Poly [ADP-ribose] polymerase

Overview
NamePoly [ADP-ribose] polymerase
Smed IDSMED30020704
Length (bp)2724
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Poly [ADP-ribose] polymerase (SMED30020704) t-SNE clustered cells

Violin plots show distribution of expression levels for Poly [ADP-ribose] polymerase (SMED30020704) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020704

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30020704h1SMcG0002851 Contig5535newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30020704h1SMcG0002851 Contig5535uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30020704h1SMcG0008856 Contig5535newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30020704h1SMcG0008856 Contig5535uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30020704h1SMcG0002851 SmedASXL_017092SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30020704h1SMcG0002851 SmedASXL_017092SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30020704h1SMcG0002851 dd_Smed_v4_6154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020704h1SMcG0002851 dd_Smed_v4_6154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020704h1SMcG0002851 dd_Smed_v4_6154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30020704h1SMcG0002851 dd_Smed_v4_6154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020704h1SMcG0002851 dd_Smed_v4_6154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020704h1SMcG0002851 dd_Smed_v4_6154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30020704h1SMcG0002851 OX_Smed_1.0.15117ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
neoblastSMED30020704h1SMcG0002851 SmWIOct06_014077GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Human
Match: PARP2 (poly(ADP-ribose) polymerase 2 [Source:HGNC Symbol;Acc:HGNC:272])

HSP 1 Score: 126.716 bits (317), Expect = 1.905e-45
Identity = 67/139 (48.20%), Postives = 104/139 (74.82%), Query Frame = 1
Query:  997 KRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCK--KEILETNKIAS-QVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            K+F DKTKN+W+DR+KFEK+ GKYD++Q+DY    ++  ET K  S +  L+P ES+L+ ++Q+L++++ +++ M + + EMKY+  K PLG+LT AQIKAGY +L++IE  +  G    ++L++ACN +YTRIPHDFG
Sbjct:  178 KKFLDKTKNNWEDREKFEKVPGKYDMLQMDYATNTQDEEETKKEESLKSPLKP-ESQLDLRVQELIKLICNVQAMEEMMMEMKYNTKKAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHG-RALMEACNEFYTRIPHDFG 314          

HSP 2 Score: 77.7962 bits (190), Expect = 1.905e-45
Identity = 36/59 (61.02%), Postives = 43/59 (72.88%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 953
            QTNLQFNNNK+Y+IQLL+D+ +  + VWMRW RVGK+GQ  L     NL  AKE F KK
Sbjct:  121 QTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKMGQHSLVACSGNLNKAKEIFQKK 179          

HSP 3 Score: 70.0922 bits (170), Expect = 9.804e-12
Identity = 32/78 (41.03%), Postives = 47/78 (60.26%), Query Frame = 1
Query: 2371 HFISMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQVNFLKNYF 2604
            H   +R PPLIR+  E+  +++LLE L DI+IA+KL+        HPLD+HY+NLHC   L  +D+  Y+   +  Y 
Sbjct:  311 HDFGLRTPPLIRTQKELSEKIQLLEALGDIEIAIKLVKTELQSPEHPLDQHYRNLHCA--LRPLDHESYEFKVISQYL 386          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Human
Match: PARP2 (poly(ADP-ribose) polymerase 2 [Source:HGNC Symbol;Acc:HGNC:272])

HSP 1 Score: 126.716 bits (317), Expect = 2.523e-45
Identity = 67/139 (48.20%), Postives = 104/139 (74.82%), Query Frame = 1
Query:  997 KRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCK--KEILETNKIAS-QVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            K+F DKTKN+W+DR+KFEK+ GKYD++Q+DY    ++  ET K  S +  L+P ES+L+ ++Q+L++++ +++ M + + EMKY+  K PLG+LT AQIKAGY +L++IE  +  G    ++L++ACN +YTRIPHDFG
Sbjct:  165 KKFLDKTKNNWEDREKFEKVPGKYDMLQMDYATNTQDEEETKKEESLKSPLKP-ESQLDLRVQELIKLICNVQAMEEMMMEMKYNTKKAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHG-RALMEACNEFYTRIPHDFG 301          

HSP 2 Score: 77.411 bits (189), Expect = 2.523e-45
Identity = 36/59 (61.02%), Postives = 43/59 (72.88%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 953
            QTNLQFNNNK+Y+IQLL+D+ +  + VWMRW RVGK+GQ  L     NL  AKE F KK
Sbjct:  108 QTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKMGQHSLVACSGNLNKAKEIFQKK 166          

HSP 3 Score: 69.707 bits (169), Expect = 1.432e-11
Identity = 32/78 (41.03%), Postives = 47/78 (60.26%), Query Frame = 1
Query: 2371 HFISMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQVNFLKNYF 2604
            H   +R PPLIR+  E+  +++LLE L DI+IA+KL+        HPLD+HY+NLHC   L  +D+  Y+   +  Y 
Sbjct:  298 HDFGLRTPPLIRTQKELSEKIQLLEALGDIEIAIKLVKTELQSPEHPLDQHYRNLHCA--LRPLDHESYEFKVISQYL 373          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Human
Match: PARP2 (poly(ADP-ribose) polymerase 2 [Source:HGNC Symbol;Acc:HGNC:272])

HSP 1 Score: 126.716 bits (317), Expect = 2.717e-45
Identity = 67/139 (48.20%), Postives = 104/139 (74.82%), Query Frame = 1
Query:  997 KRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCK--KEILETNKIAS-QVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            K+F DKTKN+W+DR+KFEK+ GKYD++Q+DY    ++  ET K  S +  L+P ES+L+ ++Q+L++++ +++ M + + EMKY+  K PLG+LT AQIKAGY +L++IE  +  G    ++L++ACN +YTRIPHDFG
Sbjct:  178 KKFLDKTKNNWEDREKFEKVPGKYDMLQMDYATNTQDEEETKKEESLKSPLKP-ESQLDLRVQELIKLICNVQAMEEMMMEMKYNTKKAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHG-RALMEACNEFYTRIPHDFG 314          

HSP 2 Score: 77.411 bits (189), Expect = 2.717e-45
Identity = 36/59 (61.02%), Postives = 43/59 (72.88%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 953
            QTNLQFNNNK+Y+IQLL+D+ +  + VWMRW RVGK+GQ  L     NL  AKE F KK
Sbjct:  121 QTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKMGQHSLVACSGNLNKAKEIFQKK 179          

HSP 3 Score: 69.707 bits (169), Expect = 1.378e-11
Identity = 32/78 (41.03%), Postives = 47/78 (60.26%), Query Frame = 1
Query: 2371 HFISMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQVNFLKNYF 2604
            H   +R PPLIR+  E+  +++LLE L DI+IA+KL+        HPLD+HY+NLHC   L  +D+  Y+   +  Y 
Sbjct:  311 HDFGLRTPPLIRTQKELSEKIQLLEALGDIEIAIKLVKTELQSPEHPLDQHYRNLHCA--LRPLDHESYEFKVISQYL 386          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Human
Match: PARP1 (poly(ADP-ribose) polymerase 1 [Source:HGNC Symbol;Acc:HGNC:270])

HSP 1 Score: 85.8853 bits (211), Expect = 3.436e-21
Identity = 49/137 (35.77%), Postives = 84/137 (61.31%), Query Frame = 1
Query:  997 KRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEP-IESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            K + +KT N W  +  F K   K+  ++IDY + E     +   ++ + P  +SKL + +QDL++++FD++ M  A+ E + D  K+PLG+L++ QI+A Y  L E++  +S+G SS+  ++   N +YT IPHDFG
Sbjct:  616 KLYEEKTGNAWHSKN-FTKYPKKFYPLEIDYGQDE-----EAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAVSQG-SSDSQILDLSNRFYTLIPHDFG 745          

HSP 2 Score: 37.3502 bits (85), Expect = 3.436e-21
Identity = 22/53 (41.51%), Postives = 31/53 (58.49%), Query Frame = 3
Query:  795 NNNKFYIIQLLKDEKEPIYYVWMRWARVGK-IGQMKLTRFYNNLAAAKECFMK 950
              N +Y +QLL+D+KE  Y+++  W RVG  IG  KL +  +   A  E FMK
Sbjct:  565 GTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAI-EHFMK 616          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Human
Match: PARP3 (poly(ADP-ribose) polymerase family member 3 [Source:HGNC Symbol;Acc:HGNC:273])

HSP 1 Score: 65.0846 bits (157), Expect = 6.603e-18
Identity = 41/143 (28.67%), Postives = 78/143 (54.55%), Query Frame = 1
Query:  988 NLSKRFYDKTKNDWQDRQKFEKINGKYDLVQI---DYCKKEILETNKIASQVKLEPIES-KLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            +  K+F +KTKN+W +R  F    GKY L+++   D  ++ +++ ++   +   + ++   L+   Q L+  +F  +   + ++ M  D  K+PLG+L++ QI  G+ AL  +E  L       +SL +  + +YT IPH+FG
Sbjct:  124 DFEKKFREKTKNNWAERDHFVSHPGKYTLIEVQAEDEAQEAVVKVDRGPVRTVTKRVQPCSLDPATQKLITNIFSKEMFKNTMALMDLDVKKMPLGKLSKQQIARGFEALEALEEALKGPTDGGQSLEELSSHFYTVIPHNFG 266          

HSP 2 Score: 46.9802 bits (110), Expect = 6.603e-18
Identity = 25/50 (50.00%), Postives = 31/50 (62.00%), Query Frame = 3
Query:  804 KFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 953
            KFYIIQLL+D     +  W RW RVG++GQ K+  F   L  AK+ F KK
Sbjct:   81 KFYIIQLLQDSNR-FFTCWNRWGRVGEVGQSKINHF-TRLEDAKKDFEKK 128          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Celegans
Match: parp-1 (Poly [ADP-ribose] polymerase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9N4H4])

HSP 1 Score: 79.337 bits (194), Expect = 1.161e-20
Identity = 43/134 (32.09%), Postives = 73/134 (54.48%), Query Frame = 1
Query: 1003 FYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            F++KTKNDW  R+ F K+ G +  V+ DY +   +   +I    K     + L + +++++  +FD++ M  A+   + D NK+PLGRL+  QI   +  L +I  LL +       ++   N +YT IPH+FG
Sbjct:  542 FHEKTKNDWIYRKHFRKMPGMFSYVETDYSEFAQITDTEITPGSK-----TLLPKSVKEVVMSIFDVENMKSALKSFEMDVNKMPLGRLSHNQINLAFEVLNDISDLLVKLPIDASRILDFSNKFYTIIPHNFG 670          

HSP 2 Score: 40.817 bits (94), Expect = 1.161e-20
Identity = 22/51 (43.14%), Postives = 31/51 (60.78%), Query Frame = 3
Query:  780 TNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVG-KIGQMKLTRFYNNLAA 929
            T+L  N N +Y IQLLKD++   YYV+  W RVG ++G  K   + N+  A
Sbjct:  484 TDLTQNKNSYYKIQLLKDDQRENYYVFRSWGRVGTEVGGNKHESYSNSNEA 534          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Celegans
Match: parp-1 (Poly [ADP-ribose] polymerase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9N4H4])

HSP 1 Score: 53.9138 bits (128), Expect = 2.603e-7
Identity = 26/71 (36.62%), Postives = 40/71 (56.34%), Query Frame = 1
Query: 1192 VFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            +FD++ M  A+   + D NK+PLGRL+  QI   +  L +I  LL +       ++   N +YT IPH+FG
Sbjct:    3 IFDVENMKSALKSFEMDVNKMPLGRLSHNQINLAFEVLNDISDLLVKLPIDASRILDFSNKFYTIIPHNFG 73          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Fly
Match: Parp (gene:FBgn0010247 transcript:FBtr0113885)

HSP 1 Score: 84.3445 bits (207), Expect = 3.569e-16
Identity = 50/141 (35.46%), Postives = 81/141 (57.45%), Query Frame = 1
Query:  988 NLSKRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEP--IESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            N  + + DKT N+++ R  F K  G+   ++I Y   + L        VK E     SKLE  +Q+L++++FD+  MN  + E   D +K+PLG+L+  QI++ Y  ++EI  +L  G ++ K L+ A N +YT IPH+FG
Sbjct:  596 NFKEIYADKTGNEYEQRDNFVKRTGRMYPIEIQYDDDQKL--------VKHESHFFTSKLEISVQNLIKLIFDIDSMNKTLMEFHIDMDKMPLGKLSAHQIQSAYRVVKEIYNVLECGSNTAK-LIDATNRFYTLIPHNFG 727          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Zebrafish
Match: parp2 (poly (ADP-ribose) polymerase 2 [Source:ZFIN;Acc:ZDB-GENE-031113-6])

HSP 1 Score: 119.783 bits (299), Expect = 6.204e-42
Identity = 60/129 (46.51%), Postives = 84/129 (65.12%), Query Frame = 1
Query: 1021 NDWQDRQKFEKINGKYDLVQIDYCKKEILETNKI-ASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            N+W+ R  FEK+ GKYD+V +DY  ++  E   +  S  + +P +  L  K+Q L+ ++ DLK M + V EMK+D  K PLG+LT  QI+AGY +L+ IE  L +   SNK L+ ACN +YTRIPHDFG
Sbjct:  255 NEWEHRASFEKVAGKYDMVFMDYSTEDKGEEKAVVPSATQKKPCQ--LNSKVQSLLELICDLKAMEECVLEMKFDTKKAPLGKLTAEQIRAGYASLKRIEECLKK-KGSNKELLDACNQFYTRIPHDFG 380          

HSP 2 Score: 72.4034 bits (176), Expect = 6.204e-42
Identity = 32/52 (61.54%), Postives = 38/52 (73.08%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAA 932
            QTNLQFNNNK+Y+IQLL+D+    Y VW+RW RVGK+GQ  L     NLA A
Sbjct:  190 QTNLQFNNNKYYLIQLLEDDSAKAYSVWLRWGRVGKVGQNNLVSCGANLAQA 241          

HSP 3 Score: 70.8626 bits (172), Expect = 4.143e-12
Identity = 32/71 (45.07%), Postives = 47/71 (66.20%), Query Frame = 1
Query: 2371 HFISMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQV 2583
            H   +R PP+IRS  E+K ++ LLETLSDI+IA+K++  N     HPLDR Y +L+C +  +  D+  Y+V
Sbjct:  377 HDFGLRTPPIIRSEEELKEKITLLETLSDIQIAVKMVQSNVKSDEHPLDRQYHSLNCQLQPLDTDSNEYKV 447          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Zebrafish
Match: parp2 (poly (ADP-ribose) polymerase 2 [Source:ZFIN;Acc:ZDB-GENE-031113-6])

HSP 1 Score: 119.783 bits (299), Expect = 6.795e-42
Identity = 60/129 (46.51%), Postives = 84/129 (65.12%), Query Frame = 1
Query: 1021 NDWQDRQKFEKINGKYDLVQIDYCKKEILETNKI-ASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            N+W+ R  FEK+ GKYD+V +DY  ++  E   +  S  + +P +  L  K+Q L+ ++ DLK M + V EMK+D  K PLG+LT  QI+AGY +L+ IE  L +   SNK L+ ACN +YTRIPHDFG
Sbjct:  254 NEWEHRASFEKVAGKYDMVFMDYSTEDKGEEKAVVPSATQKKPCQ--LNSKVQSLLELICDLKAMEECVLEMKFDTKKAPLGKLTAEQIRAGYASLKRIEECLKK-KGSNKELLDACNQFYTRIPHDFG 379          

HSP 2 Score: 72.4034 bits (176), Expect = 6.795e-42
Identity = 32/52 (61.54%), Postives = 38/52 (73.08%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAA 932
            QTNLQFNNNK+Y+IQLL+D+    Y VW+RW RVGK+GQ  L     NLA A
Sbjct:  189 QTNLQFNNNKYYLIQLLEDDSAKAYSVWLRWGRVGKVGQNNLVSCGANLAQA 240          

HSP 3 Score: 70.8626 bits (172), Expect = 4.320e-12
Identity = 32/71 (45.07%), Postives = 47/71 (66.20%), Query Frame = 1
Query: 2371 HFISMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQV 2583
            H   +R PP+IRS  E+K ++ LLETLSDI+IA+K++  N     HPLDR Y +L+C +  +  D+  Y+V
Sbjct:  376 HDFGLRTPPIIRSEEELKEKITLLETLSDIQIAVKMVQSNVKSDEHPLDRQYHSLNCQLQPLDTDSNEYKV 446          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Zebrafish
Match: parp2 (poly (ADP-ribose) polymerase 2 [Source:ZFIN;Acc:ZDB-GENE-031113-6])

HSP 1 Score: 120.168 bits (300), Expect = 2.273e-41
Identity = 60/129 (46.51%), Postives = 84/129 (65.12%), Query Frame = 1
Query: 1021 NDWQDRQKFEKINGKYDLVQIDYCKKEILETNKI-ASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            N+W+ R  FEK+ GKYD+V +DY  ++  E   +  S  + +P +  L  K+Q L+ ++ DLK M + V EMK+D  K PLG+LT  QI+AGY +L+ IE  L +   SNK L+ ACN +YTRIPHDFG
Sbjct:  253 NEWEHRASFEKVAGKYDMVFMDYSTEDKGEEKAVVPSATQKKPCQ--LNSKVQSLLELICDLKAMEECVLEMKFDTKKAPLGKLTAEQIRAGYASLKRIEECLKK-KGSNKELLDACNQFYTRIPHDFG 378          

HSP 2 Score: 70.4774 bits (171), Expect = 2.273e-41
Identity = 31/51 (60.78%), Postives = 37/51 (72.55%), Query Frame = 3
Query:  780 TNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAA 932
            TNLQFNNNK+Y+IQLL+D+    Y VW+RW RVGK+GQ  L     NLA A
Sbjct:  189 TNLQFNNNKYYLIQLLEDDSAKAYSVWLRWGRVGKVGQNNLVSCGANLAQA 239          

HSP 3 Score: 70.8626 bits (172), Expect = 5.124e-12
Identity = 32/71 (45.07%), Postives = 47/71 (66.20%), Query Frame = 1
Query: 2371 HFISMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQV 2583
            H   +R PP+IRS  E+K ++ LLETLSDI+IA+K++  N     HPLDR Y +L+C +  +  D+  Y+V
Sbjct:  375 HDFGLRTPPIIRSEEELKEKITLLETLSDIQIAVKMVQSNVKSDEHPLDRQYHSLNCQLQPLDTDSNEYKV 445          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Zebrafish
Match: parp2 (poly (ADP-ribose) polymerase 2 [Source:ZFIN;Acc:ZDB-GENE-031113-6])

HSP 1 Score: 73.9442 bits (180), Expect = 2.529e-28
Identity = 40/93 (43.01%), Postives = 59/93 (63.44%), Query Frame = 1
Query: 1015 TKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIA-SQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKA 1290
            TKN+W+ R  FEK+ GKYD+V +DY  ++  E   +  S  + +P +  L  K+Q L+ ++ DLK M + V EMK+D  K PLG+LT  QI+A
Sbjct:  181 TKNEWEHRASFEKVAGKYDMVFMDYSTEDKGEEKAVVPSATQKKPCQ--LNSKVQSLLELICDLKAMEECVLEMKFDTKKAPLGKLTAEQIRA 271          

HSP 2 Score: 72.7886 bits (177), Expect = 2.529e-28
Identity = 32/52 (61.54%), Postives = 38/52 (73.08%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAA 932
            QTNLQFNNNK+Y+IQLL+D+    Y VW+RW RVGK+GQ  L     NLA A
Sbjct:  118 QTNLQFNNNKYYLIQLLEDDSAKAYSVWLRWGRVGKVGQNNLVSCGANLAQA 169          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Zebrafish
Match: parp1 (poly (ADP-ribose) polymerase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3955])

HSP 1 Score: 80.4925 bits (197), Expect = 6.694e-20
Identity = 51/140 (36.43%), Postives = 84/140 (60.00%), Query Frame = 1
Query:  988 NLSKRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLV-QACNTYYTRIPHDFG 1404
            N    + +KT N W     F K   K+  ++IDY + E  E  K  +Q      +S+LE+ +QDL+R++FD++ M  A+ E + D  K+PLG+L++ QI++ Y  L E++  +++  SS++SL+    N +YT IPHDFG
Sbjct:  610 NFCGVYEEKTGNAWASSN-FTKYPNKFYPLEIDYGQDE--EAVKKLTQS--AGAKSQLEKPVQDLIRMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYSLLSEVQQAVAD--SSSESLILDLSNRFYTLIPHDFG 742          

HSP 2 Score: 37.7354 bits (86), Expect = 6.694e-20
Identity = 19/46 (41.30%), Postives = 29/46 (63.04%), Query Frame = 3
Query:  795 NNNKFYIIQLLKDEKEPIYYVWMRWARVG-KIGQMKLTRFYNNLAA 929
              N +Y +QLL+D+ +  Y+V+  W RVG  IG  KL +FY+  +A
Sbjct:  562 GTNSYYKLQLLEDDVQKRYWVFRSWGRVGTTIGGNKLDKFYDKNSA 607          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Xenopus
Match: gldn (gliomedin [Source:Xenbase;Acc:XB-GENE-1004090])

HSP 1 Score: 125.946 bits (315), Expect = 1.497e-43
Identity = 62/137 (45.26%), Postives = 94/137 (68.61%), Query Frame = 1
Query:  997 KRFYDKTKNDWQDRQKFEKINGKYDLVQIDY-CKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            K+F DKTKN W +R +FEK  GKYD++Q+DY   +++L+   +A   KLE    +L+  +Q+L++++ +LK M + V EMK+D  K PLG+LT  QI+AGY +L+ IE  + +     + L++ACN +YTRIPHDFG
Sbjct:  155 KKFLDKTKNLWTERAQFEKCPGKYDMLQMDYNATEQVLKEESLADLPKLE---CQLDLSIQELIQLICNLKAMEETVLEMKFDTKKAPLGKLTVDQIRAGYCSLQRIENCIKK-QKFGRDLLEACNEFYTRIPHDFG 287          

HSP 2 Score: 72.4034 bits (176), Expect = 1.497e-43
Identity = 34/59 (57.63%), Postives = 42/59 (71.19%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 953
            QTNLQFNNNK+Y+IQLL+D+    + VWMRW RVGK+GQ  L     +L  AK+ F KK
Sbjct:   98 QTNLQFNNNKYYLIQLLEDDGVRNFSVWMRWGRVGKVGQNSLVCCGGDLQKAKDIFQKK 156          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Xenopus
Match: gldn (gliomedin [Source:Xenbase;Acc:XB-GENE-1004090])

HSP 1 Score: 124.79 bits (312), Expect = 2.428e-43
Identity = 62/138 (44.93%), Postives = 91/138 (65.94%), Query Frame = 1
Query:  997 KRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIA--SQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            K+F DKTKN W +R +FEK  GKYD++Q+DY   E  E   +   S   L  +E +L+  +Q+L++++ +LK M + V EMK+D  K PLG+LT  QI+AGY +L+ IE  + +     + L++ACN +YTRIPHDFG
Sbjct:  337 KKFLDKTKNLWTERAQFEKCPGKYDMLQMDYNATEQEEERAVKEESLADLPKLECQLDLSIQELIQLICNLKAMEETVLEMKFDTKKAPLGKLTVDQIRAGYCSLQRIENCIKK-QKFGRDLLEACNEFYTRIPHDFG 473          

HSP 2 Score: 72.7886 bits (177), Expect = 2.428e-43
Identity = 34/59 (57.63%), Postives = 42/59 (71.19%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 953
            QTNLQFNNNK+Y+IQLL+D+    + VWMRW RVGK+GQ  L     +L  AK+ F KK
Sbjct:  280 QTNLQFNNNKYYLIQLLEDDGVRNFSVWMRWGRVGKVGQNSLVCCGGDLQKAKDIFQKK 338          

HSP 3 Score: 58.9214 bits (141), Expect = 3.434e-8
Identity = 26/71 (36.62%), Postives = 45/71 (63.38%), Query Frame = 1
Query: 2371 HFISMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQV 2583
            H   +R PPLIR++ ++  ++ LLE L DI+IA+KL + + +   HP+DR Y+ L+C I  +   +  +Q+
Sbjct:  470 HDFGLRTPPLIRTLEDLTVKVRLLEALGDIQIAVKLASMDLNSLEHPIDRQYRQLNCSIQPLDKTSSTFQL 540          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Xenopus
Match: gldn (gliomedin [Source:Xenbase;Acc:XB-GENE-1004090])

HSP 1 Score: 124.79 bits (312), Expect = 2.469e-43
Identity = 62/138 (44.93%), Postives = 91/138 (65.94%), Query Frame = 1
Query:  997 KRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIA--SQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            K+F DKTKN W +R +FEK  GKYD++Q+DY   E  E   +   S   L  +E +L+  +Q+L++++ +LK M + V EMK+D  K PLG+LT  QI+AGY +L+ IE  + +     + L++ACN +YTRIPHDFG
Sbjct:  337 KKFLDKTKNLWTERAQFEKCPGKYDMLQMDYNATEQEEERAVKEESLADLPKLECQLDLSIQELIQLICNLKAMEETVLEMKFDTKKAPLGKLTVDQIRAGYCSLQRIENCIKK-QKFGRDLLEACNEFYTRIPHDFG 473          

HSP 2 Score: 72.7886 bits (177), Expect = 2.469e-43
Identity = 34/59 (57.63%), Postives = 42/59 (71.19%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 953
            QTNLQFNNNK+Y+IQLL+D+    + VWMRW RVGK+GQ  L     +L  AK+ F KK
Sbjct:  280 QTNLQFNNNKYYLIQLLEDDGVRNFSVWMRWGRVGKVGQNSLVCCGGDLQKAKDIFQKK 338          

HSP 3 Score: 59.3066 bits (142), Expect = 2.465e-8
Identity = 26/71 (36.62%), Postives = 45/71 (63.38%), Query Frame = 1
Query: 2371 HFISMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQV 2583
            H   +R PPLIR++ ++  ++ LLE L DI+IA+KL + + +   HP+DR Y+ L+C I  +   +  +Q+
Sbjct:  470 HDFGLRTPPLIRTLEDLTVKVRLLEALGDIQIAVKLASMDLNSLEHPIDRQYRQLNCSIQPLDKTSSTFQL 540          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Xenopus
Match: gldn (gliomedin [Source:Xenbase;Acc:XB-GENE-1004090])

HSP 1 Score: 124.79 bits (312), Expect = 2.524e-43
Identity = 62/138 (44.93%), Postives = 91/138 (65.94%), Query Frame = 1
Query:  997 KRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIA--SQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            K+F DKTKN W +R +FEK  GKYD++Q+DY   E  E   +   S   L  +E +L+  +Q+L++++ +LK M + V EMK+D  K PLG+LT  QI+AGY +L+ IE  + +     + L++ACN +YTRIPHDFG
Sbjct:   69 KKFLDKTKNLWTERAQFEKCPGKYDMLQMDYNATEQEEERAVKEESLADLPKLECQLDLSIQELIQLICNLKAMEETVLEMKFDTKKAPLGKLTVDQIRAGYCSLQRIENCIKK-QKFGRDLLEACNEFYTRIPHDFG 205          

HSP 2 Score: 72.7886 bits (177), Expect = 2.524e-43
Identity = 34/60 (56.67%), Postives = 42/60 (70.00%), Query Frame = 3
Query:  774 FQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 953
             QTNLQFNNNK+Y+IQLL+D+    + VWMRW RVGK+GQ  L     +L  AK+ F KK
Sbjct:   11 LQTNLQFNNNKYYLIQLLEDDGVRNFSVWMRWGRVGKVGQNSLVCCGGDLQKAKDIFQKK 70          

HSP 3 Score: 58.151 bits (139), Expect = 4.311e-8
Identity = 26/71 (36.62%), Postives = 45/71 (63.38%), Query Frame = 1
Query: 2371 HFISMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQV 2583
            H   +R PPLIR++ ++  ++ LLE L DI+IA+KL + + +   HP+DR Y+ L+C I  +   +  +Q+
Sbjct:  202 HDFGLRTPPLIRTLEDLTVKVRLLEALGDIQIAVKLASMDLNSLEHPIDRQYRQLNCSIQPLDKTSSTFQL 272          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Xenopus
Match: gldn (gliomedin [Source:Xenbase;Acc:XB-GENE-1004090])

HSP 1 Score: 124.79 bits (312), Expect = 3.479e-43
Identity = 62/138 (44.93%), Postives = 91/138 (65.94%), Query Frame = 1
Query:  997 KRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIA--SQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            K+F DKTKN W +R +FEK  GKYD++Q+DY   E  E   +   S   L  +E +L+  +Q+L++++ +LK M + V EMK+D  K PLG+LT  QI+AGY +L+ IE  + +     + L++ACN +YTRIPHDFG
Sbjct:  143 KKFLDKTKNLWTERAQFEKCPGKYDMLQMDYNATEQEEERAVKEESLADLPKLECQLDLSIQELIQLICNLKAMEETVLEMKFDTKKAPLGKLTVDQIRAGYCSLQRIENCIKK-QKFGRDLLEACNEFYTRIPHDFG 279          

HSP 2 Score: 72.4034 bits (176), Expect = 3.479e-43
Identity = 34/59 (57.63%), Postives = 42/59 (71.19%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 953
            QTNLQFNNNK+Y+IQLL+D+    + VWMRW RVGK+GQ  L     +L  AK+ F KK
Sbjct:   86 QTNLQFNNNKYYLIQLLEDDGVRNFSVWMRWGRVGKVGQNSLVCCGGDLQKAKDIFQKK 144          

HSP 3 Score: 58.151 bits (139), Expect = 5.252e-8
Identity = 26/71 (36.62%), Postives = 45/71 (63.38%), Query Frame = 1
Query: 2371 HFISMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQV 2583
            H   +R PPLIR++ ++  ++ LLE L DI+IA+KL + + +   HP+DR Y+ L+C I  +   +  +Q+
Sbjct:  276 HDFGLRTPPLIRTLEDLTVKVRLLEALGDIQIAVKLASMDLNSLEHPIDRQYRQLNCSIQPLDKTSSTFQL 346          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Mouse
Match: Parp2 (poly (ADP-ribose) polymerase family, member 2 [Source:MGI Symbol;Acc:MGI:1341112])

HSP 1 Score: 136.732 bits (343), Expect = 6.032e-48
Identity = 65/136 (47.79%), Postives = 100/136 (73.53%), Query Frame = 1
Query:  997 KRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            K+F DKTKN+W+DR+ FEK+ GKYD++Q+DY      E+ K   +  L+P ES+L+ ++Q+L++++ +++ M + + EMKYD  + PLG+LT AQIKAGY +L++IE  +  G    ++LV+ACN +YTRIPHDFG
Sbjct:  158 KKFLDKTKNNWEDRENFEKVPGKYDMLQMDYAASTQDES-KTKEEETLKP-ESQLDLRVQELLKLICNVQTMEEMMIEMKYDTKRAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHG-RALVEACNEFYTRIPHDFG 290          

HSP 2 Score: 75.8702 bits (185), Expect = 6.032e-48
Identity = 35/59 (59.32%), Postives = 42/59 (71.19%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 953
            QTNLQFNNNK+Y+IQLL+D+ +  + VWMRW RVGK GQ  L     +L  AKE F KK
Sbjct:  101 QTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKTGQHSLVTCSGDLNKAKEIFQKK 159          

HSP 3 Score: 65.4698 bits (158), Expect = 2.236e-10
Identity = 28/59 (47.46%), Postives = 40/59 (67.80%), Query Frame = 1
Query: 2371 HFISMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCII 2547
            H   + IPP+IR+  E+  +++LLE L DI+IALKL+        HPLD+HY+NLHC +
Sbjct:  287 HDFGLSIPPVIRTEKELSDKVKLLEALGDIEIALKLVKSERQGLEHPLDQHYRNLHCAL 345          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Mouse
Match: Parp1 (poly (ADP-ribose) polymerase family, member 1 [Source:MGI Symbol;Acc:MGI:1340806])

HSP 1 Score: 82.4185 bits (202), Expect = 1.079e-20
Identity = 48/137 (35.04%), Postives = 82/137 (59.85%), Query Frame = 1
Query:  997 KRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEP-IESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            K + +KT N W  +  F K   K+  ++IDY + E     +   ++ ++P  +SKL + +Q+L+ ++FD++ M  A+ E + D  K+PLG+L+  QI+A Y  L E++  +S+G SS   ++   N +YT IPHDFG
Sbjct:  616 KLYEEKTGNAWHSKN-FTKYPKKFYPLEIDYGQDE-----EAVKKLTVKPGTKSKLPKPVQELVGMIFDVESMKKALVEYEIDLQKMPLGKLSRRQIQAAYSILSEVQQAVSQG-SSESQILDLSNRFYTLIPHDFG 745          

HSP 2 Score: 38.891 bits (89), Expect = 1.079e-20
Identity = 22/53 (41.51%), Postives = 31/53 (58.49%), Query Frame = 3
Query:  795 NNNKFYIIQLLKDEKEPIYYVWMRWARVGK-IGQMKLTRFYNNLAAAKECFMK 950
              N +Y +QLL+D+KE  Y+++  W RVG  IG  KL +  +   A  E FMK
Sbjct:  565 GTNSYYKLQLLEDDKESRYWIFRSWGRVGTVIGSNKLEQMPSKEDAV-EHFMK 616          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Mouse
Match: Parp3 (poly (ADP-ribose) polymerase family, member 3 [Source:MGI Symbol;Acc:MGI:1891258])

HSP 1 Score: 68.9366 bits (167), Expect = 4.651e-18
Identity = 40/136 (29.41%), Postives = 71/136 (52.21%), Query Frame = 1
Query: 1015 TKNDWQDRQKFEKINGKYDLVQIDY-CKKEILETNKIASQVKLEPIES-----KLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            TKN W++R +F     KY L+++    + +      ++ QV   P+ +      L+   Q+L+  +F  +   +A++ M  D  K+PLG+LT+ QI  G+ AL  +E  +       +SL +  + +YT IPH+FG
Sbjct:  130 TKNKWEERDRFVAQPNKYTLIEVQGEAESQEAVVKALSPQVYSGPVRTVVKPCSLDPATQNLITNIFSKEMFKNAMTLMNLDVKKMPLGKLTKQQIARGFEALEALEEAMKNPTGDGQSLEELSSCFYTVIPHNFG 265          

HSP 2 Score: 43.1282 bits (100), Expect = 4.651e-18
Identity = 18/36 (50.00%), Postives = 25/36 (69.44%), Query Frame = 3
Query:  804 KFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRF 911
            KFYIIQLL++     ++ W RW RVG++GQ K+  F
Sbjct:   79 KFYIIQLLEEGSR--FFCWNRWGRVGEVGQSKMNHF 112          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Mouse
Match: Parp3 (poly (ADP-ribose) polymerase family, member 3 [Source:MGI Symbol;Acc:MGI:1891258])

HSP 1 Score: 68.5514 bits (166), Expect = 7.314e-18
Identity = 40/135 (29.63%), Postives = 71/135 (52.59%), Query Frame = 1
Query: 1015 TKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIES-----KLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            TKN W++R +F     KY L+++    +   E+ +   +V   P+ +      L+   Q+L+  +F  +   +A++ M  D  K+PLG+LT+ QI  G+ AL  +E  +       +SL +  + +YT IPH+FG
Sbjct:  130 TKNKWEERDRFVAQPNKYTLIEV----QGEAESQEAVVKVYSGPVRTVVKPCSLDPATQNLITNIFSKEMFKNAMTLMNLDVKKMPLGKLTKQQIARGFEALEALEEAMKNPTGDGQSLEELSSCFYTVIPHNFG 260          

HSP 2 Score: 43.1282 bits (100), Expect = 7.314e-18
Identity = 18/36 (50.00%), Postives = 25/36 (69.44%), Query Frame = 3
Query:  804 KFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRF 911
            KFYIIQLL++     ++ W RW RVG++GQ K+  F
Sbjct:   79 KFYIIQLLEEGSR--FFCWNRWGRVGEVGQSKMNHF 112          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Mouse
Match: Parp3 (poly (ADP-ribose) polymerase family, member 3 [Source:MGI Symbol;Acc:MGI:1891258])

HSP 1 Score: 68.1662 bits (165), Expect = 8.961e-18
Identity = 40/135 (29.63%), Postives = 71/135 (52.59%), Query Frame = 1
Query: 1015 TKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIES-----KLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            TKN W++R +F     KY L+++    +   E+ +   +V   P+ +      L+   Q+L+  +F  +   +A++ M  D  K+PLG+LT+ QI  G+ AL  +E  +       +SL +  + +YT IPH+FG
Sbjct:  130 TKNKWEERDRFVAQPNKYTLIEV----QGEAESQEAVVKVYSGPVRTVVKPCSLDPATQNLITNIFSKEMFKNAMTLMNLDVKKMPLGKLTKQQIARGFEALEALEEAMKNPTGDGQSLEELSSCFYTVIPHNFG 260          

HSP 2 Score: 43.1282 bits (100), Expect = 8.961e-18
Identity = 18/36 (50.00%), Postives = 25/36 (69.44%), Query Frame = 3
Query:  804 KFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRF 911
            KFYIIQLL++     ++ W RW RVG++GQ K+  F
Sbjct:   79 KFYIIQLLEEGSR--FFCWNRWGRVGEVGQSKMNHF 112          
BLAST of Poly [ADP-ribose] polymerase vs. UniProt/SwissProt
Match: sp|O88554|PARP2_MOUSE (Poly [ADP-ribose] polymerase 2 OS=Mus musculus OX=10090 GN=Parp2 PE=1 SV=3)

HSP 1 Score: 136.732 bits (343), Expect = 3.677e-47
Identity = 65/136 (47.79%), Postives = 100/136 (73.53%), Query Frame = 1
Query:  997 KRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            K+F DKTKN+W+DR+ FEK+ GKYD++Q+DY      E+ K   +  L+P ES+L+ ++Q+L++++ +++ M + + EMKYD  + PLG+LT AQIKAGY +L++IE  +  G    ++LV+ACN +YTRIPHDFG
Sbjct:  158 KKFLDKTKNNWEDRENFEKVPGKYDMLQMDYAASTQDES-KTKEEETLKP-ESQLDLRVQELLKLICNVQTMEEMMIEMKYDTKRAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHG-RALVEACNEFYTRIPHDFG 290          

HSP 2 Score: 75.8702 bits (185), Expect = 3.677e-47
Identity = 35/59 (59.32%), Postives = 42/59 (71.19%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 953
            QTNLQFNNNK+Y+IQLL+D+ +  + VWMRW RVGK GQ  L     +L  AKE F KK
Sbjct:  101 QTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKTGQHSLVTCSGDLNKAKEIFQKK 159          

HSP 3 Score: 65.4698 bits (158), Expect = 1.564e-9
Identity = 28/59 (47.46%), Postives = 40/59 (67.80%), Query Frame = 1
Query: 2371 HFISMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCII 2547
            H   + IPP+IR+  E+  +++LLE L DI+IALKL+        HPLD+HY+NLHC +
Sbjct:  287 HDFGLSIPPVIRTEKELSDKVKLLEALGDIEIALKLVKSERQGLEHPLDQHYRNLHCAL 345          
BLAST of Poly [ADP-ribose] polymerase vs. UniProt/SwissProt
Match: sp|Q9UGN5|PARP2_HUMAN (Poly [ADP-ribose] polymerase 2 OS=Homo sapiens OX=9606 GN=PARP2 PE=1 SV=2)

HSP 1 Score: 126.716 bits (317), Expect = 1.206e-44
Identity = 67/139 (48.20%), Postives = 104/139 (74.82%), Query Frame = 1
Query:  997 KRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCK--KEILETNKIAS-QVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            K+F DKTKN+W+DR+KFEK+ GKYD++Q+DY    ++  ET K  S +  L+P ES+L+ ++Q+L++++ +++ M + + EMKY+  K PLG+LT AQIKAGY +L++IE  +  G    ++L++ACN +YTRIPHDFG
Sbjct:  178 KKFLDKTKNNWEDREKFEKVPGKYDMLQMDYATNTQDEEETKKEESLKSPLKP-ESQLDLRVQELIKLICNVQAMEEMMMEMKYNTKKAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHG-RALMEACNEFYTRIPHDFG 314          

HSP 2 Score: 77.411 bits (189), Expect = 1.206e-44
Identity = 36/59 (61.02%), Postives = 43/59 (72.88%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 953
            QTNLQFNNNK+Y+IQLL+D+ +  + VWMRW RVGK+GQ  L     NL  AKE F KK
Sbjct:  121 QTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKMGQHSLVACSGNLNKAKEIFQKK 179          

HSP 3 Score: 69.707 bits (169), Expect = 6.620e-11
Identity = 32/78 (41.03%), Postives = 47/78 (60.26%), Query Frame = 1
Query: 2371 HFISMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQVNFLKNYF 2604
            H   +R PPLIR+  E+  +++LLE L DI+IA+KL+        HPLD+HY+NLHC   L  +D+  Y+   +  Y 
Sbjct:  311 HDFGLRTPPLIRTQKELSEKIQLLEALGDIEIAIKLVKTELQSPEHPLDQHYRNLHCA--LRPLDHESYEFKVISQYL 386          
BLAST of Poly [ADP-ribose] polymerase vs. UniProt/SwissProt
Match: sp|Q5Z8Q9|PRP2A_ORYSJ (Poly [ADP-ribose] polymerase 2-A OS=Oryza sativa subsp. japonica OX=39947 GN=PARP2-A PE=3 SV=2)

HSP 1 Score: 86.2705 bits (212), Expect = 1.686e-24
Identity = 46/135 (34.07%), Postives = 79/135 (58.52%), Query Frame = 1
Query: 1000 RFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            +F+ KT N W DR+ FE    KY  +++DY + +  ETNK  S    +  E+KLE ++   + ++ ++  M   + E+ Y+++K+PLG+L+++ I  GY  L+ I  ++S   +  + L Q    +YT IPHDFG
Sbjct:  259 KFHGKTNNHWSDRKSFECYARKYTWLEMDYGEAD-RETNKKVSPSTDQIKETKLETRIASFISLICNISMMKQQMVEIGYNSDKLPLGKLSKSTIFKGYDVLKRISNVIS--RADRRQLEQLTGEFYTVIPHDFG 390          

HSP 2 Score: 50.447 bits (119), Expect = 1.686e-24
Identity = 26/55 (47.27%), Postives = 33/55 (60.00%), Query Frame = 3
Query:  738 LILNDKSYIRKKFQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKL 902
            L+  D+ Y     QTN+  NNNKFYIIQ L+ +    + V+ RW RVG  GQ KL
Sbjct:  188 LLKGDEIYDATMNQTNVGDNNNKFYIIQALESDAGGSFMVYNRWGRVGARGQDKL 242          
BLAST of Poly [ADP-ribose] polymerase vs. UniProt/SwissProt
Match: sp|O50017|PARP2_MAIZE (Poly [ADP-ribose] polymerase 2 OS=Zea mays OX=4577 GN=PARP2 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 9.035e-24
Identity = 46/136 (33.82%), Postives = 78/136 (57.35%), Query Frame = 1
Query: 1000 RFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEI-LETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            +F++KT N W DR+ F+    KY  +++DY + E  +E   I  Q+K    E+KLE ++   + ++ ++  M   + E+ Y+  K+PLG+L +A I  GY  L+ I  ++S+  +  + L Q    +YT IPHDFG
Sbjct:  254 KFHNKTNNHWSDRKNFKCYAKKYTWLEMDYGETEKEIEKGSITDQIK----ETKLETRIAQFISLICNISMMKQRMVEIGYNAEKLPLGKLRKATILKGYHVLKRISDVISK--ADRRHLEQLTGEFYTVIPHDFG 383          

HSP 2 Score: 49.6766 bits (117), Expect = 9.035e-24
Identity = 26/56 (46.43%), Postives = 35/56 (62.50%), Query Frame = 3
Query:  735 MLILNDKSYIRKKFQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKL 902
            +L + D+ Y     QTN+  NNNKFYIIQ+L+ +    + V+ RW RVG  GQ KL
Sbjct:  182 VLQVGDEIYDATLNQTNVGDNNNKFYIIQVLESDAGGSFMVYNRWGRVGVRGQDKL 237          
BLAST of Poly [ADP-ribose] polymerase vs. UniProt/SwissProt
Match: sp|Q11207|PARP2_ARATH (Poly [ADP-ribose] polymerase 2 OS=Arabidopsis thaliana OX=3702 GN=PARP2 PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.320e-23
Identity = 42/141 (29.79%), Postives = 79/141 (56.03%), Query Frame = 1
Query:  991 LSKRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKE---ILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
             + +F DKTKN W DR++F      Y  +++DY K+E    +  +  +S  +++P +SKL+ ++   + ++ ++  M   + E+ Y+ NK+PLG+++++ I  GY  L+ I  ++         L +    +YT IPHDFG
Sbjct:  230 FTNKFNDKTKNYWSDRKEFIPHPKSYTWLEMDYGKEENDSPVNNDIPSSSSEVKPEQSKLDTRVAKFISLICNVSMMAQHMMEIGYNANKLPLGKISKSTISKGYEVLKRISEVID--RYDRTRLEELSGEFYTVIPHDFG 368          

HSP 2 Score: 55.4546 bits (132), Expect = 1.320e-23
Identity = 26/59 (44.07%), Postives = 38/59 (64.41%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 953
            QTN++ NNNKF+++Q+L+ + +  Y V+ RW RVG  GQ KL   Y++   A E F  K
Sbjct:  175 QTNVRDNNNKFFVLQVLESDSKKTYMVYTRWGRVGVKGQSKLDGPYDSWDRAIEIFTNK 233          
BLAST of Poly [ADP-ribose] polymerase vs. TrEMBL
Match: A0A3B4XBC1 (Poly [ADP-ribose] polymerase OS=Seriola lalandi dorsalis OX=1841481 PE=4 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 1.992e-47
Identity = 69/136 (50.74%), Postives = 90/136 (66.18%), Query Frame = 1
Query:  997 KRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            K+F DKTKN+W+ R  FEK+ GKYD+V +DY   E  E       V  + I SKL+ K+Q L+ ++ DLK M + V EMK+D  K PLG+LT  QI+AGY AL+ IE  L     SN+ L++ACN +YTRIPHDFG
Sbjct:  248 KKFLDKTKNEWEQRASFEKVAGKYDMVFMDYSTNEKEEEKTTVDTVPKKKI-SKLDVKIQSLLELICDLKAMEECVLEMKFDTRKAPLGKLTSEQIRAGYSALKRIEECLKR-KGSNRELLEACNQFYTRIPHDFG 381          

HSP 2 Score: 84.3445 bits (207), Expect = 1.992e-47
Identity = 37/59 (62.71%), Postives = 45/59 (76.27%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 953
            QTNLQFNNNK+Y+IQLL+D+   +Y VWMRW RVGK+GQ  LT F  +L  AK+ F KK
Sbjct:  191 QTNLQFNNNKYYLIQLLEDDNSKVYSVWMRWGRVGKVGQNSLTAFGGDLLKAKDVFKKK 249          

HSP 3 Score: 69.3218 bits (168), Expect = 2.837e-8
Identity = 30/71 (42.25%), Postives = 47/71 (66.20%), Query Frame = 1
Query: 2371 HFISMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQV 2583
            H   ++ PP+I +  E+K+++ LLE LSDI+IA+K++  +ED   HPLDR Y++L C +N +      YQV
Sbjct:  378 HDFGLKTPPVIHTEDELKKKIALLEALSDIQIAVKMVQSSEDGDEHPLDRQYRSLQCKLNPLDSSTHEYQV 448          
BLAST of Poly [ADP-ribose] polymerase vs. TrEMBL
Match: A0A2U9BIV2 (Poly [ADP-ribose] polymerase OS=Scophthalmus maximus OX=52904 GN=SMAX5B_006454 PE=4 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 6.899e-47
Identity = 72/138 (52.17%), Postives = 92/138 (66.67%), Query Frame = 1
Query:  997 KRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIE--SKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            K+F DKTKN W+ R  FEK+ GKYD+V +DY  KE     K  S V   P +  SKL  K+Q L+ ++ DLK M + V EMKYD  K PLG+LT  QI+AGY AL++IE  L +  SS + L++ACN +YTRIPHDFG
Sbjct:  247 KKFLDKTKNAWEQRASFEKVAGKYDMVFMDYSAKE-----KEESTVSTVPTKKTSKLNVKIQSLLELICDLKAMEECVLEMKYDTRKAPLGKLTTEQIRAGYAALKKIEACLKKKGSS-RELLEACNQFYTRIPHDFG 378          

HSP 2 Score: 81.2629 bits (199), Expect = 6.899e-47
Identity = 37/59 (62.71%), Postives = 44/59 (74.58%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 953
            QTNLQFNNNK+Y+IQLL+D+   +Y VWMRW RVGK+GQ  LT    +L  AK  FMKK
Sbjct:  190 QTNLQFNNNKYYLIQLLEDDISKVYSVWMRWGRVGKVGQSSLTACGGDLLKAKNFFMKK 248          

HSP 3 Score: 63.1586 bits (152), Expect = 2.334e-6
Identity = 29/79 (36.71%), Postives = 48/79 (60.76%), Query Frame = 1
Query: 2371 HFISMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQVNFLKNYFY 2607
            H   ++ PP+I S  E+K ++ LLE LSDI+IA+K++  +E    HPLDR Y +L C   L  +D+  ++   ++ Y +
Sbjct:  375 HDFGLKTPPIIHSEEELKAKIALLEALSDIQIAVKMVQSSEGSDEHPLDRQYCSLQC--KLQPLDSGSHEYKVVEKYLH 451          
BLAST of Poly [ADP-ribose] polymerase vs. TrEMBL
Match: A0A340XU05 (Poly [ADP-ribose] polymerase OS=Lipotes vexillifer OX=118797 GN=PARP2 PE=4 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 1.011e-46
Identity = 70/139 (50.36%), Postives = 104/139 (74.82%), Query Frame = 1
Query:  997 KRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILE--TNKIAS-QVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            K+F DKTKN+W+DR+KFEK+ GKYD++Q+DY  K   E  TNK  S +  L+P ES+L+ ++Q+L++++ +++ M + + EMKYD  K PLG+LT AQIKAGY +L++IE  +  G    ++L++ACN +YTRIPHDFG
Sbjct:  186 KKFLDKTKNNWEDREKFEKVPGKYDMLQMDYTTKTQSEEETNKGESLKSPLKP-ESQLDLRVQELIKLICNVQAMEEMMVEMKYDTKKAPLGKLTVAQIKAGYQSLKKIEDCIRTGQHG-RALIEACNEFYTRIPHDFG 322          

HSP 2 Score: 77.7962 bits (190), Expect = 1.011e-46
Identity = 35/59 (59.32%), Postives = 44/59 (74.58%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 953
            QTNLQFNNNK+Y+IQLL+D+ +  + VWMRW RVGK+GQ  L     +L+ AKE F KK
Sbjct:  129 QTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKMGQHSLVACSGDLSKAKEIFQKK 187          

HSP 3 Score: 66.6254 bits (161), Expect = 2.220e-7
Identity = 30/78 (38.46%), Postives = 47/78 (60.26%), Query Frame = 1
Query: 2371 HFISMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQVNFLKNYF 2604
            H   +R PPLIR+  E+  +++LLE L DI+IA+KL+        HPLD+HY+ LHC ++   +D+  Y+   +  Y 
Sbjct:  319 HDFGLRTPPLIRTEKELSDKVQLLEALGDIEIAIKLVRTELQSPEHPLDQHYRKLHCALH--PLDHESYEFKVISQYL 394          
BLAST of Poly [ADP-ribose] polymerase vs. TrEMBL
Match: A0A3B4TRT7 (Poly [ADP-ribose] polymerase OS=Seriola dumerili OX=41447 PE=4 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 1.044e-46
Identity = 68/136 (50.00%), Postives = 89/136 (65.44%), Query Frame = 1
Query:  997 KRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            K+F DKTKN+W+ R  FEK+ GKYD+V +DY   E  E       V  +   SKL+ K+Q L+ ++ DLK M + V EMK+D  K PLG+LT  QI+AGY AL+ IE  L     SN+ L++ACN +YTRIPHDFG
Sbjct:  246 KKFLDKTKNEWEQRASFEKVAGKYDMVFMDYSTNEKEEEKTTVDTVPKKKT-SKLDVKIQSLLELICDLKAMEECVLEMKFDTRKAPLGKLTSEQIRAGYSALKRIEECLKR-KGSNRELLEACNQFYTRIPHDFG 379          

HSP 2 Score: 83.9593 bits (206), Expect = 1.044e-46
Identity = 37/59 (62.71%), Postives = 45/59 (76.27%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 953
            QTNLQFNNNK+Y+IQLL+D+   +Y VWMRW RVGK+GQ  LT F  +L  AK+ F KK
Sbjct:  189 QTNLQFNNNKYYLIQLLEDDNSKVYSVWMRWGRVGKVGQNNLTAFGGDLLKAKDVFKKK 247          

HSP 3 Score: 71.633 bits (174), Expect = 5.413e-9
Identity = 31/71 (43.66%), Postives = 48/71 (67.61%), Query Frame = 1
Query: 2371 HFISMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQV 2583
            H   ++ PP+I +  E+K+++ LLE LSDI+IA+K++  +ED   HPLDR Y++L C +NL+      YQV
Sbjct:  376 HDFGLKTPPVIHTEDELKKKIALLEALSDIQIAVKMVQSSEDGDEHPLDRQYRSLQCKLNLLDPSTHEYQV 446          
BLAST of Poly [ADP-ribose] polymerase vs. TrEMBL
Match: A0A340XMH8 (Poly [ADP-ribose] polymerase OS=Lipotes vexillifer OX=118797 GN=PARP2 PE=4 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 1.117e-46
Identity = 70/139 (50.36%), Postives = 104/139 (74.82%), Query Frame = 1
Query:  997 KRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILE--TNKIAS-QVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            K+F DKTKN+W+DR+KFEK+ GKYD++Q+DY  K   E  TNK  S +  L+P ES+L+ ++Q+L++++ +++ M + + EMKYD  K PLG+LT AQIKAGY +L++IE  +  G    ++L++ACN +YTRIPHDFG
Sbjct:  166 KKFLDKTKNNWEDREKFEKVPGKYDMLQMDYTTKTQSEEETNKGESLKSPLKP-ESQLDLRVQELIKLICNVQAMEEMMVEMKYDTKKAPLGKLTVAQIKAGYQSLKKIEDCIRTGQHG-RALIEACNEFYTRIPHDFG 302          

HSP 2 Score: 77.411 bits (189), Expect = 1.117e-46
Identity = 35/59 (59.32%), Postives = 44/59 (74.58%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 953
            QTNLQFNNNK+Y+IQLL+D+ +  + VWMRW RVGK+GQ  L     +L+ AKE F KK
Sbjct:  109 QTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKMGQHSLVACSGDLSKAKEIFQKK 167          

HSP 3 Score: 66.2402 bits (160), Expect = 2.474e-7
Identity = 30/78 (38.46%), Postives = 47/78 (60.26%), Query Frame = 1
Query: 2371 HFISMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQVNFLKNYF 2604
            H   +R PPLIR+  E+  +++LLE L DI+IA+KL+        HPLD+HY+ LHC ++   +D+  Y+   +  Y 
Sbjct:  299 HDFGLRTPPLIRTEKELSDKVQLLEALGDIEIAIKLVRTELQSPEHPLDQHYRKLHCALH--PLDHESYEFKVISQYL 374          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Cavefish
Match: parp2 (poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Acc:103030103])

HSP 1 Score: 136.346 bits (342), Expect = 9.250e-50
Identity = 68/137 (49.64%), Postives = 97/137 (70.80%), Query Frame = 1
Query:  997 KRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKE-ILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            K+F DKTKN+W+DR  FEK+ GKYDLV +DY   +   E+  +++ V+ +P  S+L+ KLQ L+ ++ D+K M + V EMK+D  K PLG+LT  QI+AGY +L+ IE  L +   SN+ L++ACN +YTRIPHDFG
Sbjct:  240 KKFLDKTKNEWEDRANFEKVPGKYDLVFMDYTGNDNEEESCDVSTSVQKKP--SQLDLKLQSLLELICDIKAMEECVLEMKFDTKKAPLGKLTVEQIRAGYASLKRIEECLKK-KGSNRELLEACNQFYTRIPHDFG 373          

HSP 2 Score: 82.0333 bits (201), Expect = 9.250e-50
Identity = 38/59 (64.41%), Postives = 43/59 (72.88%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 953
            QTNLQFNNNK+Y+IQLL+D+    Y VWMRW RVGK+GQ  L     NLA AKE F KK
Sbjct:  183 QTNLQFNNNKYYLIQLLQDDHAKAYSVWMRWGRVGKVGQNNLVSCGGNLAEAKEIFKKK 241          

HSP 3 Score: 68.1662 bits (165), Expect = 2.388e-11
Identity = 30/71 (42.25%), Postives = 46/71 (64.79%), Query Frame = 1
Query: 2371 HFISMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQV 2583
            H   +R+PP IR+  E+K ++ LLE LSDI+IA+K++  +     HPLDR Y +L C +  VT ++  +QV
Sbjct:  370 HDFGLRVPPTIRTEEELKEKMALLEALSDIQIAVKMVESSSHSDEHPLDRQYHSLKCQLQPVTPNSHEFQV 440          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Cavefish
Match: parp2 (poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Acc:103030103])

HSP 1 Score: 136.346 bits (342), Expect = 3.099e-49
Identity = 68/137 (49.64%), Postives = 97/137 (70.80%), Query Frame = 1
Query:  997 KRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKE-ILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            K+F DKTKN+W+DR  FEK+ GKYDLV +DY   +   E+  +++ V+ +P  S+L+ KLQ L+ ++ D+K M + V EMK+D  K PLG+LT  QI+AGY +L+ IE  L +   SN+ L++ACN +YTRIPHDFG
Sbjct:  223 KKFLDKTKNEWEDRANFEKVPGKYDLVFMDYTGNDNEEESCDVSTSVQKKP--SQLDLKLQSLLELICDIKAMEECVLEMKFDTKKAPLGKLTVEQIRAGYASLKRIEECLKK-KGSNRELLEACNQFYTRIPHDFG 356          

HSP 2 Score: 80.1073 bits (196), Expect = 3.099e-49
Identity = 37/59 (62.71%), Postives = 43/59 (72.88%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 953
            +TNLQFNNNK+Y+IQLL+D+    Y VWMRW RVGK+GQ  L     NLA AKE F KK
Sbjct:  166 KTNLQFNNNKYYLIQLLQDDHAKAYSVWMRWGRVGKVGQNNLVSCGGNLAEAKEIFKKK 224          

HSP 3 Score: 68.5514 bits (166), Expect = 2.020e-11
Identity = 30/71 (42.25%), Postives = 46/71 (64.79%), Query Frame = 1
Query: 2371 HFISMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQV 2583
            H   +R+PP IR+  E+K ++ LLE LSDI+IA+K++  +     HPLDR Y +L C +  VT ++  +QV
Sbjct:  353 HDFGLRVPPTIRTEEELKEKMALLEALSDIQIAVKMVESSSHSDEHPLDRQYHSLKCQLQPVTPNSHEFQV 423          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Cavefish
Match: parp3 (poly(ADP-ribose) polymerase family member 3 [Source:NCBI gene;Acc:103034813])

HSP 1 Score: 78.1814 bits (191), Expect = 9.947e-21
Identity = 48/142 (33.80%), Postives = 83/142 (58.45%), Query Frame = 1
Query:  988 NLSKRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKI---ASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            N  K+F DKTKN+W DR+ F   +GKY L+++D  +   ++ + +   A++VK   +   L++  Q L++ +F+     +A+  M  D  K+PLG+L++ QI  G+ AL EIE    +  S   +L +  + ++T IPH+FG
Sbjct:  122 NFEKKFKDKTKNNWSDRENFVSHSGKYTLIEVDGDQDAEVKVDAVDGRAAEVKKNILPCTLDDPTQRLIKFIFNNDMFKEAMENMNLDIKKMPLGKLSKQQIAKGFEALEEIE-EAIKNKSRESTLSELSSKFFTIIPHNFG 262          

HSP 2 Score: 42.743 bits (99), Expect = 9.947e-21
Identity = 22/44 (50.00%), Postives = 25/44 (56.82%), Query Frame = 3
Query:  804 KFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAK 935
            KFY+IQ+L D     YY W RW RVG+ GQ  L    N  AA K
Sbjct:   80 KFYVIQVLVDGG--TYYCWTRWGRVGESGQNNLAGPTNADAAIK 121          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Cavefish
Match: parp3 (poly(ADP-ribose) polymerase family member 3 [Source:NCBI gene;Acc:103034813])

HSP 1 Score: 77.7962 bits (190), Expect = 1.114e-20
Identity = 48/142 (33.80%), Postives = 83/142 (58.45%), Query Frame = 1
Query:  988 NLSKRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKI---ASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            N  K+F DKTKN+W DR+ F   +GKY L+++D  +   ++ + +   A++VK   +   L++  Q L++ +F+     +A+  M  D  K+PLG+L++ QI  G+ AL EIE    +  S   +L +  + ++T IPH+FG
Sbjct:  122 NFEKKFKDKTKNNWSDRENFVSHSGKYTLIEVDGDQDAEVKVDAVDGRAAEVKKNILPCTLDDPTQRLIKFIFNNDMFKEAMENMNLDIKKMPLGKLSKQQIAKGFEALEEIE-EAIKNKSRESTLSELSSKFFTIIPHNFG 262          

HSP 2 Score: 42.743 bits (99), Expect = 1.114e-20
Identity = 22/44 (50.00%), Postives = 25/44 (56.82%), Query Frame = 3
Query:  804 KFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAK 935
            KFY+IQ+L D     YY W RW RVG+ GQ  L    N  AA K
Sbjct:   80 KFYVIQVLVDGG--TYYCWTRWGRVGESGQNNLAGPTNADAAIK 121          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Cavefish
Match: parp3 (poly(ADP-ribose) polymerase family member 3 [Source:NCBI gene;Acc:103034813])

HSP 1 Score: 78.1814 bits (191), Expect = 1.185e-20
Identity = 48/142 (33.80%), Postives = 83/142 (58.45%), Query Frame = 1
Query:  988 NLSKRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKI---ASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            N  K+F DKTKN+W DR+ F   +GKY L+++D  +   ++ + +   A++VK   +   L++  Q L++ +F+     +A+  M  D  K+PLG+L++ QI  G+ AL EIE    +  S   +L +  + ++T IPH+FG
Sbjct:  122 NFEKKFKDKTKNNWSDRENFVSHSGKYTLIEVDGDQDAEVKVDAVDGRAAEVKKNILPCTLDDPTQRLIKFIFNNDMFKEAMENMNLDIKKMPLGKLSKQQIAKGFEALEEIE-EAIKNKSRESTLSELSSKFFTIIPHNFG 262          

HSP 2 Score: 42.3578 bits (98), Expect = 1.185e-20
Identity = 22/44 (50.00%), Postives = 25/44 (56.82%), Query Frame = 3
Query:  804 KFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAK 935
            KFY+IQ+L D     YY W RW RVG+ GQ  L    N  AA K
Sbjct:   80 KFYVIQVLVDGG--TYYCWTRWGRVGESGQNNLAGPTNADAAIK 121          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003213.1 (pep scaffold:Pmarinus_7.0:GL484848:6623:9574:1 gene:ENSPMAG00000002936.1 transcript:ENSPMAT00000003213.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 5.800e-7
Identity = 20/33 (60.61%), Postives = 24/33 (72.73%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWAR 875
            QTN+  NNNKFY+IQLL+D     + VWMRW R
Sbjct:  106 QTNVGLNNNKFYLIQLLRDNDIKSFSVWMRWGR 138          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Nematostella
Match: EDO26345 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TC91])

HSP 1 Score: 133.265 bits (334), Expect = 4.547e-35
Identity = 66/134 (49.25%), Postives = 94/134 (70.15%), Query Frame = 1
Query: 1003 FYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            F DKTKNDW+DR  F K+ GKYDL+ +DY  +E  E +    + K    ESKL+ ++++L+ ++ +++ M +A+ EMKYD  K PLG+LT  QIKAGY AL++IE  +S+G   NK LV+AC+ +YTRIPH FG
Sbjct:    1 FSDKTKNDWEDRASFTKVQGKYDLLIMDYKAEENDEVDAPVKEEKPAKPESKLDCRVRELVELICNVQAMEEALKEMKYDTKKAPLGKLTTDQIKAGYEALKKIESCISKGDYGNK-LVKACDEFYTRIPHCFG 133          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Nematostella
Match: EDO46480 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ13])

HSP 1 Score: 88.9669 bits (219), Expect = 8.002e-29
Identity = 46/134 (34.33%), Postives = 77/134 (57.46%), Query Frame = 1
Query:  988 NLSKRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRI 1389
               K+F DKTKNDW+DR  F K+ GKYDL+ +DY  +E  E +    + K    ESKL+ ++++L+ ++ +++ M +A+ EMKYD  K PLG  +E  +    + LR    ++        S+   C+++ TR+
Sbjct:   92 TFEKKFSDKTKNDWEDRASFTKVQGKYDLLIMDYKAEENDEVDAPVKEEKPAKPESKLDCRVRELVELICNVQAMEEALKEMKYDTKKAPLGSFSEYHVCHYTIQLRMTGRIVPVSPRCKGSMT--CSSWITRL 223          

HSP 2 Score: 57.7658 bits (138), Expect = 8.002e-29
Identity = 29/53 (54.72%), Postives = 32/53 (60.38%), Query Frame = 3
Query:  804 KFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKLSS 962
            K+Y+IQLL+D     YY WMRW RVG  GQ  L  F  NL AAK  F KK S 
Sbjct:   47 KYYLIQLLEDNTAKKYYTWMRWGRVGFDGQKNLQAFGANLDAAKRTFEKKFSD 99          

HSP 3 Score: 66.2402 bits (160), Expect = 2.811e-11
Identity = 26/55 (47.27%), Postives = 41/55 (74.55%), Query Frame = 1
Query: 2377 ISMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHC 2541
            + M+ PPL+R+  E+K +LELLE L DI++A+ ++ E  D  +HP D+HY++LHC
Sbjct:  227 MKMKRPPLLRTNEEVKEKLELLEALGDIQVAITMLKEKVDDKMHPADKHYESLHC 281          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Nematostella
Match: EDO46812 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNW1])

HSP 1 Score: 83.5741 bits (205), Expect = 2.392e-16
Identity = 44/134 (32.84%), Postives = 83/134 (61.94%), Query Frame = 1
Query: 1003 FYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            + +KT N+W +R  F K   ++  ++IDY +      + + +++++   +SKL  ++Q+L++++FD++ M   + E + D  K+PLG+LT+ QI+  Y  L E + +LSE  +S  +++   N +YT IPHDFG
Sbjct:  571 YREKTGNEWSERDNFVKHPNRFYPLEIDYGQAH---EDVVKAKIEMGS-KSKLPSQIQELIKMIFDVESMKKTLIEFEIDLKKMPLGKLTKRQIEKAYSVLGEAQQILSEA-ASKTAVLDVSNRFYTLIPHDFG 699          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Nematostella
Match: EDO29976 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T240])

HSP 1 Score: 36.5798 bits (83), Expect = 5.376e-7
Identity = 17/49 (34.69%), Postives = 29/49 (59.18%), Query Frame = 3
Query:  792 FNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKE 938
            F  N FY +Q++ ++ + ++ +  RW R+G  GQ +LT F +  AA  E
Sbjct:  103 FGLNNFYKMQVIFEKGKNLWVLLTRWGRIGDRGQHQLTPFSDAKAATDE 151          

HSP 2 Score: 36.1946 bits (82), Expect = 5.376e-7
Identity = 35/115 (30.43%), Postives = 53/115 (46.09%), Query Frame = 1
Query:  997 KRFYDKTKNDWQDRQKFEKINGKYDLV------QIDYCK-KEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSE--MKYDNNKVPLGRLTEAQIKAGYLALREI 1314
            K F  KT N W ++  F K   KY LV      Q  + K K+IL+   + +        SKL + LQ LM+ + D + +  +VS   ++ D   +P GRL+   I      L +I
Sbjct:  154 KIFRSKTGNLWDEKGSFVKHPKKYSLVLPERNPQFHHRKPKDILKPFDLEACP-----PSKLPKPLQTLMKAITDQEWLRKSVSHHSLQVDPEFMPFGRLSLETINRARGVLEKI 263          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Medaka
Match: parp2 (poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Acc:101165670])

HSP 1 Score: 135.576 bits (340), Expect = 5.287e-48
Identity = 66/136 (48.53%), Postives = 92/136 (67.65%), Query Frame = 1
Query:  997 KRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            K+F+DKT+N+W+ R  F K+ GKYD+V +DY   E +ET      +K   + S L+ K+Q L+ ++ DLK M + V EMK+D  K PLG+LT  QI+AGY AL++IE  L    SS + L++ACN +YTRIPHDFG
Sbjct:  127 KKFFDKTRNEWEQRGSFVKVAGKYDMVFMDYSTNEKVETKTRVLSLK---VFSSLDPKVQSLLELICDLKAMEECVLEMKFDTRKAPLGKLTSEQIRAGYAALKKIEECLKRKGSS-RDLLEACNQFYTRIPHDFG 258          

HSP 2 Score: 77.0258 bits (188), Expect = 5.287e-48
Identity = 35/59 (59.32%), Postives = 42/59 (71.19%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 953
             TNLQFNNNKFY+IQLL+D+    + VWMRW RVGK+GQ  LT    +L  AK+ F KK
Sbjct:   70 STNLQFNNNKFYLIQLLQDDSSKSFSVWMRWGRVGKVGQNSLTACGGDLLKAKDIFKKK 128          

HSP 3 Score: 68.5514 bits (166), Expect = 1.895e-11
Identity = 31/78 (39.74%), Postives = 49/78 (62.82%), Query Frame = 1
Query: 2371 HFISMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQVNFLKNYF 2604
            H   +R PP+I + +E+K ++ LLE LSDI+IA+K++  + D   HPLDRHY +L C  NL  +D+   +   ++ Y 
Sbjct:  255 HDFGLRPPPVIHTDAELKEKISLLEALSDIQIAVKMVQSSADSEEHPLDRHYHSLKC--NLQPLDSTSSEFKVIEKYL 330          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Medaka
Match: parp2 (poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Acc:101165670])

HSP 1 Score: 131.724 bits (330), Expect = 1.738e-47
Identity = 65/136 (47.79%), Postives = 88/136 (64.71%), Query Frame = 1
Query:  997 KRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            K+F+DKT+N+W+ R  F K+ GKYD+V +DY   E  E N             KL+ K+Q L+ ++ DLK M + V EMK+D  K PLG+LT  QI+AGY AL++IE  L    SS + L++ACN +YTRIPHDFG
Sbjct:  236 KKFFDKTRNEWEQRGSFVKVAGKYDMVFMDYSTNEK-EENTTVVDAATNKRSCKLDPKVQSLLELICDLKAMEECVLEMKFDTRKAPLGKLTSEQIRAGYAALKKIEECLKRKGSS-RDLLEACNQFYTRIPHDFG 369          

HSP 2 Score: 78.9518 bits (193), Expect = 1.738e-47
Identity = 36/59 (61.02%), Postives = 43/59 (72.88%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 953
            QTNLQFNNNKFY+IQLL+D+    + VWMRW RVGK+GQ  LT    +L  AK+ F KK
Sbjct:  179 QTNLQFNNNKFYLIQLLQDDSSKSFSVWMRWGRVGKVGQNSLTACGGDLLKAKDIFKKK 237          

HSP 3 Score: 68.5514 bits (166), Expect = 1.833e-11
Identity = 31/78 (39.74%), Postives = 49/78 (62.82%), Query Frame = 1
Query: 2371 HFISMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQVNFLKNYF 2604
            H   +R PP+I + +E+K ++ LLE LSDI+IA+K++  + D   HPLDRHY +L C  NL  +D+   +   ++ Y 
Sbjct:  366 HDFGLRPPPVIHTDAELKEKISLLEALSDIQIAVKMVQSSADSEEHPLDRHYHSLKC--NLQPLDSTSSEFKVIEKYL 441          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Medaka
Match: parp2 (poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Acc:101165670])

HSP 1 Score: 131.724 bits (330), Expect = 1.782e-47
Identity = 65/136 (47.79%), Postives = 88/136 (64.71%), Query Frame = 1
Query:  997 KRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            K+F+DKT+N+W+ R  F K+ GKYD+V +DY   E  E N             KL+ K+Q L+ ++ DLK M + V EMK+D  K PLG+LT  QI+AGY AL++IE  L    SS + L++ACN +YTRIPHDFG
Sbjct:  236 KKFFDKTRNEWEQRGSFVKVAGKYDMVFMDYSTNEK-EENTTVVDAATNKRSCKLDPKVQSLLELICDLKAMEECVLEMKFDTRKAPLGKLTSEQIRAGYAALKKIEECLKRKGSS-RDLLEACNQFYTRIPHDFG 369          

HSP 2 Score: 78.9518 bits (193), Expect = 1.782e-47
Identity = 36/59 (61.02%), Postives = 43/59 (72.88%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 953
            QTNLQFNNNKFY+IQLL+D+    + VWMRW RVGK+GQ  LT    +L  AK+ F KK
Sbjct:  179 QTNLQFNNNKFYLIQLLQDDSSKSFSVWMRWGRVGKVGQNSLTACGGDLLKAKDIFKKK 237          

HSP 3 Score: 69.3218 bits (168), Expect = 1.099e-11
Identity = 31/78 (39.74%), Postives = 49/78 (62.82%), Query Frame = 1
Query: 2371 HFISMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQVNFLKNYF 2604
            H   +R PP+I + +E+K ++ LLE LSDI+IA+K++  + D   HPLDRHY +L C  NL  +D+   +   ++ Y 
Sbjct:  366 HDFGLRPPPVIHTDAELKEKISLLEALSDIQIAVKMVQSSADSEEHPLDRHYHSLKC--NLQPLDSTSSEFKVIEKYL 441          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Medaka
Match: parp3 (poly(ADP-ribose) polymerase family member 3 [Source:NCBI gene;Acc:101172069])

HSP 1 Score: 71.2478 bits (173), Expect = 1.667e-22
Identity = 41/133 (30.83%), Postives = 73/133 (54.89%), Query Frame = 1
Query: 1015 TKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKI---ASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            TKNDW +R  F    GKY L++++  +   ++ + +   A +V    +   L+E  Q L+ ++F      +A+  M  D  K+PLG+L++ QI  G+  L EIE  L++ +  +  L +  + ++T IPH+FG
Sbjct:  128 TKNDWSNRSNFVTHPGKYTLIEVEGEQDAEVKVDSVDGKAVKVPKNTLPCTLDEATQKLITLIFSNDMFKEAMECMDLDIKKMPLGKLSKVQIAKGFEVLEEIEAALNKPNQRH-LLEELSSKFFTTIPHNFG 259          

HSP 2 Score: 55.8398 bits (133), Expect = 1.667e-22
Identity = 24/45 (53.33%), Postives = 33/45 (73.33%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRF 911
            QTN+  NNNKFY+IQ++++ K   +Y W RW RVG++GQ KL  F
Sbjct:   68 QTNIGHNNNKFYVIQVVQENKR--FYSWNRWGRVGEVGQNKLNSF 110          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Medaka
Match: parp1 (poly(ADP-ribose) polymerase 1 [Source:NCBI gene;Acc:101157338])

HSP 1 Score: 73.1738 bits (178), Expect = 2.018e-17
Identity = 45/139 (32.37%), Postives = 77/139 (55.40%), Query Frame = 1
Query:  988 NLSKRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            N    + +KT N+W     F K   K+  ++IDY + E       AS       +SKL + +Q+L++++FD++ M  A+ E + D  K+PLG+L++ QI++ Y  L E++  +S+       ++   N +YT IPHDFG
Sbjct:  614 NFLSVYKEKTGNEW-GSSNFIKYPTKFYPLEIDYGQDEEAVKRLTASA----GTKSKLPKPVQELIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYALLTEVQQAVSD-CVPEAQILDLSNRFYTLIPHDFG 746          

HSP 2 Score: 36.5798 bits (83), Expect = 2.018e-17
Identity = 18/46 (39.13%), Postives = 29/46 (63.04%), Query Frame = 3
Query:  795 NNNKFYIIQLLKDEKEPIYYVWMRWARVG-KIGQMKLTRFYNNLAA 929
              N +Y +QLL+D+ +  Y+V+  W RVG  IG  KL +F++  +A
Sbjct:  566 GTNSYYKLQLLEDDLQKRYWVFRSWGRVGTTIGGNKLDKFHDKNSA 611          
BLAST of Poly [ADP-ribose] polymerase vs. Planmine SMEST
Match: SMESG000060010.1 (SMESG000060010.1)

HSP 1 Score: 283.878 bits (725), Expect = 2.735e-108
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 1
Query:  997 KRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            K+FYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG
Sbjct:  354 KKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 489          

HSP 2 Score: 129.798 bits (325), Expect = 2.735e-108
Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 953
            QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK
Sbjct:  297 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 355          

HSP 3 Score: 143.28 bits (360), Expect = 5.297e-35
Identity = 70/78 (89.74%), Postives = 70/78 (89.74%), Query Frame = 1
Query: 2353 NDYIT--GHFISMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQ 2580
            N Y T   H   MRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQ
Sbjct:  478 NTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQ 555          
BLAST of Poly [ADP-ribose] polymerase vs. Planmine SMEST
Match: SMESG000060010.1 (SMESG000060010.1)

HSP 1 Score: 283.878 bits (725), Expect = 2.736e-108
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 1
Query:  997 KRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            K+FYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG
Sbjct:  328 KKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 463          

HSP 2 Score: 129.798 bits (325), Expect = 2.736e-108
Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 953
            QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK
Sbjct:  271 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 329          

HSP 3 Score: 143.665 bits (361), Expect = 4.123e-35
Identity = 70/78 (89.74%), Postives = 70/78 (89.74%), Query Frame = 1
Query: 2353 NDYIT--GHFISMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQ 2580
            N Y T   H   MRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQ
Sbjct:  452 NTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQ 529          
BLAST of Poly [ADP-ribose] polymerase vs. Planmine SMEST
Match: SMESG000067451.1 (SMESG000067451.1)

HSP 1 Score: 283.493 bits (724), Expect = 3.073e-108
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 1
Query:  997 KRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            K+FYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG
Sbjct:  353 KKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 488          

HSP 2 Score: 129.798 bits (325), Expect = 3.073e-108
Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 953
            QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK
Sbjct:  296 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 354          

HSP 3 Score: 138.272 bits (347), Expect = 2.229e-33
Identity = 67/71 (94.37%), Postives = 68/71 (95.77%), Query Frame = 1
Query: 2371 HFISMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQV 2583
            H   MRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQ+
Sbjct:  485 HDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQL 555          
BLAST of Poly [ADP-ribose] polymerase vs. Planmine SMEST
Match: SMESG000067451.1 (SMESG000067451.1)

HSP 1 Score: 283.493 bits (724), Expect = 3.231e-108
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 1
Query:  997 KRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
            K+FYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG
Sbjct:  327 KKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 462          

HSP 2 Score: 129.798 bits (325), Expect = 3.231e-108
Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 953
            QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK
Sbjct:  270 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 328          

HSP 3 Score: 138.272 bits (347), Expect = 1.989e-33
Identity = 67/71 (94.37%), Postives = 68/71 (95.77%), Query Frame = 1
Query: 2371 HFISMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQV 2583
            H   MRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQ+
Sbjct:  459 HDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLINENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQL 529          
BLAST of Poly [ADP-ribose] polymerase vs. Planmine SMEST
Match: SMESG000011115.1 (SMESG000011115.1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.042e-23
Identity = 48/138 (34.78%), Postives = 77/138 (55.80%), Query Frame = 1
Query:  991 LSKRFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKKEILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFG 1404
              K+F DKTKN W +R  F+    +           E+L TN  AS+ K  P  SKL ++ Q L+ ++F     N A++++K D  K+PLG+L++ QI  G+  L E++  +S+ +     L++  + +YT IPHDFG
Sbjct:  120 FDKKFQDKTKNHWDNRDNFKSDEDE---------TSEVLVTNSDASE-KFSP--SKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFG 245          

HSP 2 Score: 46.9802 bits (110), Expect = 2.042e-23
Identity = 25/59 (42.37%), Postives = 35/59 (59.32%), Query Frame = 3
Query:  777 QTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKK 953
            QTN+  NNNK+Y+IQ+++   +  Y+VW RW RVG+ G       YN    A + F KK
Sbjct:   67 QTNIDGNNNKYYVIQMIQYNGK--YFVWTRWGRVGENGATLKLGPYNTKEDAHKQFDKK 123          
The following BLAST results are available for this feature:
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PARP21.905e-4548.20poly(ADP-ribose) polymerase 2 [Source:HGNC Symbol;... [more]
PARP22.523e-4548.20poly(ADP-ribose) polymerase 2 [Source:HGNC Symbol;... [more]
PARP22.717e-4548.20poly(ADP-ribose) polymerase 2 [Source:HGNC Symbol;... [more]
PARP13.436e-2135.77poly(ADP-ribose) polymerase 1 [Source:HGNC Symbol;... [more]
PARP36.603e-1828.67poly(ADP-ribose) polymerase family member 3 [Sourc... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
parp-11.161e-2032.09Poly [ADP-ribose] polymerase 1 [Source:UniProtKB/... [more]
parp-12.603e-736.62Poly [ADP-ribose] polymerase 1 [Source:UniProtKB/... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Parp3.569e-1635.46gene:FBgn0010247 transcript:FBtr0113885[more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
parp26.204e-4246.51poly (ADP-ribose) polymerase 2 [Source:ZFIN;Acc:ZD... [more]
parp26.795e-4246.51poly (ADP-ribose) polymerase 2 [Source:ZFIN;Acc:ZD... [more]
parp22.273e-4146.51poly (ADP-ribose) polymerase 2 [Source:ZFIN;Acc:ZD... [more]
parp22.529e-2843.01poly (ADP-ribose) polymerase 2 [Source:ZFIN;Acc:ZD... [more]
parp16.694e-2036.43poly (ADP-ribose) polymerase 1 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gldn1.497e-4345.26gliomedin [Source:Xenbase;Acc:XB-GENE-1004090][more]
gldn2.428e-4344.93gliomedin [Source:Xenbase;Acc:XB-GENE-1004090][more]
gldn2.469e-4344.93gliomedin [Source:Xenbase;Acc:XB-GENE-1004090][more]
gldn2.524e-4344.93gliomedin [Source:Xenbase;Acc:XB-GENE-1004090][more]
gldn3.479e-4344.93gliomedin [Source:Xenbase;Acc:XB-GENE-1004090][more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Parp26.032e-4847.79poly (ADP-ribose) polymerase family, member 2 [Sou... [more]
Parp11.079e-2035.04poly (ADP-ribose) polymerase family, member 1 [Sou... [more]
Parp34.651e-1829.41poly (ADP-ribose) polymerase family, member 3 [Sou... [more]
Parp37.314e-1829.63poly (ADP-ribose) polymerase family, member 3 [Sou... [more]
Parp38.961e-1829.63poly (ADP-ribose) polymerase family, member 3 [Sou... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O88554|PARP2_MOUSE3.677e-4747.79Poly [ADP-ribose] polymerase 2 OS=Mus musculus OX=... [more]
sp|Q9UGN5|PARP2_HUMAN1.206e-4448.20Poly [ADP-ribose] polymerase 2 OS=Homo sapiens OX=... [more]
sp|Q5Z8Q9|PRP2A_ORYSJ1.686e-2434.07Poly [ADP-ribose] polymerase 2-A OS=Oryza sativa s... [more]
sp|O50017|PARP2_MAIZE9.035e-2433.82Poly [ADP-ribose] polymerase 2 OS=Zea mays OX=4577... [more]
sp|Q11207|PARP2_ARATH1.320e-2329.79Poly [ADP-ribose] polymerase 2 OS=Arabidopsis thal... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3B4XBC11.992e-4750.74Poly [ADP-ribose] polymerase OS=Seriola lalandi do... [more]
A0A2U9BIV26.899e-4752.17Poly [ADP-ribose] polymerase OS=Scophthalmus maxim... [more]
A0A340XU051.011e-4650.36Poly [ADP-ribose] polymerase OS=Lipotes vexillifer... [more]
A0A3B4TRT71.044e-4650.00Poly [ADP-ribose] polymerase OS=Seriola dumerili O... [more]
A0A340XMH81.117e-4650.36Poly [ADP-ribose] polymerase OS=Lipotes vexillifer... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
parp29.250e-5049.64poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Ac... [more]
parp23.099e-4949.64poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Ac... [more]
parp39.947e-2133.80poly(ADP-ribose) polymerase family member 3 [Sourc... [more]
parp31.114e-2033.80poly(ADP-ribose) polymerase family member 3 [Sourc... [more]
parp31.185e-2033.80poly(ADP-ribose) polymerase family member 3 [Sourc... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000003213.15.800e-760.61pep scaffold:Pmarinus_7.0:GL484848:6623:9574:1 gen... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO263454.547e-3549.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO464808.002e-2934.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468122.392e-1632.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO299765.376e-734.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
parp25.287e-4848.53poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Ac... [more]
parp21.738e-4747.79poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Ac... [more]
parp21.782e-4747.79poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Ac... [more]
parp31.667e-2230.83poly(ADP-ribose) polymerase family member 3 [Sourc... [more]
parp12.018e-1732.37poly(ADP-ribose) polymerase 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060010.12.735e-10899.26SMESG000060010.1[more]
SMESG000060010.12.736e-10899.26SMESG000060010.1[more]
SMESG000067451.13.073e-10899.26SMESG000067451.1[more]
SMESG000067451.13.231e-10899.26SMESG000067451.1[more]
SMESG000011115.12.042e-2334.78SMESG000011115.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020704 ID=SMED30020704|Name=Poly [ADP-ribose] polymerase|organism=Schmidtea mediterranea sexual|type=transcript|length=2724bp
ATAAAATAAAATAAAATAAAATAATAAATTTAGCGGTATTTTTCATAGCA
TGGAAATATTTTTAAAAATTACAAAATAAATATTTAAAAATGAAAATAAA
TAATATTTTTAGCGGTATTTTTTCATCGAAAAAAAAATTACTAAACAATA
ATTAAAATAAAAATATTAAAAAATTAAAATATAAATTTATATATTTCGTT
AATAAAATTTACAAAATTTAACGAATAATTTATAATAATTAAACAAATAA
TAATAATTTTATAATATTAATAATTTAATTTATATTTTTAATAATTAAAA
ATAATATTAATTATAATATTATTAATTAAATTAATTTTTTTAATAATTAA
AAAATAATATAAATACAATAATTTTAAAATATTATAATTAATATTAATAA
TAATTATATTTATAATAATAATATTAATTTTATTATTTCTTGATCACTAG
AATTACTAACACGGTCACAGATAGAATCGTTTATTAATCACTAATTTTGC
TATCTTAATTTTTATTATTCGATAACTTTCAATTTGTGCTATTAATCTGA
AAATGAGCAGTATTAATTTACAAAATACAGCAGTAATAAAAACAGAATAA
TAATAATCTCCAGTCATCACAAGACCTTAAACTACAAAACTGAGACCAGC
AACCAAGAATATTTTTTATATTTAGTGCTCAAGTAAGTAAAATAAGAGAT
CAAAAAACCGCCAATCATAATAATAATTATAATAATGCTAATACTAAATG
ATAAAAGTTATATCAGAAAAAAATTTCAGACCAATTTGCAGTTCAATAAC
AACAAATTTTACATAATTCAACTGTTAAAAGATGAAAAAGAACCAATTTA
CTACGTTTGGATGAGATGGGCCCGTGTAGGGAAAATCGGCCAAATGAAAT
TAACTAGATTTTATAACAACCTTGCCGCTGCCAAAGAGTGCTTCATGAAA
AAGTTAAGCAGTTAATAAACTTATCCTTCTAATAATAAATCTATCAAAAA
GGTTCTACGATAAAACGAAAAATGACTGGCAAGATCGTCAGAAATTTGAG
AAAATAAATGGCAAATATGATCTTGTACAGATTGATTACTGTAAAAAGGA
AATTCTGGAAACGAATAAAATAGCGAGCCAAGTTAAATTAGAACCGATTG
AAAGTAAATTAGAAGAAAAATTACAAGATCTTATGCGAATTGTCTTTGAT
TTGAAAGAAATGAATGATGCAGTGTCGGAAATGAAATATGATAATAATAA
GGTGCCACTTGGACGCCTGACTGAGGCACAGATCAAAGCTGGTTATCTAG
CTCTCCGAGAAATCGAAGGATTGTTGAGTGAGGGGCATTCTAGCAATAAA
TCGTTAGTCCAGGCGTGCAACACGTATTACACTAGAATACCGCACGATTT
CGGGTAAATCAATTATTATTAATATCCTTTCAATATCAATTTAATAGTTA
TCAATTCAAATAAATAGGTTTTGTTGTAGGTAAAAAAATTTCATTTAATA
AACAGAGCGGAAATGACTTTTACCTATTTATTAATTTGAATTATATTTCT
ATAAATAATTCTGCTATCGACAAATTATTTTAAAGTTTAATTATCTAATT
ATTTACCATCGACCAAAATTGACAATAATAATTTAAATTGATAATAAAAT
AATTCATTTATTTAAAATAAGTAAAAATAAAATTTAAGCTTTAATCTTAA
TGAAAATGAACGAATTGATAAAAACTTGAATAGATCGAAAGTTAAACAAA
AGTATGAAGAATATGCTAATTAATATTCTTTGAAAAATTCCTTTTAAAAT
ATCAAATATACAATGCATTTTTTATTTTCATAATAAAACTAATCTATTAA
ATGTAGTTGACTTTTTATGTGGCTTGTCTGCCTTCAAAACATTGACCACG
TGTCCCAGATATTGCAAATGGTAAAACACCTGTTTTAGGTAGTAGGAAAT
CTTTTGGAAATTTATATAGTGAACGCAACAAATTTTCAGGAAATTATCGA
TTTTTCCCCATTTTCGCAGTGACCTACTAGATAGTTTTCCAAATAATTTC
AGTTAGGCACAATTAATAATTCTTAACAGGATTTTTAAAAAATTTACAGA
TTTTCACTTCTTGCACAAATATTTCTTAAAAGATCATTAGAAATATTTCT
TACAAAGTTTTCAGTTAGTCACGTGAAATAATAGATATATGTTAAGTAAA
TTATACAGTTATATTACACCTGAATTACGTGTTACTAATAATAAACGTGC
TATCTGATGCATGAAACTTCTCTCTAATAACCATTTATTCATAGCCTTTG
ACGTATTATTTTTATCCTACTTGATGGTATCTGTTATATGAATTCGTTTA
TAAATGATTATATAACGGGGCATTTTATTAGCATGAGAATTCCACCTCTC
ATACGATCCATATCAGAAATTAAAAGAGAACTGGAGTTATTGGAAACGTT
AAGCGACATAAAGATTGCGCTGAAGCTCATCAATGAAAATGAAGATGTAC
ATGTTCATCCTCTAGACCGCCATTACCAAAATCTTCATTGTATTATTAAT
TTAGTTACAATCGATAATCCGATTTATCAGGTAAATTTTTTAAAGAATTA
TTTTTATTTAATATCGTTTTTCAAAAAAAACTTTATTTTGAAAATCGTTA
TTTAATAACCAATCACATAAATAATTTAAATATGTGCCGAAATATTTTAA
AAATCTCAAATCCCCGCGCTATGT
back to top

protein sequence of SMED30020704-orf-1

>SMED30020704-orf-1 ID=SMED30020704-orf-1|Name=SMED30020704-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=106bp
MNSFINDYITGHFISMRIPPLIRSISEIKRELELLETLSDIKIALKLINE
NEDVHVHPLDRHYQNLHCIINLVTIDNPIYQVNFLKNYFYLISFFKKNFI
LKIVI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036616Poly(ADP-ribose)pol_reg_dom_sf
IPR008893WGR_domain
IPR004102Poly(ADP-ribose)pol_reg_dom
Vocabulary: molecular function
TermDefinition
GO:0003950NAD+ ADP-ribosyltransferase activity
GO:0003910DNA ligase (ATP) activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
Vocabulary: biological process
TermDefinition
GO:0006471protein ADP-ribosylation
GO:0006273lagging strand elongation
GO:0051103DNA ligation involved in DNA repair
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004102Poly(ADP-ribose) polymerase, regulatory domainPFAMPF02877PARP_regcoord: 12..63
e-value: 1.5E-10
score: 41.3
IPR004102Poly(ADP-ribose) polymerase, regulatory domainPROSITEPS51060PARP_ALPHA_HDcoord: 1..49
score: 10.329
IPR036616Poly(ADP-ribose) polymerase, regulatory domain superfamilyGENE3DG3DSA:1.20.142.10coord: 6..66
e-value: 1.6E-12
score: 49.3
IPR036616Poly(ADP-ribose) polymerase, regulatory domain superfamilySUPERFAMILYSSF47587Domain of poly(ADP-ribose) polymerasecoord: 12..64
NoneNo IPR availablePANTHERPTHR10459DNA LIGASEcoord: 13..82