Succinyl-CoA:3-ketoacid-coenzyme A transferase

Overview
NameSuccinyl-CoA:3-ketoacid-coenzyme A transferase
Smed IDSMED30020710
Length (bp)375
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Succinyl-CoA:3-ketoacid-coenzyme A transferase (SMED30020710) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Succinyl-CoA:3-ketoacid-coenzyme A transferase (SMED30020710) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020710

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30020710h1SMcG0003737 SmedASXL_016550SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30020710h1SMcG0003737 Contig46141newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020710h1SMcG0003737 Contig46141uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020710h1SMcG0003737 Contig45598uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020710h1SMcG0003737 Contig45598newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020710h1SMcG0003737 Contig12524uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020710h1SMcG0003737 Contig12524newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020710h1SMcG0003737 Contig52215newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020710h1SMcG0003737 Contig52215uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30020710h1SMcG0003737 dd_Smed_v4_1189_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020710h1SMcG0003737 dd_Smed_v4_1189_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020710h1SMcG0003737 dd_Smed_v4_1189_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020710h1SMcG0003737 dd_Smed_v4_1189_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30020710h1SMcG0003737 dd_Smed_v6_1189_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30020710h1SMcG0003737 SMED30020710smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30020710h1SMcG0003737 SMED30020710smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Category 3 cellSMED30020710h1SMcG0003737 dd_Smed_v6_1189_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30020710h1SMcG0003737 dd_Smed_v4_1189_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Human
Match: OXCT1 (3-oxoacid CoA-transferase 1 [Source:HGNC Symbol;Acc:HGNC:8527])

HSP 1 Score: 81.2629 bits (199), Expect = 1.928e-18
Identity = 40/84 (47.62%), Postives = 58/84 (69.05%), Query Frame = 1
Query:  103 YTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            YT+  E++KDIP+G+T+LVGG       FG+CGIPENLI  L ++ +K LT VSNNAG+ ++GL +L   +Q+K +   Y  +N
Sbjct:   43 YTDPVEAVKDIPDGATVLVGG-------FGLCGIPENLIDALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGEN 119          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Human
Match: OXCT2 (3-oxoacid CoA-transferase 2 [Source:HGNC Symbol;Acc:HGNC:18606])

HSP 1 Score: 79.7221 bits (195), Expect = 7.085e-18
Identity = 36/86 (41.86%), Postives = 57/86 (66.28%), Query Frame = 1
Query:  103 YTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDNNI 360
            Y +  E +KDI +G+T+++GG       FG+CGIPENLI  L ++++KDL +VS+N G+ D+GL +L   RQV+ +   Y  +N +
Sbjct:   43 YADPVEMVKDISDGATVMIGG-------FGLCGIPENLIAALLRTRVKDLQVVSSNVGVEDFGLGLLLAARQVRRIVCSYVGENTL 121          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Celegans
Match: C05C10.3 (Probable succinyl-CoA:3-ketoacid coenzyme A transferase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q09450])

HSP 1 Score: 85.5001 bits (210), Expect = 2.338e-20
Identity = 44/95 (46.32%), Postives = 64/95 (67.37%), Query Frame = 1
Query:   73 VSVVNSFKP-VYTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            +S+ +S K  V+ +AEE++KDIP+ + LLVGG       FG+CGIPENLI  + ++  K LT VSNNAG+ +WGL +L + RQ+K +   Y  +N
Sbjct:   29 ISMTSSMKAKVFNSAEEAVKDIPDNAKLLVGG-------FGLCGIPENLIQAITKTGQKGLTCVSNNAGVDNWGLGLLLQTRQIKKMISSYVGEN 116          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Fly
Match: SCOT (gene:FBgn0035298 transcript:FBtr0072844)

HSP 1 Score: 65.0846 bits (157), Expect = 3.924e-13
Identity = 33/86 (38.37%), Postives = 52/86 (60.47%), Query Frame = 1
Query:  100 VYTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDNN 357
            +Y +A +++ D+ +G+ +L GG       FGICGIPE +I  L Q  +K++T VSNN G+ D GL +L + +QV  +   Y  +N 
Sbjct:   36 IYESAIDAVADVQDGAQILFGG-------FGICGIPEKMINALKQKGVKNITGVSNNGGVDDTGLGVLIKQKQVSKVIGSYVGENT 114          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Fly
Match: SCOT (gene:FBgn0035298 transcript:FBtr0072843)

HSP 1 Score: 64.6994 bits (156), Expect = 4.742e-13
Identity = 33/86 (38.37%), Postives = 52/86 (60.47%), Query Frame = 1
Query:  100 VYTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDNN 357
            +Y +A +++ D+ +G+ +L GG       FGICGIPE +I  L Q  +K++T VSNN G+ D GL +L + +QV  +   Y  +N 
Sbjct:   22 IYESAIDAVADVQDGAQILFGG-------FGICGIPEKMINALKQKGVKNITGVSNNGGVDDTGLGVLIKQKQVSKVIGSYVGENT 100          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Zebrafish
Match: oxct1b (3-oxoacid CoA transferase 1b [Source:ZFIN;Acc:ZDB-GENE-060929-212])

HSP 1 Score: 82.4185 bits (202), Expect = 4.608e-19
Identity = 40/84 (47.62%), Postives = 59/84 (70.24%), Query Frame = 1
Query:  103 YTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            Y++  E+++DIPNGS LLVGG       FG+CGIPENLI  L ++ +KD+T VSNNAG+ ++GL +L + +Q+K +   Y  +N
Sbjct:   51 YSDPVETVQDIPNGSKLLVGG-------FGLCGIPENLISSLLKTGVKDITAVSNNAGVDNFGLGMLLKSKQIKRMISSYVGEN 127          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Zebrafish
Match: oxct1a (3-oxoacid CoA transferase 1a [Source:ZFIN;Acc:ZDB-GENE-040723-3])

HSP 1 Score: 82.0333 bits (201), Expect = 5.989e-19
Identity = 40/84 (47.62%), Postives = 58/84 (69.05%), Query Frame = 1
Query:  103 YTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            Y++  +++KDIPNG+T+LVGG       FG+CGIPENLI  L ++ +K LT VSNNAG+ D+GL +L   +Q+K +   Y  +N
Sbjct:   50 YSDPLDAVKDIPNGATVLVGG-------FGLCGIPENLINSLLKTGVKSLTAVSNNAGVDDFGLGLLLRTKQIKRMISSYVGEN 126          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Zebrafish
Match: oxct1a (3-oxoacid CoA transferase 1a [Source:ZFIN;Acc:ZDB-GENE-040723-3])

HSP 1 Score: 80.8777 bits (198), Expect = 1.813e-18
Identity = 40/84 (47.62%), Postives = 58/84 (69.05%), Query Frame = 1
Query:  103 YTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            Y++  +++KDIPNG+T+LVGG       FG+CGIPENLI  L ++ +K LT VSNNAG+ D+GL +L   +Q+K +   Y  +N
Sbjct:   50 YSDPLDAVKDIPNGATVLVGG-------FGLCGIPENLINSLLKTGVKSLTAVSNNAGVDDFGLGLLLRTKQIKRMISSYVGEN 126          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Xenopus
Match: mettl18 (methyltransferase like 18 [Source:Xenbase;Acc:XB-GENE-5811219])

HSP 1 Score: 84.7297 bits (208), Expect = 8.897e-20
Identity = 41/84 (48.81%), Postives = 60/84 (71.43%), Query Frame = 1
Query:  103 YTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            Y++  E++KDIP+GSTLLVGG       FG+CGIPENLI GL ++ +K +T VSNNAG+ ++GL +L + +Q+K +   Y  +N
Sbjct:   53 YSDPVEAVKDIPDGSTLLVGG-------FGLCGIPENLIAGLLKTGVKGITAVSNNAGVDNFGLGLLLQTKQIKRMVSSYVGEN 129          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Xenopus
Match: mettl18 (methyltransferase like 18 [Source:Xenbase;Acc:XB-GENE-5811219])

HSP 1 Score: 84.7297 bits (208), Expect = 9.043e-20
Identity = 41/84 (48.81%), Postives = 60/84 (71.43%), Query Frame = 1
Query:  103 YTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            Y++  E++KDIP+GSTLLVGG       FG+CGIPENLI GL ++ +K +T VSNNAG+ ++GL +L + +Q+K +   Y  +N
Sbjct:   38 YSDPVEAVKDIPDGSTLLVGG-------FGLCGIPENLIAGLLKTGVKGITAVSNNAGVDNFGLGLLLQTKQIKRMVSSYVGEN 114          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Xenopus
Match: mettl18 (methyltransferase like 18 [Source:Xenbase;Acc:XB-GENE-5811219])

HSP 1 Score: 84.7297 bits (208), Expect = 9.225e-20
Identity = 41/84 (48.81%), Postives = 60/84 (71.43%), Query Frame = 1
Query:  103 YTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            Y++  E++KDIP+GSTLLVGG       FG+CGIPENLI GL ++ +K +T VSNNAG+ ++GL +L + +Q+K +   Y  +N
Sbjct:   53 YSDPVEAVKDIPDGSTLLVGG-------FGLCGIPENLIAGLLKTGVKGITAVSNNAGVDNFGLGLLLQTKQIKRMVSSYVGEN 129          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Xenopus
Match: mettl18 (methyltransferase like 18 [Source:Xenbase;Acc:XB-GENE-5811219])

HSP 1 Score: 83.1889 bits (204), Expect = 3.555e-19
Identity = 41/84 (48.81%), Postives = 60/84 (71.43%), Query Frame = 1
Query:  103 YTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            Y++  E++KDIP+GSTLLVGG       FG+CGIPENLI GL ++ +K +T VSNNAG+ ++GL +L + +Q+K +   Y  +N
Sbjct:   32 YSDPVEAVKDIPDGSTLLVGG-------FGLCGIPENLIAGLLKTGVKGITAVSNNAGVDNFGLGLLLQTKQIKRMVSSYVGEN 108          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Xenopus
Match: mettl18 (methyltransferase like 18 [Source:Xenbase;Acc:XB-GENE-5811219])

HSP 1 Score: 83.1889 bits (204), Expect = 3.565e-19
Identity = 41/84 (48.81%), Postives = 60/84 (71.43%), Query Frame = 1
Query:  103 YTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            Y++  E++KDIP+GSTLLVGG       FG+CGIPENLI GL ++ +K +T VSNNAG+ ++GL +L + +Q+K +   Y  +N
Sbjct:   35 YSDPVEAVKDIPDGSTLLVGG-------FGLCGIPENLIAGLLKTGVKGITAVSNNAGVDNFGLGLLLQTKQIKRMVSSYVGEN 111          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Mouse
Match: Oxct1 (3-oxoacid CoA transferase 1 [Source:MGI Symbol;Acc:MGI:1914291])

HSP 1 Score: 88.5817 bits (218), Expect = 2.670e-21
Identity = 44/84 (52.38%), Postives = 60/84 (71.43%), Query Frame = 1
Query:  103 YTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            YT+  E++KDIPNG+TLLVGG       FG+CGIPENLIG L ++ +KDLT VSNNAG+ ++GL +L   +Q+K +   Y  +N
Sbjct:   43 YTDPVEAVKDIPNGATLLVGG-------FGLCGIPENLIGALLKTGVKDLTAVSNNAGVDNFGLGLLLRSKQIKRMISSYVGEN 119          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Mouse
Match: Oxct1 (3-oxoacid CoA transferase 1 [Source:MGI Symbol;Acc:MGI:1914291])

HSP 1 Score: 88.5817 bits (218), Expect = 3.224e-21
Identity = 44/84 (52.38%), Postives = 60/84 (71.43%), Query Frame = 1
Query:  103 YTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            YT+  E++KDIPNG+TLLVGG       FG+CGIPENLIG L ++ +KDLT VSNNAG+ ++GL +L   +Q+K +   Y  +N
Sbjct:   43 YTDPVEAVKDIPNGATLLVGG-------FGLCGIPENLIGALLKTGVKDLTAVSNNAGVDNFGLGLLLRSKQIKRMISSYVGEN 119          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Mouse
Match: Oxct2b (3-oxoacid CoA transferase 2B [Source:MGI Symbol;Acc:MGI:2664115])

HSP 1 Score: 73.9442 bits (180), Expect = 5.115e-16
Identity = 36/84 (42.86%), Postives = 55/84 (65.48%), Query Frame = 1
Query:  103 YTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            YT+  ++++ + +GST+++GG       FG+CGIPENLIG L    +KDL IVS+N G+ D+GL IL   +QV+ +   Y  +N
Sbjct:   43 YTDPVKAVEGVKDGSTVMLGG-------FGLCGIPENLIGALKTKGVKDLKIVSSNVGVDDFGLGILLASKQVRRVVCSYLGEN 119          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Mouse
Match: Oxct2a (3-oxoacid CoA transferase 2A [Source:MGI Symbol;Acc:MGI:1891061])

HSP 1 Score: 73.9442 bits (180), Expect = 5.115e-16
Identity = 36/84 (42.86%), Postives = 55/84 (65.48%), Query Frame = 1
Query:  103 YTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            YT+  ++++ + +GST+++GG       FG+CGIPENLIG L    +KDL IVS+N G+ D+GL IL   +QV+ +   Y  +N
Sbjct:   43 YTDPVKAVEGVKDGSTVMLGG-------FGLCGIPENLIGALKTKGVKDLKIVSSNVGVDDFGLGILLASKQVRRVVCSYLGEN 119          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. UniProt/SwissProt
Match: sp|Q54JD9|SCOT_DICDI (Probable succinyl-CoA:3-ketoacid coenzyme A transferase, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=oxct1 PE=3 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 3.069e-22
Identity = 45/85 (52.94%), Postives = 61/85 (71.76%), Query Frame = 1
Query:  100 VYTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            +Y NA+E++KDIPNGS LLVGG       FG+CGIPENLI  +  + +KDLT+VSNNAG+ D+GL +L + RQ+K +   Y  +N
Sbjct:   28 IYENAKEAVKDIPNGSKLLVGG-------FGLCGIPENLISAVRDTGVKDLTVVSNNAGVDDFGLGVLLKSRQIKRMISSYVGEN 105          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. UniProt/SwissProt
Match: sp|B2GV06|SCOT1_RAT (Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Oxct1 PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.766e-20
Identity = 44/84 (52.38%), Postives = 60/84 (71.43%), Query Frame = 1
Query:  103 YTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            YT+  E++KDIPNG+TLLVGG       FG+CGIPENLIG L ++ +KDLT VSNNAG+ ++GL +L   +Q+K +   Y  +N
Sbjct:   43 YTDPVEAVKDIPNGATLLVGG-------FGLCGIPENLIGALLKTGVKDLTAVSNNAGVDNFGLGLLLRSKQIKRMISSYVGEN 119          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. UniProt/SwissProt
Match: sp|Q29551|SCOT1_PIG (Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Sus scrofa OX=9823 GN=OXCT1 PE=1 SV=2)

HSP 1 Score: 88.5817 bits (218), Expect = 1.966e-20
Identity = 43/84 (51.19%), Postives = 62/84 (73.81%), Query Frame = 1
Query:  103 YTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            YT+A E++KDIPNG+T+LVGG       FG+CGIPENLIG L ++ +K+LT VSNNAG+ ++GL +L + +Q+K +   Y  +N
Sbjct:   43 YTDAVEAVKDIPNGATVLVGG-------FGLCGIPENLIGALLKTGVKELTAVSNNAGVDNFGLGLLLQSKQIKRMISSYVGEN 119          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. UniProt/SwissProt
Match: sp|Q9D0K2|SCOT1_MOUSE (Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Mus musculus OX=10090 GN=Oxct1 PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.255e-20
Identity = 44/84 (52.38%), Postives = 60/84 (71.43%), Query Frame = 1
Query:  103 YTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            YT+  E++KDIPNG+TLLVGG       FG+CGIPENLIG L ++ +KDLT VSNNAG+ ++GL +L   +Q+K +   Y  +N
Sbjct:   43 YTDPVEAVKDIPNGATLLVGG-------FGLCGIPENLIGALLKTGVKDLTAVSNNAGVDNFGLGLLLRSKQIKRMISSYVGEN 119          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. UniProt/SwissProt
Match: sp|Q09450|SCOT_CAEEL (Probable succinyl-CoA:3-ketoacid coenzyme A transferase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=C05C10.3 PE=3 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.974e-19
Identity = 44/95 (46.32%), Postives = 64/95 (67.37%), Query Frame = 1
Query:   73 VSVVNSFKP-VYTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            +S+ +S K  V+ +AEE++KDIP+ + LLVGG       FG+CGIPENLI  + ++  K LT VSNNAG+ +WGL +L + RQ+K +   Y  +N
Sbjct:   29 ISMTSSMKAKVFNSAEEAVKDIPDNAKLLVGG-------FGLCGIPENLIQAITKTGQKGLTCVSNNAGVDNWGLGLLLQTRQIKKMISSYVGEN 116          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. TrEMBL
Match: A0A2T7NR33 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_16904 PE=4 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.370e-20
Identity = 46/81 (56.79%), Postives = 61/81 (75.31%), Query Frame = 1
Query:  112 AEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            A+E+IKDIPNG+ LLVGG       FG+CGIPENLIG L ++K+KDLT+VSNNAG+ D+GL +L + RQ+K +   Y  +N
Sbjct:  162 AQEAIKDIPNGAKLLVGG-------FGLCGIPENLIGALLETKVKDLTVVSNNAGVDDFGLGMLLKQRQIKRMISSYVGEN 235          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. TrEMBL
Match: A0A2B4SF60 (Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Stylophora pistillata OX=50429 GN=OXCT1 PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 6.296e-20
Identity = 51/97 (52.58%), Postives = 65/97 (67.01%), Query Frame = 1
Query:   64 KLSVSVVNSFKPVYTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            K S S   S    Y NAEE++KDIP+G+ LLVGG       FG+CGIPENLI GL ++ IKDLT VSNNAG+ D+GL +L + +QVK +   Y  +N
Sbjct:   31 KFSTSSSRSLH-FYNNAEEAVKDIPHGAKLLVGG-------FGLCGIPENLIDGLLKTGIKDLTCVSNNAGVDDFGLGLLLKTKQVKRMISSYVGEN 119          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. TrEMBL
Match: A0A2V8VDS7 (Succinyl-CoA--3-ketoacid-CoA transferase OS=Acidobacteria bacterium OX=1978231 GN=DMF52_14435 PE=4 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 2.076e-19
Identity = 41/89 (46.07%), Postives = 60/89 (67.42%), Query Frame = 1
Query:  100 VYTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDNNIMN 366
            V  +A+E+I+DIP+G+TL+VGG       FG+CGIPENLI  L +   KDLT++SNNAG  D+GL +L   RQ++ +   Y  +N++  
Sbjct:    4 VVRDADEAIRDIPDGATLMVGG-------FGLCGIPENLIKALQRKGTKDLTVMSNNAGTSDYGLGLLLRTRQIRKMISTYVGENDLFE 85          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. TrEMBL
Match: A0A1Q7RQ26 (Succinyl-CoA--3-ketoacid-CoA transferase OS=Acidobacteria bacterium 13_1_40CM_2_68_10 OX=1803445 GN=AUI52_05240 PE=4 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 2.076e-19
Identity = 41/89 (46.07%), Postives = 60/89 (67.42%), Query Frame = 1
Query:  100 VYTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDNNIMN 366
            V  +A+E+I+DIP+G+TL+VGG       FG+CGIPENLI  L +   KDLT++SNNAG  D+GL +L   RQ++ +   Y  +N++  
Sbjct:    4 VVRDADEAIRDIPDGATLMVGG-------FGLCGIPENLIKALQRKGTKDLTVMSNNAGTSDYGLGLLLRTRQIRKMISTYVGENDLFE 85          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. TrEMBL
Match: A0A2G5UUV4 (Uncharacterized protein OS=Caenorhabditis nigoni OX=1611254 GN=Cni-C05C10.3 PE=4 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 2.348e-19
Identity = 49/112 (43.75%), Postives = 66/112 (58.93%), Query Frame = 1
Query:   22 LIPNGSTLKISIIRKLSVSVVNSFKP-VYTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            L+P  +T  I  +     S   S K  +Y + EE++KDIPNG+ LLVGG       FG+CGIPENLI  L ++    LT VSNNAG+  WGL +L + RQ+K +   Y  +N
Sbjct:   15 LLPRAATRHIRFL-----STTFSLKAKIYESPEEAVKDIPNGAKLLVGG-------FGLCGIPENLIQALTKTGQTGLTCVSNNAGVDKWGLGLLLQTRQIKKMISSYVGEN 114          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Cavefish
Match: oxct1a (succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial [Source:NCBI gene;Acc:103039388])

HSP 1 Score: 83.9593 bits (206), Expect = 9.820e-20
Identity = 40/84 (47.62%), Postives = 59/84 (70.24%), Query Frame = 1
Query:  103 YTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            Y N+ +++KDIP+G+T+LVGG       FG+CGIPENLI  L ++ +K LT VSNNAG+ D+GL +L + +Q+K +   Y  +N
Sbjct:   38 YPNSTDAVKDIPDGATILVGG-------FGLCGIPENLINSLLKTGVKSLTAVSNNAGVDDFGLGLLLKTKQIKRMISSYVGEN 114          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Cavefish
Match: oxct1a (succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial [Source:NCBI gene;Acc:103039388])

HSP 1 Score: 83.9593 bits (206), Expect = 1.132e-19
Identity = 40/84 (47.62%), Postives = 59/84 (70.24%), Query Frame = 1
Query:  103 YTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            Y N+ +++KDIP+G+T+LVGG       FG+CGIPENLI  L ++ +K LT VSNNAG+ D+GL +L + +Q+K +   Y  +N
Sbjct:   38 YPNSTDAVKDIPDGATILVGG-------FGLCGIPENLINSLLKTGVKSLTAVSNNAGVDDFGLGLLLKTKQIKRMISSYVGEN 114          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Cavefish
Match: oxct1b (succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial-like [Source:NCBI gene;Acc:103028178])

HSP 1 Score: 83.5741 bits (205), Expect = 1.350e-19
Identity = 40/84 (47.62%), Postives = 59/84 (70.24%), Query Frame = 1
Query:  103 YTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            Y +  E+++DIP+GSTLLVGG       FG+CGIPENLI GL ++ +K +T VSNNAG+ ++GL +L + +Q+K +   Y  +N
Sbjct:   51 YGSPTEAVRDIPDGSTLLVGG-------FGLCGIPENLISGLLKTGVKQITAVSNNAGVDNFGLGLLLKTKQIKRMISSYVGEN 127          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Sea Lamprey
Match: oxct1b (3-oxoacid CoA transferase 1b [Source:ZFIN;Acc:ZDB-GENE-060929-212])

HSP 1 Score: 60.077 bits (144), Expect = 2.574e-12
Identity = 29/57 (50.88%), Postives = 39/57 (68.42%), Query Frame = 1
Query:  184 GFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            GFG+CGIPENL+  L QS +K++T VSNNAG+  +GL  L   RQ+K +   Y  +N
Sbjct:    1 GFGLCGIPENLLEALVQSGVKNITAVSNNAGVDGFGLGKLLNTRQIKRMVSSYVGEN 57          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Nematostella
Match: EDO27730 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8F7])

HSP 1 Score: 77.7962 bits (190), Expect = 8.299e-20
Identity = 41/84 (48.81%), Postives = 55/84 (65.48%), Query Frame = 1
Query:  103 YTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            Y   +E+IKDIP+   LLVGG       FG+CGIPENLI  LN S +K LT VSNNAG+ ++GL +L + +Q+K +   Y  +N
Sbjct:   12 YNTPDEAIKDIPDNCKLLVGG-------FGLCGIPENLIIALNASGVKGLTCVSNNAGVDNFGLGLLLQTKQIKRMISSYVGEN 88          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Nematostella
Match: EDO46906 (Succinyl-CoA:3-ketoacid-coenzyme A transferase [Source:UniProtKB/TrEMBL;Acc:A7RNT1])

HSP 1 Score: 80.8777 bits (198), Expect = 5.191e-19
Identity = 47/116 (40.52%), Postives = 66/116 (56.90%), Query Frame = 1
Query:    7 KGIKYLIPNGSTLKISIIRKLSVSVVNSFKPVYTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            +G  +   N      ++ R LS S  +     Y   +E+IKDIP+   LLVGG       FG+CGIPENLI  LN S +K LT VSNNAG+ ++GL +L + +Q+K +   Y  +N
Sbjct:   12 RGAGFRTFNNRIFFSNVSRSLSTSQ-SKLAKFYNTPDEAIKDIPDNCKLLVGG-------FGLCGIPENLIIALNTSGVKGLTCVSNNAGVDNFGLGLLLQTKQIKRMISSYVGEN 119          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Medaka
Match: oxct1a (3-oxoacid CoA-transferase 1 [Source:NCBI gene;Acc:101163581])

HSP 1 Score: 78.1814 bits (191), Expect = 1.287e-17
Identity = 38/84 (45.24%), Postives = 57/84 (67.86%), Query Frame = 1
Query:  103 YTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDN 354
            Y++  E++KDIP+G+ +LVGG       FG+CGIPENLI  L +S +  LT VSNNAG+ ++GL +L + +Q+K +   Y  +N
Sbjct:   52 YSDPSEAVKDIPDGAVILVGG-------FGLCGIPENLINSLLKSGVTGLTAVSNNAGVDNFGLGLLLQSKQIKRMISSYVGEN 128          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Planmine SMEST
Match: SMESG000080424.1 (SMESG000080424.1)

HSP 1 Score: 184.111 bits (466), Expect = 1.108e-56
Identity = 96/119 (80.67%), Postives = 101/119 (84.87%), Query Frame = 1
Query:    1 MIKGIKYLIPNGSTLKISIIRKLSVSVVNSFKPVYTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDNN 357
            MIKGIKYLIPN STLKISIIRKLSVSVVNSFKP+YTNAEESIKDIPNGSTLLVG       GFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGL IL   RQ+K +   +  +NN
Sbjct:   15 MIKGIKYLIPNRSTLKISIIRKLSVSVVNSFKPIYTNAEESIKDIPNGSTLLVG-------GFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLGILLNSRQIKRMISSFVGENN 126          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Planmine SMEST
Match: SMESG000080432.1 (SMESG000080432.1)

HSP 1 Score: 171.014 bits (432), Expect = 8.550e-52
Identity = 90/119 (75.63%), Postives = 98/119 (82.35%), Query Frame = 1
Query:    1 MIKGIKYLIPNGSTLKISIIRKLSVSVVNSFKPVYTNAEESIKDIPNGSTLLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSILFELRQVKVLNLLYANDNN 357
            MIKGIKYLIP+GS LKISIIR LSVSVVNSFKPVYTNAEE+IKDIPNGSTLLVG       GFGICGIPENLIGGLNQS+I+DLTIVSNNAGL D GL +L   RQ+K +   Y  +NN
Sbjct:    1 MIKGIKYLIPSGSNLKISIIRNLSVSVVNSFKPVYTNAEEAIKDIPNGSTLLVG-------GFGICGIPENLIGGLNQSRIRDLTIVSNNAGLIDCGLGLLLNSRQIKRMISSYVGENN 112          
The following BLAST results are available for this feature:
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
OXCT11.928e-1847.623-oxoacid CoA-transferase 1 [Source:HGNC Symbol;Ac... [more]
OXCT27.085e-1841.863-oxoacid CoA-transferase 2 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C05C10.32.338e-2046.32Probable succinyl-CoA:3-ketoacid coenzyme A transf... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SCOT3.924e-1338.37gene:FBgn0035298 transcript:FBtr0072844[more]
SCOT4.742e-1338.37gene:FBgn0035298 transcript:FBtr0072843[more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
oxct1b4.608e-1947.623-oxoacid CoA transferase 1b [Source:ZFIN;Acc:ZDB-... [more]
oxct1a5.989e-1947.623-oxoacid CoA transferase 1a [Source:ZFIN;Acc:ZDB-... [more]
oxct1a1.813e-1847.623-oxoacid CoA transferase 1a [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mettl188.897e-2048.81methyltransferase like 18 [Source:Xenbase;Acc:XB-G... [more]
mettl189.043e-2048.81methyltransferase like 18 [Source:Xenbase;Acc:XB-G... [more]
mettl189.225e-2048.81methyltransferase like 18 [Source:Xenbase;Acc:XB-G... [more]
mettl183.555e-1948.81methyltransferase like 18 [Source:Xenbase;Acc:XB-G... [more]
mettl183.565e-1948.81methyltransferase like 18 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Oxct12.670e-2152.383-oxoacid CoA transferase 1 [Source:MGI Symbol;Acc... [more]
Oxct13.224e-2152.383-oxoacid CoA transferase 1 [Source:MGI Symbol;Acc... [more]
Oxct2b5.115e-1642.863-oxoacid CoA transferase 2B [Source:MGI Symbol;Ac... [more]
Oxct2a5.115e-1642.863-oxoacid CoA transferase 2A [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q54JD9|SCOT_DICDI3.069e-2252.94Probable succinyl-CoA:3-ketoacid coenzyme A transf... [more]
sp|B2GV06|SCOT1_RAT1.766e-2052.38Succinyl-CoA:3-ketoacid coenzyme A transferase 1, ... [more]
sp|Q29551|SCOT1_PIG1.966e-2051.19Succinyl-CoA:3-ketoacid coenzyme A transferase 1, ... [more]
sp|Q9D0K2|SCOT1_MOUSE2.255e-2052.38Succinyl-CoA:3-ketoacid coenzyme A transferase 1, ... [more]
sp|Q09450|SCOT_CAEEL2.974e-1946.32Probable succinyl-CoA:3-ketoacid coenzyme A transf... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7NR331.370e-2056.79Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A2B4SF606.296e-2052.58Succinyl-CoA:3-ketoacid coenzyme A transferase 1, ... [more]
A0A2V8VDS72.076e-1946.07Succinyl-CoA--3-ketoacid-CoA transferase OS=Acidob... [more]
A0A1Q7RQ262.076e-1946.07Succinyl-CoA--3-ketoacid-CoA transferase OS=Acidob... [more]
A0A2G5UUV42.348e-1943.75Uncharacterized protein OS=Caenorhabditis nigoni O... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
oxct1a9.820e-2047.62succinyl-CoA:3-ketoacid coenzyme A transferase 1, ... [more]
oxct1a1.132e-1947.62succinyl-CoA:3-ketoacid coenzyme A transferase 1, ... [more]
oxct1b1.350e-1947.62succinyl-CoA:3-ketoacid coenzyme A transferase 1, ... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
oxct1b2.574e-1250.883-oxoacid CoA transferase 1b [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO277308.299e-2048.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469065.191e-1940.52Succinyl-CoA:3-ketoacid-coenzyme A transferase [S... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
oxct1a1.287e-1745.243-oxoacid CoA-transferase 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000080424.11.108e-5680.67SMESG000080424.1[more]
SMESG000080432.18.550e-5275.63SMESG000080432.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020710 ID=SMED30020710|Name=Succinyl-CoA:3-ketoacid-coenzyme A transferase|organism=Schmidtea mediterranea sexual|type=transcript|length=375bp
ATGATTAAAGGTATCAAATATCTAATTCCGAATGGGTCGACTTTAAAGAT
TTCGATTATCCGCAAACTATCAGTTTCAGTTGTCAATTCTTTTAAACCAG
TTTATACTAATGCAGAAGAATCTATTAAAGATATTCCGAACGGCAGCACT
CTTTTGGTCGGAGGTAATATTTGTGAAAGTAAAGGTTTTGGTATATGTGG
GATACCAGAGAATTTGATAGGGGGCCTTAATCAAAGTAAAATTAAAGATT
TGACAATAGTTAGTAACAATGCTGGTCTTTATGACTGGGGATTAAGTATT
TTGTTTGAACTCAGACAAGTAAAAGTTTTGAATTTATTATACGCAAATGA
TAATAATATTATGAATATAGATTAA
back to top

protein sequence of SMED30020710-orf-1

>SMED30020710-orf-1 ID=SMED30020710-orf-1|Name=SMED30020710-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=125bp
MIKGIKYLIPNGSTLKISIIRKLSVSVVNSFKPVYTNAEESIKDIPNGST
LLVGGNICESKGFGICGIPENLIGGLNQSKIKDLTIVSNNAGLYDWGLSI
LFELRQVKVLNLLYANDNNIMNID*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000035Category 3 cell
PLANA:0000421tail
PLANA:0002032epidermal cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR004165CoA_trans_fam_I
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0046952ketone body catabolic process
Vocabulary: molecular function
TermDefinition
GO:0008410CoA-transferase activity
GO:00082603-oxoacid CoA-transferase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion