 transcript:FBtr0085786[more]
CG16075.861e-6243.32gene:FBgn0039844 transcript:FBtr0334550[more]
CG16075.861e-6243.32gene:FBgn0039844 transcript:FBtr0334549[more]
mnd7.067e-5242.52gene:FBgn0002778 transcript:FBtr0075626[more]
back to top
BLAST of slc7a-4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc7a61.165e-5240.31solute carrier family 7 member 6 [Source:NCBI gene... [more]
slc7a61.998e-5240.31solute carrier family 7 member 6 [Source:NCBI gene... [more]
slc7a111.260e-5141.20solute carrier family 7 member 11 [Source:ZFIN;Acc... [more]
slc7a51.034e-5041.14solute carrier family 7 member 5 [Source:ZFIN;Acc:... [more]
slc7a52.388e-5041.14solute carrier family 7 member 5 [Source:ZFIN;Acc:... [more]
back to top
BLAST of slc7a-4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC7A119.461e-5641.29solute carrier family 7 member 11 [Source:NCBI gen... [more]
SLC7A119.563e-5641.56solute carrier family 7 member 11 [Source:NCBI gen... [more]
SLC7A111.154e-5541.29solute carrier family 7 member 11 [Source:NCBI gen... [more]
SLC7A113.558e-5541.53solute carrier family 7 member 11 [Source:NCBI gen... [more]
SLC7A113.945e-5541.53solute carrier family 7 member 11 [Source:NCBI gen... [more]
back to top
BLAST of slc7a-4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc7a113.787e-5742.95solute carrier family 7 (cationic amino acid trans... [more]
Slc7a114.796e-5643.19solute carrier family 7 (cationic amino acid trans... [more]
Slc7a68.692e-5237.81solute carrier family 7 (cationic amino acid trans... [more]
Slc7a72.908e-4936.52solute carrier family 7 (cationic amino acid trans... [more]
Slc7a72.908e-4936.52solute carrier family 7 (cationic amino acid trans... [more]
back to top
BLAST of slc7a-4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UPY5|XCT_HUMAN5.255e-5843.09Cystine/glutamate transporter OS=Homo sapiens OX=9... [more]
sp|Q5RAG7|XCT_PONAB1.047e-5743.09Cystine/glutamate transporter OS=Pongo abelii OX=9... [more]
sp|Q9WTR6|XCT_MOUSE2.649e-5642.95Cystine/glutamate transporter OS=Mus musculus OX=1... [more]
sp|Q7YQK4|LAT1_RABIT1.171e-5141.59Large neutral amino acids transporter small subuni... [more]
sp|Q59I64|YLAT2_DANRE1.859e-5140.00Y+L amino acid transporter 2 OS=Danio rerio OX=795... [more]
back to top
BLAST of slc7a-4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YK273.600e-16599.34Slc7a-4 (Fragment) OS=Schmidtea mediterranea OX=79... [more]
A0A0H3YF659.182e-9661.27Slc7a-8 OS=Schmidtea mediterranea OX=79327 GN=slc7... [more]
A0A068YDY48.368e-8155.13Cationic amino acid transporter OS=Echinococcus mu... [more]
A0A183T5B49.519e-8156.13Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A068X2Y47.740e-8054.81Cationic amino acid transporter OS=Echinococcus gr... [more]
back to top
BLAST of slc7a-4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc7a113.545e-5341.37solute carrier family 7 member 11 [Source:NCBI gen... [more]
slc7a10b1.016e-4937.69asc-type amino acid transporter 1-like [Source:NCB... [more]
slc7a8b1.210e-4938.80large neutral amino acids transporter small subuni... [more]
slc7a10b2.008e-4837.74asc-type amino acid transporter 1-like [Source:NCB... [more]
slc7a10a1.666e-4737.58solute carrier family 7 member 10a [Source:ZFIN;Ac... [more]
back to top
BLAST of slc7a-4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC7A116.687e-5239.55solute carrier family 7 member 11 [Source:HGNC Sym... [more]
ENSPMAT00000002665.14.566e-3740.00pep scaffold:Pmarinus_7.0:GL476806:119517:143089:1... [more]
slc7a56.738e-3037.91solute carrier family 7 member 5 [Source:ZFIN;Acc:... [more]
slc7a72.112e-2430.81solute carrier family 7 member 7 [Source:ZFIN;Acc:... [more]
slc7a8b6.133e-1932.56solute carrier family 7 member 8b [Source:ZFIN;Acc... [more]
back to top
BLAST of slc7a-4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc7a-4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO415943.976e-5339.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405511.064e-4839.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO415454.060e-4736.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO370747.026e-4738.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411481.308e-4635.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc7a-4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc7a51.617e-5141.03solute carrier family 7 member 5 [Source:NCBI gene... [more]
slc7a10a3.181e-4838.20asc-type amino acid transporter 1 [Source:NCBI gen... [more]
ENSORLT00000006048.23.248e-4838.32large neutral amino acids transporter small subuni... [more]
slc7a63.355e-4838.34Y+L amino acid transporter 2 [Source:NCBI gene;Acc... [more]
slc7a68.078e-4838.34Y+L amino acid transporter 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of slc7a-4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017104.10.000e+099.44SMESG000017104.1[more]
SMESG000006721.11.535e-9961.59SMESG000006721.1[more]
SMESG000081276.14.109e-9655.17SMESG000081276.1[more]
SMESG000051755.11.370e-4840.25SMESG000051755.1[more]
SMESG000044247.13.784e-4539.06SMESG000044247.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30020714
GenBankAKN21448.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020714 ID=SMED30020714|Name=slc7a-4|organism=Schmidtea mediterranea sexual|type=transcript|length=2995bp
AATATTCAACGGTTTCTAGTAATCGAGGCCCAACATGTCATTCGTTTTAA
TAGTTGGTCTAAAAGGGCCAATTCAGCAAAAATTAATTGTAGGATCCAAC
TAAAAGGAAACCAATCTTATAAACGAACTAACTTCAAAATTAAACAGAGT
GGTATACCATCTCATTCACAATTTTGCATCCATTCACGAAGGAAAATTAT
CGCCAAAAAATTTCATAGAACATTTGCCATCTTTCAGTCCATTCCTGAAT
CCATTGGAAATTGTCTTCAGCAAAATAGAGTCAATCATACGGAAGAATAT
CTTGTGGAAAGTGGATTCAGTTCAATGTCCTTCCCAAGCAGATTTGATGT
GGTCAATGAGGCTTTGGAAATGGAACTGCGTAAAGATGATTATAAAAATA
TTTCCACATTCGGCGATTTTTTCCAAATTGCGATAAGAAAAAAAAAATTT
TGGAGAACAATGACATTTTTTTTAATAAATTTTAGTTTTAAATTAATCTG
ATTTACTTTTAATCGAAAAATAAATTCAATAATTTACAAAAATTACTGAA
AATCTAAAGAAAATTAATTAATTTCAAATAAATGTTGATAAAAAGTATTA
TTTAAGAGCTTGAATAACTTTTTGAGATCACAATCCAAGCTTTAAAATTT
ACTTACCAACCATTTTAAATATGGTTAATTCATAAATAATAACTGTAGTT
AGAAGTTAATGAACTGGAACAAGTTTAGTAAAAGTTGTTAATCATTCGAA
CCGACTACATCAATACACAGGTAAGTATGTGTGTCCTATAATAGAGATTT
ATTGTTTTTAAATTCAATAAATAATTTATTGATAATTAATTTGAATCCGA
TTAATATAAAGTAAATATCTTTGCATTTTATCATATTTGATAACAGTTTT
GTGTAGTGACCCTTGGAGCAATTAACTGCTATAACGTTCAATGGGCCACA
AAAATGGCAATAGTATTCACAGTCAGTAAAGTTCTTGCATTACTCATAAT
AATTGTAATAGGTGGGGTATACCTAATAAGAGGAAATACTGAGAGTTTTG
TAGATCCATTTTCCGGATCTGGTTTCCACACAGCATCAATTCCAATGGCA
TTTTATCAAGGTTTTTGGGCGTATTCTGGATGGAATTATCTGAATTTTTT
AACGAATGAAATGAAGAATCCTGAAAAAAACTTACCGTTAGCCATAATTC
TATCATTGACCCTTATCACAGTCGTTTACCTCCTGGTCAATGTTGCGTAT
CTCGCTGTATTATCTCCGCAAGAGATATTGCTCATCGGACAGAGTTCTGC
TGCTGTTGCAGTGAATTTTGCGGATCGAACAATGGGAGTCATGTCTTGGG
TTATGCCCATTTTCGTTGGAATGTCAGTTTTTGGAAGCATGAATTCTGAA
TTACTTTCCTTGTCAAGACTAACTCAAACGGGGGCCGAGGAAAAACAAAT
GCCAGAGGTCCTGGCCATGGTCAGCTATAAACATCTGACTCCAATGCCAG
CAGTAATAATCATTACGCTTTTAACAATATTGTTTCAATTCTACCGGAAC
GCATTTTATTTAATTGAATTGGCGGGGTTTGCGTTCGCAGTCATCGCTGC
CATGGCAGTGTGCTGCCTGCTATATCTCCGTTACAAATGTCCAGATCTAC
CAAGGCCCTTCAAACTACCAATTATTGTTCCAGTATTATTTCTGTTGGCA
GATTTATTTATAGGAGGCCTTACAATTTATCAACAACCCTTTGACTCATT
TATCAGTCTCTGCTTGATGTTACTAAGTATTCCTGTCTACATTATATTTA
TCGCATGGACCAAAAAACCGAGATCATTGACTGATCTAATCTCTAAAATA
ACAGTTAATTTGCAGAAGTTATTGAATGTCGTATTACAAGATGTCGTTTC
CGATGAACTTGATGCTATGCTGGCAAATAAAAAGTCGTCTCAAAATGATC
CGTCTATCAAGAATGGAAAATTATGATCGGAATGTGCTGCTAATTTAATT
TCAATTTGAATATATTTTGAAGCTTTTCGAATAAATTTCTAGGATTTTTT
GGACCTAGATGAGAGTCATTTGCATGAAGGCCTGATTTTGCTGCAGTGCC
AGGATGAGTCTGAATTATTTACAGTGGGGATTTTTTTCTAGAATGTGCTG
GTTGAATTTTGGGAGGAATTTTGTAGAAATCAATATCATAATCAATAAAT
TATAATCGACAAATAACACGGCACATAGATTGATTAATTAGGAATTTCCC
GCAAAATGAAAAATTAATTAAATAATAACTTTAAAAGTCGTAACAAATTA
TTGAAGGGAAATTAGAGAGTGAAAGATGTAGAAATCAAGCAATTTCTATT
TAATTTTTGAATGACCGAAGGTTGCTGGGATATCAATTGGTGGGTTGGAA
GTTGCCAAGGAATCGGACTAACTCGTCTCAGGAGGCACATAGGGCAGGAC
GGATTTGAATTAGGTGAGTAAACAGGATCTGGTAAAATATTCAGGTGCAA
TTGTCGCGGCTTATTTGTTCTGATGAAAGAGGGATGGTGTTATTATCTAG
TTGTCCGGAGTAGTGGTATAAAAGCCCGCTGGCAATGACTCGTTCAAGAT
CATTGAATTAGTTGTAATTTTTTCAAGGTCATTCTAAACCAGTCAGTCAC
CGTTCATCTTCTTTTTCACCTAGCTGCAACATTTAATTGGTCTAGCACTT
CACAATAATAATCGGGAGTAAAGCCAGTGTTGAGAGGCAGAACAACAAAA
CATATGACACCTCTAGCATCCCAAAATGCTCTCAATATGTGTTCATCTTC
GTCACCCGCCAAGGTTTGTGACGGTTGCTAGCTCTGTTTTCCTATTAAAC
TGAGCACTCAATTACTGTAATTACACAAAATAGAAAATCCTATTTGTGAT
AAGTCAAACAGTTAAAACTGTAAAAATCTAAATTGTGTAGGTAGAGGTAT
CTTTTGGTAAGAAATGAGTGGATAAAGATGGTGCTCATAAAATAC
back to top

protein sequence of SMED30020714-orf-1

>SMED30020714-orf-1 ID=SMED30020714-orf-1|Name=SMED30020714-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=341bp
MAIVFTVSKVLALLIIIVIGGVYLIRGNTESFVDPFSGSGFHTASIPMAF
YQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITVVYLLVNVAYL
AVLSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSEL
LSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVIIITLLTILFQFYRNA
FYLIELAGFAFAVIAAMAVCCLLYLRYKCPDLPRPFKLPIIVPVLFLLAD
LFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKIT
VNLQKLLNVVLQDVVSDELDAMLANKKSSQNDPSIKNGKL*
back to top

protein sequence of SMED30020714-orf-2

>SMED30020714-orf-2 ID=SMED30020714-orf-2|Name=SMED30020714-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=167bp
NIQRFLVIEAQHVIRFNSWSKRANSAKINCRIQLKGNQSYKRTNFKIKQS
GIPSHSQFCIHSRRKIIAKKFHRTFAIFQSIPESIGNCLQQNRVNHTEEY
LVESGFSSMSFPSRFDVVNEALEMELRKDDYKNISTFGDFFQIAIRKKKF
WRTMTFFLINFSFKLI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0015171amino acid transmembrane transporter activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0003333amino acid transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0002109X1 cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR001888Transposase_1
IPR012340NA-bd_OB-fold
IPR002293AA/rel_permease1
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane