Long-chain specific acyl-CoA dehydrogenase

Overview
NameLong-chain specific acyl-CoA dehydrogenase
Smed IDSMED30020701
Length (bp)2885
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Long-chain specific acyl-CoA dehydrogenase (SMED30020701) t-SNE clustered cells

Violin plots show distribution of expression levels for Long-chain specific acyl-CoA dehydrogenase (SMED30020701) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Long-chain specific acyl-CoA dehydrogenase (SMED30020701) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Long-chain specific acyl-CoA dehydrogenase (SMED30020701) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020701

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 51

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30020701SMESG000073618.1 SMESG000073174.1 SMESG000059623.1 SMESG000050300.1 SMESG000040932.1 SMESG000025201.1 SMESG000006554.1 SMESG000079557.1 SMESG000069853.1 SMESG000050880.1 SMESG000043279.1 SMESG000028068.1 SMESG000018675.1 SMESG000018320.1 SMESG000016710.1 SMESG000016088.1 SMESG000005066.1 SMESG000002984.1 SMESG000081574.1 SMESG000081529.1 SMESG000078601.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000072739.1 SMESG000071859.1 SMESG000071198.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000062504.1 SMESG000060952.1 SMESG000060260.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000047126.1 SMESG000044971.1 SMESG000043973.1 SMESG000040474.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029537.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000015216.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000007021.1 SmedASXL_018089SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30020701SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021640.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000017296.1 SMESG000017295.1 SMESG000017294.1 SMESG000018675.1 Contig18951uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020701SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021640.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000017296.1 SMESG000017295.1 SMESG000017294.1 SMESG000018675.1 Contig18951newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020701SMESG000081574.1 SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000069110.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000018675.1 Contig48540newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020701SMESG000081574.1 SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000069110.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000018675.1 Contig48540uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020701SMESG000023007.1 Contig4612GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020701SMESG000081273.1 Contig4612GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020701SMESG000080919.1 SMESG000077556.1 SMESG000073961.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000052524.1 SMESG000044971.1 SMESG000043973.1 SMESG000042719.1 SMESG000039356.1 SMESG000021640.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000064571.1 Contig20236newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020701SMESG000080919.1 SMESG000077556.1 SMESG000073961.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000052524.1 SMESG000044971.1 SMESG000043973.1 SMESG000042719.1 SMESG000039356.1 SMESG000021640.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000064571.1 Contig20236uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020701SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000021640.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000003705.1 SMESG000018675.1 Contig15583uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020701SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000021640.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000003705.1 SMESG000018675.1 Contig15583newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020701SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000077813.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000068262.1 SMESG000067334.1 SMESG000064992.1 SMESG000064086.1 SMESG000060260.1 SMESG000050492.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000026762.1 SMESG000025022.1 SMESG000021640.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000012464.1 SMESG000011816.1 SMESG000007021.1 SMESG000000031.1 SMESG000070487.1 SMESG000068881.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000008519.1 SMESG000005066.1 Contig40604newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020701SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000077813.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000068262.1 SMESG000067334.1 SMESG000064992.1 SMESG000064086.1 SMESG000060260.1 SMESG000050492.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000026762.1 SMESG000025022.1 SMESG000021640.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000012464.1 SMESG000011816.1 SMESG000007021.1 SMESG000000031.1 SMESG000070487.1 SMESG000068881.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000008519.1 SMESG000005066.1 Contig40604uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020701SMESG000081574.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000019776.1 SMESG000019761.1 SMESG000018320.1 SMESG000015216.1 SMESG000012464.1 SMESG000010348.1 SMESG000010333.1 SMESG000010322.1 SMESG000007021.1 SMESG000056926.1 Contig15760uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020701SMESG000081574.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000019776.1 SMESG000019761.1 SMESG000018320.1 SMESG000015216.1 SMESG000012464.1 SMESG000010348.1 SMESG000010333.1 SMESG000010322.1 SMESG000007021.1 SMESG000056926.1 Contig15760newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020701SMESG000081529.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000041949.1 SMESG000041948.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000012464.1 SMESG000007021.1 SMESG000025201.1 Contig17437newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020701SMESG000081529.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000041949.1 SMESG000041948.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000012464.1 SMESG000007021.1 SMESG000025201.1 Contig17437uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020701SMESG000081574.1 SMESG000081529.1 SMESG000080770.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000065333.1 SMESG000060260.1 SMESG000059844.1 SMESG000058646.1 SMESG000055266.1 SMESG000054970.1 SMESG000052813.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000043769.1 SMESG000043147.1 SMESG000041246.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000037745.1 SMESG000037601.1 SMESG000036070.1 SMESG000034368.1 SMESG000033763.1 SMESG000031415.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000019663.1 SMESG000018320.1 SMESG000015216.1 SMESG000012464.1 SMESG000010897.1 SMESG000010825.1 SMESG000009005.1 SMESG000007021.1 SMESG000005029.1 SMESG000077800.1 SMESG000054046.1 SMESG000052058.1 SMESG000025201.1 Contig34191uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020701SMESG000081574.1 SMESG000081529.1 SMESG000080770.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000065333.1 SMESG000060260.1 SMESG000059844.1 SMESG000058646.1 SMESG000055266.1 SMESG000054970.1 SMESG000052813.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000043769.1 SMESG000043147.1 SMESG000041246.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000037745.1 SMESG000037601.1 SMESG000036070.1 SMESG000034368.1 SMESG000033763.1 SMESG000031415.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000019663.1 SMESG000018320.1 SMESG000015216.1 SMESG000012464.1 SMESG000010897.1 SMESG000010825.1 SMESG000009005.1 SMESG000007021.1 SMESG000005029.1 SMESG000077800.1 SMESG000054046.1 SMESG000052058.1 SMESG000025201.1 Contig34191newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30020701SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020701SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020701SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30020701SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30020701SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020701SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020701SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30020701SMESG000081273.1 SMESG000081269.1 dd_Smed_v4_1458_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020701SMESG000039741.1 Contig12688uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020701SMESG000039741.1 Contig12688newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020701SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000067334.1 SMESG000060260.1 SMESG000039792.1 SMESG000039741.1 SMESG000033763.1 SMESG000026649.1 SMESG000021640.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000056926.1 SMESG000018675.1 Contig13423uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020701SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000067334.1 SMESG000060260.1 SMESG000039792.1 SMESG000039741.1 SMESG000033763.1 SMESG000026649.1 SMESG000021640.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000056926.1 SMESG000018675.1 Contig13423newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020701SMESG000081574.1 SMESG000079557.1 SMESG000077813.1 SMESG000077556.1 SMESG000073961.1 SMESG000073852.1 SMESG000073851.1 SMESG000073618.1 SMESG000071859.1 SMESG000071073.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015102.1 SMESG000012464.1 SMESG000007021.1 SMESG000068881.1 SMESG000056926.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000005066.1 Contig11477uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020701SMESG000081574.1 SMESG000079557.1 SMESG000077813.1 SMESG000077556.1 SMESG000073961.1 SMESG000073852.1 SMESG000073851.1 SMESG000073618.1 SMESG000071859.1 SMESG000071073.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015102.1 SMESG000012464.1 SMESG000007021.1 SMESG000068881.1 SMESG000056926.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000005066.1 Contig11477newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30020701SMESG000073618.1 SMESG000073174.1 SMESG000059623.1 SMESG000050300.1 SMESG000040932.1 SMESG000025201.1 SMESG000006554.1 SMESG000079557.1 SMESG000069853.1 SMESG000050880.1 SMESG000043279.1 SMESG000028068.1 SMESG000018675.1 SMESG000018320.1 SMESG000016710.1 SMESG000016088.1 SMESG000005066.1 SMESG000002984.1 SMESG000081574.1 SMESG000081529.1 SMESG000078601.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000072739.1 SMESG000071859.1 SMESG000071198.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000062504.1 SMESG000060952.1 SMESG000060260.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000047126.1 SMESG000044971.1 SMESG000043973.1 SMESG000040474.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029537.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000015216.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000007021.1 SMED30032823smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30020701SMESG000073618.1 SMESG000073174.1 SMESG000059623.1 SMESG000050300.1 SMESG000040932.1 SMESG000025201.1 SMESG000006554.1 SMESG000079557.1 SMESG000069853.1 SMESG000050880.1 SMESG000043279.1 SMESG000028068.1 SMESG000018675.1 SMESG000018320.1 SMESG000016710.1 SMESG000016088.1 SMESG000005066.1 SMESG000002984.1 SMESG000081574.1 SMESG000081529.1 SMESG000078601.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000072739.1 SMESG000071859.1 SMESG000071198.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000062504.1 SMESG000060952.1 SMESG000060260.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000047126.1 SMESG000044971.1 SMESG000043973.1 SMESG000040474.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029537.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000015216.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000007021.1 SMED30032823smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30020701SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30020701SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30020701SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30020701SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020701SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30020701SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021640.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000017296.1 SMESG000017295.1 SMESG000017294.1 SMESG000018675.1 Contig18951uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30020701SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021640.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000017296.1 SMESG000017295.1 SMESG000017294.1 SMESG000018675.1 Contig18951newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30020701SMESG000073618.1 SMESG000018675.1 SMESG000081574.1 SMESG000077556.1 SMESG000073961.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 Contig55788newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30020701SMESG000073618.1 SMESG000018675.1 SMESG000081574.1 SMESG000077556.1 SMESG000073961.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 Contig55788newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30020701SMESG000073618.1 SMESG000018675.1 SMESG000081574.1 SMESG000077556.1 SMESG000073961.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 Contig55788uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30020701SMESG000073618.1 SMESG000018675.1 SMESG000081574.1 SMESG000077556.1 SMESG000073961.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 Contig55788uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30020701SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000053120.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021640.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000018675.1 Contig20396newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30020701SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000053120.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021640.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000018675.1 Contig20396uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30020701SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000065669.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 SMESG000025201.1 Contig12382newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30020701SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000065669.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 SMESG000025201.1 Contig12382uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30020701SMESG000081273.1 SMESG000081269.1 dd_Smed_v4_1458_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Human
Match: ACADL (acyl-CoA dehydrogenase long chain [Source:HGNC Symbol;Acc:HGNC:88])

HSP 1 Score: 160.999 bits (406), Expect = 6.855e-42
Identity = 70/104 (67.31%), Postives = 85/104 (81.73%), Query Frame = 1
Query: 2458 YFQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            + QT+QHKLAE+KT IC +R+FVD+CL L  + +LD+ TA MAKY+ S+L N + YD VQLHGGWGYMW+YP+ K+YVDARVQ IYGG NEIMKELIAR IV D
Sbjct:  326 HLQTVQHKLAELKTHICVTRAFVDNCLQLHEAKRLDSATACMAKYWASELQNSVAYDCVQLHGGWGYMWEYPIAKAYVDARVQPIYGGTNEIMKELIAREIVFD 429          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Human
Match: ACAD8 (acyl-CoA dehydrogenase family member 8 [Source:HGNC Symbol;Acc:HGNC:87])

HSP 1 Score: 74.7146 bits (182), Expect = 7.375e-14
Identity = 39/103 (37.86%), Postives = 62/103 (60.19%), Query Frame = 1
Query: 2464 QTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDT-QTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            Q +Q  LA+M T +  +R  V +  + L   + D     SMAK + +D    IC  A+Q+HGG+GY+ DY V +   D+RV  I  G+NE+M+ LI+RS++++
Sbjct:  186 QYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVALCSMAKLFATDECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE 288          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Human
Match: ACAD8 (acyl-CoA dehydrogenase family member 8 [Source:HGNC Symbol;Acc:HGNC:87])

HSP 1 Score: 74.7146 bits (182), Expect = 2.896e-13
Identity = 39/103 (37.86%), Postives = 62/103 (60.19%), Query Frame = 1
Query: 2464 QTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDT-QTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            Q +Q  LA+M T +  +R  V +  + L   + D     SMAK + +D    IC  A+Q+HGG+GY+ DY V +   D+RV  I  G+NE+M+ LI+RS++++
Sbjct:  313 QYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVALCSMAKLFATDECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE 415          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Human
Match: ACADSB (acyl-CoA dehydrogenase short/branched chain [Source:HGNC Symbol;Acc:HGNC:91])

HSP 1 Score: 71.633 bits (174), Expect = 1.417e-12
Identity = 37/100 (37.00%), Postives = 57/100 (57.00%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSI 2760
            FQ +QH++A + T +  +R    +   LL + K   + ASMAKYY S++  +     ++  GG GY  DYPV K + DA++ +IY GA+ I    IA+ I
Sbjct:  227 FQGLQHQVAHVATQLEAARLLTYNAARLLEAGKPFIKEASMAKYYASEIAGQTTSKCIEWMGGVGYTKDYPVEKYFRDAKIGTIYEGASNIQLNTIAKHI 326          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Human
Match: ACADSB (acyl-CoA dehydrogenase short/branched chain [Source:HGNC Symbol;Acc:HGNC:91])

HSP 1 Score: 71.2478 bits (173), Expect = 3.207e-12
Identity = 37/100 (37.00%), Postives = 57/100 (57.00%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSI 2760
            FQ +QH++A + T +  +R    +   LL + K   + ASMAKYY S++  +     ++  GG GY  DYPV K + DA++ +IY GA+ I    IA+ I
Sbjct:  329 FQGLQHQVAHVATQLEAARLLTYNAARLLEAGKPFIKEASMAKYYASEIAGQTTSKCIEWMGGVGYTKDYPVEKYFRDAKIGTIYEGASNIQLNTIAKHI 428          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Celegans
Match: acdh-9 (Acyl CoA DeHydrogenase [Source:UniProtKB/TrEMBL;Acc:Q95YB2])

HSP 1 Score: 62.7734 bits (151), Expect = 5.935e-10
Identity = 37/102 (36.27%), Postives = 56/102 (54.90%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLL-NSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIV 2763
            FQ  Q KLAE+ T +  SR  V +    L N +       +MAK + +D    +   A+Q+ GG+G++ DYPV +   D RV  I  G NE+M+ LI+R ++
Sbjct:  300 FQYNQFKLAELATKLYTSRLIVRNAAEQLDNDDPEKVALCAMAKLHATDNCFDVVNGALQMFGGYGFLKDYPVQQYLRDIRVHQILEGTNEMMRLLISRDLL 401          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Celegans
Match: ivd-1 (Isovaleryl-CoA dehydrogenase [Source:UniProtKB/TrEMBL;Acc:G5EEH6])

HSP 1 Score: 61.2326 bits (147), Expect = 1.973e-9
Identity = 31/103 (30.10%), Postives = 57/103 (55.34%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            FQ +Q KLA+M T +  SRS++       +   +  +  +    Y ++   ++C DA+Q+ GG GY+ DYP  +   DA++  I  G +E+ + +I R++ K+
Sbjct:  314 FQLLQGKLADMYTTLNASRSYLYMVAKAADKGNVSNKDCAGVILYVAEKCTQVCLDAIQILGGNGYINDYPAGRLLRDAKLYEIGAGTSEVRRLIIGRALNKE 416          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Celegans
Match: ivd-1 (Isovaleryl-CoA dehydrogenase [Source:UniProtKB/TrEMBL;Acc:G5EEH6])

HSP 1 Score: 61.2326 bits (147), Expect = 1.973e-9
Identity = 31/103 (30.10%), Postives = 57/103 (55.34%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            FQ +Q KLA+M T +  SRS++       +   +  +  +    Y ++   ++C DA+Q+ GG GY+ DYP  +   DA++  I  G +E+ + +I R++ K+
Sbjct:  314 FQLLQGKLADMYTTLNASRSYLYMVAKAADKGNVSNKDCAGVILYVAEKCTQVCLDAIQILGGNGYINDYPAGRLLRDAKLYEIGAGTSEVRRLIIGRALNKE 416          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Celegans
Match: acdh-8 (Acyl CoA DeHydrogenase [Source:UniProtKB/TrEMBL;Acc:Q21243])

HSP 1 Score: 58.151 bits (139), Expect = 1.658e-8
Identity = 31/102 (30.39%), Postives = 56/102 (54.90%), Query Frame = 1
Query: 2464 QTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            Q +Q  +A+M   +  SR F       ++S  + +  AS+AK + +D  N    +A Q+ GG G+  +YPV K   DA++  IY G ++I + +I R++ ++
Sbjct:  301 QGVQFMIADMAINLELSRLFTYRAAAEVDSYGVSSYNASIAKCFAADTANVAATNACQIFGGAGFNCEYPVEKLMRDAKIYQIYEGTSQIQRMVIGRTLFQN 402          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Celegans
Match: acdh-7 (Acyl CoA DeHydrogenase [Source:UniProtKB/TrEMBL;Acc:Q22781])

HSP 1 Score: 56.225 bits (134), Expect = 8.119e-8
Identity = 31/100 (31.00%), Postives = 53/100 (53.00%), Query Frame = 1
Query: 2464 QTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIV 2763
            Q +   LAEM      +R         +++ +  +  AS+AK + SD  N+   +AVQ+ GG G+  +YP  K   DA++  IY G ++I + +IAR ++
Sbjct:  304 QGVSFLLAEMAINCELARLMTYKSGAEVDAGRPGSYYASIAKLFASDTANQAATNAVQIFGGAGFNTEYPAEKLMRDAKIFQIYEGTSQIQRMVIARQLL 403          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Fly
Match: Mcad (gene:FBgn0035811 transcript:FBtr0076808)

HSP 1 Score: 64.3142 bits (155), Expect = 2.543e-10
Identity = 35/101 (34.65%), Postives = 59/101 (58.42%), Query Frame = 1
Query: 2458 YFQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSI 2760
            Y Q +Q  LA+M   +  SR         ++  + ++  AS+AK + +D+ NKI  DAVQ+ GG G+  +YPV K   DA++  IY G ++I + +I+R++
Sbjct:  311 YHQAVQFMLADMAIGVETSRLAWRLSAWEIDQGRRNSYYASIAKCHAADMANKIASDAVQIFGGNGFNSEYPVEKLMRDAKIYQIYEGTSQIQRLIISRNM 411          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Fly
Match: CG4860 (gene:FBgn0037999 transcript:FBtr0082623)

HSP 1 Score: 61.6178 bits (148), Expect = 1.834e-9
Identity = 35/103 (33.98%), Postives = 55/103 (53.40%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
             Q IQ KLA+M T +  SR        L ++    T+ A+MAK + S+      +  +Q+ GG GY  D P    Y +ARV  IY G +EI + +IA +++++
Sbjct:  309 LQLIQQKLADMATRVEISRLLTWRAAWLKDNGLPITKEAAMAKLHASESATFCAHQCIQILGGMGYTTDLPAELYYRNARVTEIYEGTSEIQRIVIANAVLRE 411          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Fly
Match: Arc42 (gene:FBgn0038742 transcript:FBtr0083817)

HSP 1 Score: 61.6178 bits (148), Expect = 1.983e-9
Identity = 35/103 (33.98%), Postives = 56/103 (54.37%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
             Q+IQ K+A+M  A+  +R        L +  +  T+ A+MAK   S+      +  +Q+ GG GY+ D    + Y DAR+  IY G +EI + +IA SI+K+
Sbjct:  300 LQSIQQKIADMSLAMESARLLTWRAAWLKDQKQPYTKEAAMAKLAASEAATLCSHQCIQILGGMGYVTDMAAERHYRDARITEIYEGTSEIQRLVIAGSILKE 402          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Fly
Match: CG3902 (gene:FBgn0036824 transcript:FBtr0075076)

HSP 1 Score: 60.077 bits (144), Expect = 4.873e-9
Identity = 36/109 (33.03%), Postives = 56/109 (51.38%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQ------TASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            FQ++QH++A + T I  +R      L+  N+ +L  Q       A+MAKYY S++  +     V   GG G+  D+P  K Y D ++ +IY G   +    IA+ I KD
Sbjct:  309 FQSMQHQIATVATEIEAAR------LMTYNAARLQEQGVPFQKEAAMAKYYASEVAQRAAIKCVDWMGGVGFTRDFPQEKYYRDVKIGAIYEGTTNMQLSTIAKCIKKD 411          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Fly
Match: CG6638 (gene:FBgn0035911 transcript:FBtr0076651)

HSP 1 Score: 53.5286 bits (127), Expect = 5.896e-7
Identity = 29/103 (28.16%), Postives = 54/103 (52.43%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            FQ +Q K+A+M T +   RS++       ++     +  +    YT++   K+  DA+Q+ GG GY+ + P  +   DA++  I  G +EI + LI R + ++
Sbjct:  316 FQLLQGKMADMYTTLSACRSYLYTVARSCDAGNRSPKDCAGVILYTAEKATKVALDAIQILGGNGYINENPTGRILRDAKLYEIGAGTSEIRRWLIGRQLNQE 418          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Zebrafish
Match: acadl (acyl-CoA dehydrogenase long chain [Source:ZFIN;Acc:ZDB-GENE-040426-771])

HSP 1 Score: 150.214 bits (378), Expect = 2.286e-38
Identity = 63/101 (62.38%), Postives = 80/101 (79.21%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIV 2763
             Q +QHKLAE+KT IC  R+F+D CL L +  KLD+ TASMAKY+ +DL N++    +QLHGGWGYMW+YP+ K++ DARVQ IYGG NEIMKELI+R+IV
Sbjct:  339 LQVVQHKLAELKTEICVGRAFIDSCLQLHSEKKLDSSTASMAKYWATDLQNRVATQCLQLHGGWGYMWEYPIAKAFADARVQPIYGGTNEIMKELISRNIV 439          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Zebrafish
Match: acadl (acyl-CoA dehydrogenase long chain [Source:ZFIN;Acc:ZDB-GENE-040426-771])

HSP 1 Score: 150.214 bits (378), Expect = 2.286e-38
Identity = 63/101 (62.38%), Postives = 80/101 (79.21%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIV 2763
             Q +QHKLAE+KT IC  R+F+D CL L +  KLD+ TASMAKY+ +DL N++    +QLHGGWGYMW+YP+ K++ DARVQ IYGG NEIMKELI+R+IV
Sbjct:  339 LQVVQHKLAELKTEICVGRAFIDSCLQLHSEKKLDSSTASMAKYWATDLQNRVATQCLQLHGGWGYMWEYPIAKAFADARVQPIYGGTNEIMKELISRNIV 439          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Zebrafish
Match: acad8 (acyl-CoA dehydrogenase family, member 8 [Source:ZFIN;Acc:ZDB-GENE-040426-828])

HSP 1 Score: 79.7221 bits (195), Expect = 4.113e-15
Identity = 43/103 (41.75%), Postives = 60/103 (58.25%), Query Frame = 1
Query: 2464 QTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQT-ASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            Q +Q KLAEM T +  SR  V    L L   + D  +  SMAK + +D    IC  A+Q+HGG+GY+ DY V +   D RV  I  G NE+M+ +IARS++ +
Sbjct:  315 QFLQFKLAEMATKLVASRLLVRQAALALQDGRPDAVSLCSMAKLFVTDECFSICNQALQIHGGYGYLKDYAVQQYVRDIRVHQILEGTNEVMRMIIARSLLTE 417          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Zebrafish
Match: acad8 (acyl-CoA dehydrogenase family, member 8 [Source:ZFIN;Acc:ZDB-GENE-040426-828])

HSP 1 Score: 79.7221 bits (195), Expect = 4.113e-15
Identity = 43/103 (41.75%), Postives = 60/103 (58.25%), Query Frame = 1
Query: 2464 QTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQT-ASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            Q +Q KLAEM T +  SR  V    L L   + D  +  SMAK + +D    IC  A+Q+HGG+GY+ DY V +   D RV  I  G NE+M+ +IARS++ +
Sbjct:  315 QFLQFKLAEMATKLVASRLLVRQAALALQDGRPDAVSLCSMAKLFVTDECFSICNQALQIHGGYGYLKDYAVQQYVRDIRVHQILEGTNEVMRMIIARSLLTE 417          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Zebrafish
Match: acads (acyl-CoA dehydrogenase short chain [Source:ZFIN;Acc:ZDB-GENE-040808-64])

HSP 1 Score: 73.9442 bits (180), Expect = 2.391e-13
Identity = 40/103 (38.83%), Postives = 59/103 (57.28%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
             Q IQ KLA+M  AI  +R       LL ++ K  T+ A+MAK   S+      + A+Q+ GG GY+ D P  + Y DAR+  IY G +EI + +IA +I+K+
Sbjct:  300 LQAIQFKLADMAVAIESARLLTWKAALLRDAKKPFTKEAAMAKLAASEAATFASHQAIQVLGGMGYVTDMPAERHYRDARITEIYEGTSEIQRLVIANNILKE 402          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Xenopus
Match: ppp3r1 (protein phosphatase 3 regulatory subunit B, alpha [Source:Xenbase;Acc:XB-GENE-948794])

HSP 1 Score: 157.147 bits (396), Expect = 8.026e-41
Identity = 68/104 (65.38%), Postives = 83/104 (79.81%), Query Frame = 1
Query: 2458 YFQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            + QT+QHKLAE+KT IC  R+F+D+CL L    +LD+ TASMAKY+ SDL N +    VQLHGGWGYMW+YP+ K+YVD+RVQ IYGG NEIMKELIAR IVK+
Sbjct:  300 HLQTVQHKLAELKTQICIGRTFLDNCLQLHAEKRLDSATASMAKYWASDLQNSVATQCVQLHGGWGYMWEYPIAKAYVDSRVQPIYGGTNEIMKELIARDIVKE 403          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Xenopus
Match: ppp3r1 (protein phosphatase 3 regulatory subunit B, alpha [Source:Xenbase;Acc:XB-GENE-948794])

HSP 1 Score: 156.762 bits (395), Expect = 9.887e-41
Identity = 68/104 (65.38%), Postives = 83/104 (79.81%), Query Frame = 1
Query: 2458 YFQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            + QT+QHKLAE+KT IC  R+F+D+CL L    +LD+ TASMAKY+ SDL N +    VQLHGGWGYMW+YP+ K+YVD+RVQ IYGG NEIMKELIAR IVK+
Sbjct:  305 HLQTVQHKLAELKTQICIGRTFLDNCLQLHAEKRLDSATASMAKYWASDLQNSVATQCVQLHGGWGYMWEYPIAKAYVDSRVQPIYGGTNEIMKELIARDIVKE 408          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Xenopus
Match: ppp3r1 (protein phosphatase 3 regulatory subunit B, alpha [Source:Xenbase;Acc:XB-GENE-948794])

HSP 1 Score: 157.532 bits (397), Expect = 1.239e-40
Identity = 68/104 (65.38%), Postives = 83/104 (79.81%), Query Frame = 1
Query: 2458 YFQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            + QT+QHKLAE+KT IC  R+F+D+CL L    +LD+ TASMAKY+ SDL N +    VQLHGGWGYMW+YP+ K+YVD+RVQ IYGG NEIMKELIAR IVK+
Sbjct:  340 HLQTVQHKLAELKTQICIGRTFLDNCLQLHAEKRLDSATASMAKYWASDLQNSVATQCVQLHGGWGYMWEYPIAKAYVDSRVQPIYGGTNEIMKELIARDIVKE 443          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Xenopus
Match: ppp3r1 (protein phosphatase 3 regulatory subunit B, alpha [Source:Xenbase;Acc:XB-GENE-948794])

HSP 1 Score: 156.762 bits (395), Expect = 1.517e-40
Identity = 68/104 (65.38%), Postives = 83/104 (79.81%), Query Frame = 1
Query: 2458 YFQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            + QT+QHKLAE+KT IC  R+F+D+CL L    +LD+ TASMAKY+ SDL N +    VQLHGGWGYMW+YP+ K+YVD+RVQ IYGG NEIMKELIAR IVK+
Sbjct:  320 HLQTVQHKLAELKTQICIGRTFLDNCLQLHAEKRLDSATASMAKYWASDLQNSVATQCVQLHGGWGYMWEYPIAKAYVDSRVQPIYGGTNEIMKELIARDIVKE 423          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Xenopus
Match: ppp3r1 (protein phosphatase 3 regulatory subunit B, alpha [Source:Xenbase;Acc:XB-GENE-948794])

HSP 1 Score: 156.377 bits (394), Expect = 2.592e-40
Identity = 68/104 (65.38%), Postives = 83/104 (79.81%), Query Frame = 1
Query: 2458 YFQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            + QT+QHKLAE+KT IC  R+F+D+CL L    +LD+ TASMAKY+ SDL N +    VQLHGGWGYMW+YP+ K+YVD+RVQ IYGG NEIMKELIAR IVK+
Sbjct:  328 HLQTVQHKLAELKTQICIGRTFLDNCLQLHAEKRLDSATASMAKYWASDLQNSVATQCVQLHGGWGYMWEYPIAKAYVDSRVQPIYGGTNEIMKELIARDIVKE 431          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Mouse
Match: Acadl (acyl-Coenzyme A dehydrogenase, long-chain [Source:MGI Symbol;Acc:MGI:87866])

HSP 1 Score: 160.999 bits (406), Expect = 4.841e-42
Identity = 69/104 (66.35%), Postives = 85/104 (81.73%), Query Frame = 1
Query: 2458 YFQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            + QT+QHKLAE+KT IC +R+FVD CL L  + +LD+ +ASMAKY+ S+L N + Y+ VQLHGGWGYMW+YP+ K+YVDARVQ IYGG NEIMKELIAR IV D
Sbjct:  326 HIQTVQHKLAELKTHICVTRAFVDSCLQLHETKRLDSGSASMAKYWASELQNSVAYECVQLHGGWGYMWEYPIAKAYVDARVQPIYGGTNEIMKELIARQIVSD 429          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Mouse
Match: Acad8 (acyl-Coenzyme A dehydrogenase family, member 8 [Source:MGI Symbol;Acc:MGI:1914198])

HSP 1 Score: 74.7146 bits (182), Expect = 1.880e-13
Identity = 38/103 (36.89%), Postives = 62/103 (60.19%), Query Frame = 1
Query: 2464 QTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDT-QTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            Q +Q +LA+M T +  SR  +    + L   + D     SMAK + ++    IC  A+Q+HGG+GY+ DY V +   D+RV  I  G+NE+M+ LI+R++++D
Sbjct:  311 QYLQFQLADMATKLVASRLMIRTAAVALQEEREDAVALCSMAKLFATEECFAICNQALQMHGGYGYLKDYAVQQYMRDSRVHQILEGSNEVMRMLISRNLLQD 413          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Mouse
Match: Acad8 (acyl-Coenzyme A dehydrogenase family, member 8 [Source:MGI Symbol;Acc:MGI:1914198])

HSP 1 Score: 74.7146 bits (182), Expect = 1.930e-13
Identity = 38/103 (36.89%), Postives = 62/103 (60.19%), Query Frame = 1
Query: 2464 QTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDT-QTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            Q +Q +LA+M T +  SR  +    + L   + D     SMAK + ++    IC  A+Q+HGG+GY+ DY V +   D+RV  I  G+NE+M+ LI+R++++D
Sbjct:  311 QYLQFQLADMATKLVASRLMIRTAAVALQEEREDAVALCSMAKLFATEECFAICNQALQMHGGYGYLKDYAVQQYMRDSRVHQILEGSNEVMRMLISRNLLQD 413          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Mouse
Match: Acadsb (acyl-Coenzyme A dehydrogenase, short/branched chain [Source:MGI Symbol;Acc:MGI:1914135])

HSP 1 Score: 68.1662 bits (165), Expect = 2.209e-11
Identity = 35/100 (35.00%), Postives = 57/100 (57.00%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSI 2760
            FQ +QH++A++ T +  +R    +   L+ + +   + ASMAKYY S++        ++  GG GY  DYPV K + DA++ +IY GA+ I    IA+ I
Sbjct:  329 FQGLQHQVAQVATQLEATRLLTYNAARLVEAGRPFIKEASMAKYYASEVAGLTTSKCIEWMGGVGYTKDYPVEKFFRDAKIGTIYEGASNIQLNTIAKHI 428          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Mouse
Match: Acads (acyl-Coenzyme A dehydrogenase, short chain [Source:MGI Symbol;Acc:MGI:87868])

HSP 1 Score: 67.0106 bits (162), Expect = 5.441e-11
Identity = 35/102 (34.31%), Postives = 58/102 (56.86%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVK 2766
             Q IQ KLA+M  A+  +R       +L ++ K  T+ ++MAK   S+    I + A+Q+ GG GY+ + P  + Y DAR+  IY G +EI + +IA  +++
Sbjct:  307 LQNIQFKLADMALALESARLLTWRAAMLKDNKKPFTKESAMAKLAASEAATAISHQAIQILGGMGYVTEMPAERYYRDARITEIYEGTSEIQRLVIAGHLLR 408          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. UniProt/SwissProt
Match: sp|P51174|ACADL_MOUSE (Long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Acadl PE=1 SV=2)

HSP 1 Score: 160.999 bits (406), Expect = 2.939e-41
Identity = 69/104 (66.35%), Postives = 85/104 (81.73%), Query Frame = 1
Query: 2458 YFQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            + QT+QHKLAE+KT IC +R+FVD CL L  + +LD+ +ASMAKY+ S+L N + Y+ VQLHGGWGYMW+YP+ K+YVDARVQ IYGG NEIMKELIAR IV D
Sbjct:  326 HIQTVQHKLAELKTHICVTRAFVDSCLQLHETKRLDSGSASMAKYWASELQNSVAYECVQLHGGWGYMWEYPIAKAYVDARVQPIYGGTNEIMKELIARQIVSD 429          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. UniProt/SwissProt
Match: sp|P28330|ACADL_HUMAN (Long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADL PE=1 SV=2)

HSP 1 Score: 160.999 bits (406), Expect = 3.292e-41
Identity = 70/104 (67.31%), Postives = 85/104 (81.73%), Query Frame = 1
Query: 2458 YFQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            + QT+QHKLAE+KT IC +R+FVD+CL L  + +LD+ TA MAKY+ S+L N + YD VQLHGGWGYMW+YP+ K+YVDARVQ IYGG NEIMKELIAR IV D
Sbjct:  326 HLQTVQHKLAELKTHICVTRAFVDNCLQLHEAKRLDSATACMAKYWASELQNSVAYDCVQLHGGWGYMWEYPIAKAYVDARVQPIYGGTNEIMKELIAREIVFD 429          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. UniProt/SwissProt
Match: sp|Q60HI0|ACADL_MACFA (Long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Macaca fascicularis OX=9541 GN=ACADL PE=2 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 5.750e-41
Identity = 70/104 (67.31%), Postives = 85/104 (81.73%), Query Frame = 1
Query: 2458 YFQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            + QT+QHKLAE+KT IC +R+FVD+CL L  + +LD+ TA MAKY+ S+L N + YD VQLHGGWGYMW+YP+ K+YVDARVQ IYGG NEIMKELIAR IV D
Sbjct:  326 HLQTVQHKLAELKTHICVTRAFVDNCLQLHEAKRLDSATACMAKYWASELQNSVAYDCVQLHGGWGYMWEYPIAKAYVDARVQPIYGGTNEIMKELIAREIVFD 429          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. UniProt/SwissProt
Match: sp|P15650|ACADL_RAT (Long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acadl PE=1 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 7.562e-41
Identity = 69/104 (66.35%), Postives = 84/104 (80.77%), Query Frame = 1
Query: 2458 YFQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            + QT+QHKLAE+KT IC +R+FVD CL L  + +LD+ +ASMAKY+ S+L N + Y  VQLHGGWGYMW+YP+ K+YVDARVQ IYGG NEIMKELIAR IV D
Sbjct:  326 HIQTVQHKLAELKTNICVTRAFVDSCLQLHETKRLDSASASMAKYWASELQNTVAYQCVQLHGGWGYMWEYPIAKAYVDARVQPIYGGTNEIMKELIARQIVSD 429          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. UniProt/SwissProt
Match: sp|P79274|ACADL_PIG (Long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Sus scrofa OX=9823 GN=ACADL PE=2 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.103e-40
Identity = 68/104 (65.38%), Postives = 84/104 (80.77%), Query Frame = 1
Query: 2458 YFQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            + QT+QHKLAE+KT IC +R+FVD CL L  + +L++  ASMAKY+ S+L N + YD VQLHGGWGYMW+YP+ ++YVDARVQ IYGG NEIMKELIAR IV D
Sbjct:  326 HIQTVQHKLAELKTHICVTRAFVDSCLQLHETKRLESAAASMAKYWASELQNSVAYDCVQLHGGWGYMWEYPIARAYVDARVQPIYGGTNEIMKELIAREIVHD 429          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. TrEMBL
Match: A0A183APB8 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS8803 PE=3 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 6.007e-45
Identity = 76/103 (73.79%), Postives = 90/103 (87.38%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
             QT+QH+LAEMKT+IC SR+FVD CL LLN  +LD+  ASMAKY+ SDL N++ +D VQLHGGWGYMWDY VCK+YVD+RVQSIYGG+NEIMKELIARSI+KD
Sbjct:  186 LQTVQHRLAEMKTSICVSRAFVDQCLELLNQGRLDSSMASMAKYWASDLFNRVAHDGVQLHGGWGYMWDYAVCKAYVDSRVQSIYGGSNEIMKELIARSIMKD 288          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. TrEMBL
Match: A0A1S8X7M8 (Acyl-CoA dehydrogenase protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_01361 PE=3 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 2.806e-44
Identity = 75/101 (74.26%), Postives = 88/101 (87.13%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIV 2763
             QT+QHKLAEMKT +C SR+FVD CL LLN  +LDT+ ASMAKY+ SD+ N++ YD VQLHGGWGYMW+YPVCKS+VDAR+Q+IYGG NEIMKELIARSIV
Sbjct:  243 LQTVQHKLAEMKTKLCVSRAFVDQCLELLNQGRLDTEMASMAKYWASDVANQVAYDGVQLHGGWGYMWEYPVCKSFVDARLQTIYGGTNEIMKELIARSIV 343          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. TrEMBL
Match: G7YI21 (Long-chain-acyl-CoA dehydrogenase OS=Clonorchis sinensis OX=79923 GN=CLF_108434 PE=3 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 3.823e-44
Identity = 74/101 (73.27%), Postives = 88/101 (87.13%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIV 2763
             QT+QHKLAEMKT +C SR+FVD CL LLN  +LDT+ ASMAKY+ SD+ N++ YD VQLHGGWGYMW+YPVCKS+VDAR+Q+IYGG NEIMKELIARSI+
Sbjct:  186 LQTVQHKLAEMKTNLCVSRAFVDQCLDLLNQGRLDTEMASMAKYWASDVANQVAYDGVQLHGGWGYMWEYPVCKSFVDARLQTIYGGTNEIMKELIARSIL 286          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. TrEMBL
Match: A0A2H1CS32 (Acyl-CoA dehydrogenase protein (Fragment) OS=Fasciola hepatica OX=6192 GN=D915_02858 PE=3 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 6.971e-44
Identity = 78/104 (75.00%), Postives = 89/104 (85.58%), Query Frame = 1
Query: 2458 YFQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            + QTIQH+LAEMKT+IC SR+FVD CL LLN   LD+  ASMAKY+ SDL N+I YD VQLHGGWGYMW+Y VCK+YVDARVQSIYGG+NEIMKELI RSIVK+
Sbjct:  238 HLQTIQHRLAEMKTSICVSRAFVDQCLNLLNQGNLDSGMASMAKYWASDLYNRIAYDGVQLHGGWGYMWEYAVCKAYVDARVQSIYGGSNEIMKELIGRSIVKE 341          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. TrEMBL
Match: A0A075A9Z1 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_01445 PE=3 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.395e-43
Identity = 75/101 (74.26%), Postives = 88/101 (87.13%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIV 2763
             QT+QHKLAEMKT +C SR+FVD CL LLN  +LDT+ ASMAKY+ SD+ N++ YD VQLHGGWGYMW+YPVCKS+VDAR+Q+IYGG NEIMKELIARSIV
Sbjct:  266 LQTVQHKLAEMKTKLCVSRAFVDQCLELLNQGRLDTEMASMAKYWASDVANQVAYDGVQLHGGWGYMWEYPVCKSFVDARLQTIYGGTNEIMKELIARSIV 366          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Cavefish
Match: acadl (acyl-CoA dehydrogenase long chain [Source:NCBI gene;Acc:111197552])

HSP 1 Score: 154.451 bits (389), Expect = 7.956e-40
Identity = 66/100 (66.00%), Postives = 81/100 (81.00%), Query Frame = 1
Query: 2464 QTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIV 2763
            QT+QHKLAE+KT IC  RSF+D+CL L +  KLD+ TASMAK++ SDL N++    +QLHGGWGYMW+YP+ K++ DARVQ IYGG NEIMKELIAR IV
Sbjct:  339 QTVQHKLAELKTEICVGRSFIDNCLQLHSEKKLDSSTASMAKFWASDLQNRVATQCLQLHGGWGYMWEYPIAKAFADARVQPIYGGTNEIMKELIARPIV 438          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Cavefish
Match: acad8 (acyl-CoA dehydrogenase family member 8 [Source:NCBI gene;Acc:103025351])

HSP 1 Score: 77.411 bits (189), Expect = 1.656e-14
Identity = 41/103 (39.81%), Postives = 60/103 (58.25%), Query Frame = 1
Query: 2464 QTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDT-QTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            Q +Q KLAEM T +  SR  V    + L  ++ D     SMAK + +D    IC  A+Q+HGG+GY+ DY V +   D RV  I  G NE+M+ +IAR+++ +
Sbjct:  278 QFLQFKLAEMATRLVASRLMVRQAAVALQEDRPDAVALCSMAKLFATDECFSICNQALQMHGGYGYLKDYAVQQFVRDIRVHQILEGTNEVMRMIIARNLLTE 380          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Cavefish
Match: acad8 (acyl-CoA dehydrogenase family member 8 [Source:NCBI gene;Acc:103025351])

HSP 1 Score: 77.411 bits (189), Expect = 2.049e-14
Identity = 41/103 (39.81%), Postives = 60/103 (58.25%), Query Frame = 1
Query: 2464 QTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDT-QTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            Q +Q KLAEM T +  SR  V    + L  ++ D     SMAK + +D    IC  A+Q+HGG+GY+ DY V +   D RV  I  G NE+M+ +IAR+++ +
Sbjct:  316 QFLQFKLAEMATRLVASRLMVRQAAVALQEDRPDAVALCSMAKLFATDECFSICNQALQMHGGYGYLKDYAVQQFVRDIRVHQILEGTNEVMRMIIARNLLTE 418          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Cavefish
Match: acads (acyl-CoA dehydrogenase short chain [Source:NCBI gene;Acc:111190888])

HSP 1 Score: 68.5514 bits (166), Expect = 1.284e-11
Identity = 36/103 (34.95%), Postives = 58/103 (56.31%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
             Q IQ KLA+M  A+  +R       +L ++ K  ++ A+MAK   S+      + A+Q+ GG GY+ D P  + Y DAR+  IY G +EI + +IA  ++K+
Sbjct:  301 MQAIQFKLADMAVALESARLLTWKASMLRDAKKPFSKEAAMAKLAASEAATFCSHQAIQVLGGMGYVTDMPAERHYRDARITEIYEGTSEIQRLVIANQVLKE 403          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Cavefish
Match: acadm (acyl-CoA dehydrogenase medium chain [Source:NCBI gene;Acc:103046142])

HSP 1 Score: 63.1586 bits (152), Expect = 7.859e-10
Identity = 33/98 (33.67%), Postives = 53/98 (54.08%), Query Frame = 1
Query: 2464 QTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARS 2757
            Q +   LAEM   +  +R         ++  + +T  AS+AK Y  D+ N++  DAVQ+ GG G+  +YPV K   DA++  IY G  +I + +I+R 
Sbjct:  318 QAVSFMLAEMAMKVELARLAYQRAAWEVDDGRRNTYYASIAKAYAGDIANQVASDAVQIFGGNGFNSEYPVEKLMRDAKIYQIYEGTAQIQRLIISRE 415          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Sea Lamprey
Match: acads (acyl-CoA dehydrogenase short chain [Source:ZFIN;Acc:ZDB-GENE-040808-64])

HSP 1 Score: 68.1662 bits (165), Expect = 3.818e-12
Identity = 36/103 (34.95%), Postives = 59/103 (57.28%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
             Q IQ KL++M  A+  +R       +L ++ K  T+ A+MAK   S+    I + ++Q+ GG GY+ D P  + Y DAR+  IY G +EI + +IA  ++K+
Sbjct:  309 LQAIQFKLSDMALALESARLLTWRAAMLKDNGKNYTKEAAMAKLAASEAATFISHQSIQILGGMGYVTDMPAERHYRDARITEIYEGTSEIQRLVIANRLLKE 411          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Sea Lamprey
Match: zgc:85777 (zgc:85777 [Source:ZFIN;Acc:ZDB-GENE-040426-2210])

HSP 1 Score: 51.2174 bits (121), Expect = 7.158e-7
Identity = 30/97 (30.93%), Postives = 50/97 (51.55%), Query Frame = 1
Query: 2464 QTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIAR 2754
            Q +  +LAE++T +   RS +   + L       T+ ASMAK     LV ++    +Q  GG G+  +  V + + D R+ SI GG +E+M  +I +
Sbjct:  265 QMVHFRLAELQTEVELLRSLLHRAVDLYVQGHDVTKLASMAKLKAGRLVRELTDACLQFWGGMGFTNEVYVSRLFRDGRLVSIGGGTDEVMLSIICK 361          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Sea Lamprey
Match: acadsb (acyl-CoA dehydrogenase short/branched chain [Source:ZFIN;Acc:ZDB-GENE-070410-109])

HSP 1 Score: 50.0618 bits (118), Expect = 1.503e-6
Identity = 29/98 (29.59%), Postives = 49/98 (50.00%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIAR 2754
            FQ +QH++A + T I  +R    +   L  +       A MAKY+TS++ +      ++  GG G+   YP+ K Y D +V ++  G + I    IA+
Sbjct:  281 FQGMQHQIAHVATQIEAARLLTYNAARLREAGLPFLTQACMAKYFTSEVASLTTSKCMEWMGGVGFTTSYPIEKYYRDCKVGTVPEGTSNIQLSTIAK 378          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Nematostella
Match: EDO43730 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV6])

HSP 1 Score: 71.633 bits (174), Expect = 3.983e-15
Identity = 39/96 (40.62%), Postives = 55/96 (57.29%), Query Frame = 1
Query: 2479 KLAEMKTAICFSRSFVDDCLLLLNSNKLDTQT-ASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIV 2763
            KLAEM T +  SR  V      L+ N  +  T  +MAK + +D   +I    +QLHGG+GY+ DYPV +   D RV  I  G NEIM+ +I+R ++
Sbjct:    3 KLAEMATDLTASRLMVRHAATSLDKNAHNVATLCAMAKLFATDKCFEITNQCMQLHGGYGYLKDYPVQQYMRDTRVHQILEGTNEIMRVIISRDLL 98          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Nematostella
Match: EDO26860 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAV6])

HSP 1 Score: 68.9366 bits (167), Expect = 1.430e-14
Identity = 30/72 (41.67%), Postives = 49/72 (68.06%), Query Frame = 1
Query: 2545 LNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSI 2760
            LN  +   + ASM+K  ++ + + + YDA+QL GG+GYM +YP+ +   D+R+  I GG +EI+KE+IA+ I
Sbjct:    1 LNDGQYVVKEASMSKLLSTKMADSVIYDALQLLGGYGYMEEYPLARLLRDSRLGPIGGGTSEILKEIIAKMI 72          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Nematostella
Match: EDO26365 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TC74])

HSP 1 Score: 66.2402 bits (160), Expect = 7.316e-12
Identity = 30/103 (29.13%), Postives = 61/103 (59.22%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            FQ ++H + E  T +   + F    +  L+  +   + A+MAK  ++ + ++  Y  +Q+ GG+GYM +YP+ +   D+R+  I GG +EI+KE++++ I+ +
Sbjct:  158 FQALRHTIVEHATDVEHCKLFNYAAVARLDKGEYVVKEATMAKLKSTKVADETIYSCLQMLGGYGYMEEYPLARLLRDSRLGPIGGGTSEILKEILSKMIIDN 260          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Nematostella
Match: EDO47569 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMA8])

HSP 1 Score: 60.8474 bits (146), Expect = 1.485e-9
Identity = 35/103 (33.98%), Postives = 57/103 (55.34%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
             QTIQ KLA++ T +  +R        + ++    T+ A+MAK   S+      + ++Q+ GG GY+ D P  + Y DAR+  IY G +EI K +IA  ++K+
Sbjct:  314 LQTIQMKLADIATQLEAARLLTWKAAAIKDAGMNYTKEAAMAKLAASEAATFAAHQSIQILGGMGYVTDMPAERHYRDARITEIYEGTSEIQKLVIAGRLLKE 416          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Nematostella
Match: EDO31980 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWC2])

HSP 1 Score: 55.8398 bits (133), Expect = 4.424e-8
Identity = 29/103 (28.16%), Postives = 55/103 (53.40%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            FQ +Q K+A+M T +   RS++       ++  +  +  +    YT++   ++  DA+Q  GG GY+ DYP  +   DA++  I  G +E+ + +I R+  K+
Sbjct:  318 FQMMQGKMADMYTRLNACRSYLYTVARACDAGHISNKDCAAIILYTAENATQVALDAIQCLGGNGYINDYPTGRFLRDAKLYEIGAGTSEVRRLIIGRAFNKE 420          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Medaka
Match: acadl (acyl-CoA dehydrogenase long chain [Source:NCBI gene;Acc:101159651])

HSP 1 Score: 155.606 bits (392), Expect = 3.298e-40
Identity = 68/102 (66.67%), Postives = 83/102 (81.37%), Query Frame = 1
Query: 2458 YFQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIV 2763
            + QT+QHKLAE+KT IC  RSFVD+CLLLL   +LD  TASMAK++ S+L NK+    +QLHGGWGYM +YP+ K++VD+RVQ IYGG NEIMKELIARSIV
Sbjct:  338 HLQTVQHKLAELKTEICVGRSFVDNCLLLLAEKRLDPSTASMAKFWASELQNKVATQCLQLHGGWGYMLEYPIAKAFVDSRVQPIYGGTNEIMKELIARSIV 439          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Medaka
Match: acad8 (acyl-CoA dehydrogenase family member 8 [Source:NCBI gene;Acc:101168062])

HSP 1 Score: 77.0258 bits (188), Expect = 2.522e-14
Identity = 41/103 (39.81%), Postives = 61/103 (59.22%), Query Frame = 1
Query: 2464 QTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQT-ASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
            Q +Q KLAEM T +  SR  V +    L +N  D  +  SMAK + +D    IC  A+Q+HGG+GY+ DY V +   D RV  I  G NE+M+ +I+R+++ +
Sbjct:  316 QYLQFKLAEMATKLVASRLLVREAAKALQTNHPDAVSLCSMAKLFVTDECFNICNQALQMHGGYGYLKDYAVQQFVRDIRVHQILEGTNEVMRMIISRNLLME 418          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Medaka
Match: acads (acyl-CoA dehydrogenase short chain [Source:NCBI gene;Acc:101166811])

HSP 1 Score: 71.633 bits (174), Expect = 1.235e-12
Identity = 38/103 (36.89%), Postives = 58/103 (56.31%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
             Q +Q KLA+M  A+  +R       LL +S +  T+ A+MAK   S+      + A+Q+ GG GY+ D P  + Y DAR+  IY G +EI + +IA  I+K+
Sbjct:  300 LQAVQFKLADMGVALESARLLTWKAALLRDSKRPFTKEAAMAKLAASEAATFCSHQAIQILGGMGYVTDMPAERHYRDARITEIYEGTSEIQRLVIAGQILKE 402          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Medaka
Match: ENSORLT00000003950.2 (pep primary_assembly:ASM223467v1:17:3780367:3787251:1 gene:ENSORLG00000003172.2 transcript:ENSORLT00000003950.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 3.361e-10
Identity = 32/98 (32.65%), Postives = 53/98 (54.08%), Query Frame = 1
Query: 2464 QTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARS 2757
            Q +   LAEM   +  +R         ++  + +T  AS+AK +  D+ N++  DAVQ+ GG G+  +YPV K   DA++  IY G  +I + +I+R 
Sbjct:  114 QAVSFILAEMAMKVELARMAYQRSAWEVDQGRRNTYYASIAKAFAGDIANQVATDAVQVFGGNGFNSEYPVEKLMRDAKIYQIYEGTAQIQRLIISRE 211          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Medaka
Match: acad8 (acyl-CoA dehydrogenase family member 8 [Source:NCBI gene;Acc:101168062])

HSP 1 Score: 62.7734 bits (151), Expect = 9.875e-10
Identity = 36/87 (41.38%), Postives = 48/87 (55.17%), Query Frame = 1
Query: 2464 QTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQT-ASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGG 2721
            Q +Q KLAEM T +  SR  V +    L +N  D  +  SMAK + +D    IC  A+Q+HGG+GY+ DY V +   D RV  I  G
Sbjct:  316 QYLQFKLAEMATKLVASRLLVREAAKALQTNHPDAVSLCSMAKLFVTDECFNICNQALQMHGGYGYLKDYAVQQFVRDIRVHQILEG 402          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Planmine SMEST
Match: SMESG000081273.1 (SMESG000081273.1)

HSP 1 Score: 218.394 bits (555), Expect = 5.242e-63
Identity = 102/103 (99.03%), Postives = 102/103 (99.03%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
             QTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD
Sbjct:  269 LQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 371          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Planmine SMEST
Match: SMESG000081273.1 (SMESG000081273.1)

HSP 1 Score: 217.624 bits (553), Expect = 7.557e-63
Identity = 102/103 (99.03%), Postives = 102/103 (99.03%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
             QTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD
Sbjct:  260 LQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 362          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Planmine SMEST
Match: SMESG000081273.1 (SMESG000081273.1)

HSP 1 Score: 218.009 bits (554), Expect = 3.051e-62
Identity = 102/103 (99.03%), Postives = 102/103 (99.03%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
             QTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD
Sbjct:  326 LQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 428          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Planmine SMEST
Match: SMESG000081273.1 (SMESG000081273.1)

HSP 1 Score: 217.624 bits (553), Expect = 5.396e-62
Identity = 102/103 (99.03%), Postives = 102/103 (99.03%), Query Frame = 1
Query: 2461 FQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 2769
             QTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD
Sbjct:  334 LQTIQHKLAEMKTAICFSRSFVDDCLLLLNSNKLDTQTASMAKYYTSDLVNKICYDAVQLHGGWGYMWDYPVCKSYVDARVQSIYGGANEIMKELIARSIVKD 436          
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Planmine SMEST
Match: SMESG000055478.1 (SMESG000055478.1)

HSP 1 Score: 136.346 bits (342), Expect = 5.728e-49
Identity = 99/169 (58.58%), Postives = 118/169 (69.82%), Query Frame = 3
Query:  501 YKKIMWLSRARDDLIIETRCQQITVSEQSAALLQIFNE-ELQARLPSRSLAQQLDIIPAHHLPSKSGNPVISQGNSPPADGT*XXXXXXXXXXXXXXXXXXXXXXLLFQANLRNDEYPESTEKQNSLPIECVV--YDFDNELIYAPIQPIFSHPTPTQITVNAIIRESP 998
            YKKI  LSRARDDLIIETR Q+IT+SEQ+AA  QIF E ELQARLPSR+L QQ++II A+HLP  + N  I+  ++ PADG    NRRHK NRNRR RQR RA N L QANLRND  PE  E Q+ +  +     +D D ++IYAP QP F H TP QIT+ +   ESP
Sbjct:   53 YKKITRLSRARDDLIIETRSQRITISEQTAAFRQIFTEKELQARLPSRNLVQQINIIQAYHLPINAENSPINYDSNIPADGILHVNRRHKSNRNRRWRQRRRAENALLQANLRNDGLPELREIQDLVSTKQATPRHDDDLDIIYAPFQPEFFHSTPAQITITSHGHESP 221          

HSP 2 Score: 78.9518 bits (193), Expect = 5.728e-49
Identity = 39/51 (76.47%), Postives = 43/51 (84.31%), Query Frame = 2
Query:  347 MNLPRIPRIVPASHAVAMIQQLEKHERENFILREKYEKLKGTWLSPEATKD 499
            MNLP IPRIV A  AVAM Q+LEK + ENF+LREKYEKLKGTW SPEATK+
Sbjct:    1 MNLPSIPRIVLAPSAVAMTQRLEKLKWENFVLREKYEKLKGTWCSPEATKE 51          
The following BLAST results are available for this feature:
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACADL6.855e-4267.31acyl-CoA dehydrogenase long chain [Source:HGNC Sym... [more]
ACAD87.375e-1437.86acyl-CoA dehydrogenase family member 8 [Source:HGN... [more]
ACAD82.896e-1337.86acyl-CoA dehydrogenase family member 8 [Source:HGN... [more]
ACADSB1.417e-1237.00acyl-CoA dehydrogenase short/branched chain [Sourc... [more]
ACADSB3.207e-1237.00acyl-CoA dehydrogenase short/branched chain [Sourc... [more]
back to top
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acdh-95.935e-1036.27Acyl CoA DeHydrogenase [Source:UniProtKB/TrEMBL;A... [more]
ivd-11.973e-930.10Isovaleryl-CoA dehydrogenase [Source:UniProtKB/Tr... [more]
ivd-11.973e-930.10Isovaleryl-CoA dehydrogenase [Source:UniProtKB/Tr... [more]
acdh-81.658e-830.39Acyl CoA DeHydrogenase [Source:UniProtKB/TrEMBL;A... [more]
acdh-78.119e-831.00Acyl CoA DeHydrogenase [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mcad2.543e-1034.65gene:FBgn0035811 transcript:FBtr0076808[more]
CG48601.834e-933.98gene:FBgn0037999 transcript:FBtr0082623[more]
Arc421.983e-933.98gene:FBgn0038742 transcript:FBtr0083817[more]
CG39024.873e-933.03gene:FBgn0036824 transcript:FBtr0075076[more]
CG66385.896e-728.16gene:FBgn0035911 transcript:FBtr0076651[more]
back to top
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acadl2.286e-3862.38acyl-CoA dehydrogenase long chain [Source:ZFIN;Acc... [more]
acadl2.286e-3862.38acyl-CoA dehydrogenase long chain [Source:ZFIN;Acc... [more]
acad84.113e-1541.75acyl-CoA dehydrogenase family, member 8 [Source:ZF... [more]
acad84.113e-1541.75acyl-CoA dehydrogenase family, member 8 [Source:ZF... [more]
acads2.391e-1338.83acyl-CoA dehydrogenase short chain [Source:ZFIN;Ac... [more]
back to top
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp3r18.026e-4165.38protein phosphatase 3 regulatory subunit B, alpha ... [more]
ppp3r19.887e-4165.38protein phosphatase 3 regulatory subunit B, alpha ... [more]
ppp3r11.239e-4065.38protein phosphatase 3 regulatory subunit B, alpha ... [more]
ppp3r11.517e-4065.38protein phosphatase 3 regulatory subunit B, alpha ... [more]
ppp3r12.592e-4065.38protein phosphatase 3 regulatory subunit B, alpha ... [more]
back to top
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Acadl4.841e-4266.35acyl-Coenzyme A dehydrogenase, long-chain [Source:... [more]
Acad81.880e-1336.89acyl-Coenzyme A dehydrogenase family, member 8 [So... [more]
Acad81.930e-1336.89acyl-Coenzyme A dehydrogenase family, member 8 [So... [more]
Acadsb2.209e-1135.00acyl-Coenzyme A dehydrogenase, short/branched chai... [more]
Acads5.441e-1134.31acyl-Coenzyme A dehydrogenase, short chain [Source... [more]
back to top
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P51174|ACADL_MOUSE2.939e-4166.35Long-chain specific acyl-CoA dehydrogenase, mitoch... [more]
sp|P28330|ACADL_HUMAN3.292e-4167.31Long-chain specific acyl-CoA dehydrogenase, mitoch... [more]
sp|Q60HI0|ACADL_MACFA5.750e-4167.31Long-chain specific acyl-CoA dehydrogenase, mitoch... [more]
sp|P15650|ACADL_RAT7.562e-4166.35Long-chain specific acyl-CoA dehydrogenase, mitoch... [more]
sp|P79274|ACADL_PIG1.103e-4065.38Long-chain specific acyl-CoA dehydrogenase, mitoch... [more]
back to top
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183APB86.007e-4573.79Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A1S8X7M82.806e-4474.26Acyl-CoA dehydrogenase protein (Fragment) OS=Opist... [more]
G7YI213.823e-4473.27Long-chain-acyl-CoA dehydrogenase OS=Clonorchis si... [more]
A0A2H1CS326.971e-4475.00Acyl-CoA dehydrogenase protein (Fragment) OS=Fasci... [more]
A0A075A9Z11.395e-4374.26Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acadl7.956e-4066.00acyl-CoA dehydrogenase long chain [Source:NCBI gen... [more]
acad81.656e-1439.81acyl-CoA dehydrogenase family member 8 [Source:NCB... [more]
acad82.049e-1439.81acyl-CoA dehydrogenase family member 8 [Source:NCB... [more]
acads1.284e-1134.95acyl-CoA dehydrogenase short chain [Source:NCBI ge... [more]
acadm7.859e-1033.67acyl-CoA dehydrogenase medium chain [Source:NCBI g... [more]
back to top
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
acads3.818e-1234.95acyl-CoA dehydrogenase short chain [Source:ZFIN;Ac... [more]
zgc:857777.158e-730.93zgc:85777 [Source:ZFIN;Acc:ZDB-GENE-040426-2210][more]
acadsb1.503e-629.59acyl-CoA dehydrogenase short/branched chain [Sourc... [more]
back to top
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO437303.983e-1540.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO268601.430e-1441.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO263657.316e-1229.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475691.485e-933.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319804.424e-828.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acadl3.298e-4066.67acyl-CoA dehydrogenase long chain [Source:NCBI gen... [more]
acad82.522e-1439.81acyl-CoA dehydrogenase family member 8 [Source:NCB... [more]
acads1.235e-1236.89acyl-CoA dehydrogenase short chain [Source:NCBI ge... [more]
ENSORLT00000003950.23.361e-1032.65pep primary_assembly:ASM223467v1:17:3780367:378725... [more]
acad89.875e-1041.38acyl-CoA dehydrogenase family member 8 [Source:NCB... [more]
back to top
BLAST of Long-chain specific acyl-CoA dehydrogenase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081273.15.242e-6399.03SMESG000081273.1[more]
SMESG000081273.17.557e-6399.03SMESG000081273.1[more]
SMESG000081273.13.051e-6299.03SMESG000081273.1[more]
SMESG000081273.15.396e-6299.03SMESG000081273.1[more]
SMESG000055478.15.728e-4958.58SMESG000055478.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020701 ID=SMED30020701|Name=Long-chain specific acyl-CoA dehydrogenase|organism=Schmidtea mediterranea sexual|type=transcript|length=2885bp
TTTACCGAATTAGCAAAAGTAGAAGATAAAGCCCATGAACGATAAATCAA
TCCTTTCACCATATTTCTCTTATACTTAAATTCACAAAAGCTTTCTGGAG
AAGTATAAAGACCAGTACCAGAAACCGAAGTCTCCTCCATCCATTGTTTC
ATCTATCCGACAATTCTCGCAAAATTGGAATTTAATTGTCTTAAATTAAC
TCTAAGCAAATCGTAAGTTCTACAAAACTGCCGGATTACGTAACCGCCAA
ATTCAAATTCTCATATTAACAGTTCGGATTTTTTCTGAATTTTCATACCA
TTAACGCTAATTTTCTCTTGGGAATTACTCTGTCATTTCAATGCCAATGA
ACTTGCCGCGCATTCCCAGAATTGTTCCTGCTTCGCATGCTGTGGCTATG
ATACAACAACTAGAAAAACATGAACGTGAGAATTTCATTCTCCGAGAAAA
ATATGAGAAACTCAAGGGCACTTGGCTATCACCCGAGGCCACCAAAGACA
TATAAGAAAATCATGTGGCTCTCTCGTGCCCGAGATGATCTTATCATAGA
AACGAGATGCCAACAGATTACAGTATCCGAACAAAGCGCAGCTCTCCTAC
AGATTTTTAACGAAGAGTTGCAAGCTCGCCTACCGAGCAGGAGCTTAGCG
CAACAACTCGATATAATCCCGGCACACCATCTGCCGTCCAAGTCAGGAAA
TCCAGTAATTAGCCAGGGCAATAGTCCGCCTGCAGATGGAACATGACGGG
CCAACCGAAGGCATAAGCCCAACAGAAATCGTCGCAAGCGGCAGAGGTGT
AGGGCCAGAAACCTCCTGTTCCAGGCTAACTTGAGAAACGACGAATATCC
GGAATCAACAGAAAAACAAAACTCATTACCCATAGAATGTGTCGTTTACG
ATTTCGACAACGAACTGATCTATGCCCCCATTCAACCCATATTTTCACAT
CCCACTCCGACTCAGATAACCGTCAATGCAATCATTCGCGAGTCGCCCAC
CCACATCAATATCATTACTACTATGATAGAGGAAGAACATCAATCAAGTG
GACAGTCATCGCTACTGATCCTTTCGGTTGTAGAACCGACCGTACTTCAA
GAGCGGAGGGCAGGTTTTCCACGACAAGCATCATCCCATCCAACGACGCG
ATGTCCCAAGCGCCGTAGACATCGACGGGAACGAATAAATCAATGCCTCC
GAAAATGCCCTCGCCCGATTGACATCAGTCTATATCTCCTCTGCTAGCGA
CATTTTCCTAAAAAAACTTCACCTCCATCTTATTTTATCTTATGTTACTT
TACCTTAAGCAGAAATAACGTTTTTTTGTTTTGTTATTTAATACGGTTAA
GATTAAAATTTTAATGCAAGAGTAGTATGGGAAGTGACTTAATTCTCTTG
TTCAGTAATAAATAATTTATTAATTTTAGAAATGGTTTAATTAATTTAAA
TGAAATTGGCTGAGTAATAGGAAAAAAGGGATTGAAAATGATAATGGTTT
TCAAATTTATAGTTTTGTTCGTTTCATTAGTGTTCGATATCTTCACAGTC
AGTTCCCTTACTTAAACTTAAAGAACCAGATATATTTTTGGATTACCGAA
TTATAAGAATGCGTTAGACCTTCTAGCGGCTGCTTTGAACCCGAATCGAA
AGTTACTCGAGGAGTAGTACTGGCAACAATGCTCACCAGCTCCAATAGCA
TTCGACTATCATACACATTACCAACATTGGTAACCCATGGGTGTATGATG
GTGAGGCGTAAATTATGTTGTGTGCGATGGAAATTAGACCCTAGAAACGG
AAAGGCGTGTGGGTTTTTGTACAAGTCGGTATCCAGTGGTAACAAAGGTT
CCCAGTACACCAGCAGTTGCATAAATTGAAAATTCTGGAGGATATTTATT
TTCAAGACAAGTGAATATATTTTTATTACAAATTAATCTTAAATTCAAAA
ATTTACTAAATAATTTGAAACAAACTATCAAATACAAAACAACATACCTT
ACCAAAATGCAAAAAAAGTATGATAAATCGAATTCATTCGGAAATCACAA
TTTATCCCAAATGAAATTTAACAAAAATAATAGCAAATATTCATAATCAG
TAATTTATAATTAAATCTTTCGGTAATTATTTGTGCATAATTTAGATATT
CTTCATATCCATAAATTAAATTATAATCTTTTTTAACGGATTAGTGTATT
TGGAAGCCGGGGGATAAGTTGATAAAGGGATATGAATGTGTTTAAAAATG
AAGTAGTTGATGTTGTAGCAACCAATGGTTGCTTGAAATCGGAATATCTG
ATTTCCATTTTGACTTGAAAATTGACAATTAATATTTTGTTCAGGAAATA
TTTTTCGAGAGCATTGATATCAAATTTGTATAAGATTTTCATGGGAAAGC
TTTTAACGGTTCACCACACCCCGAAATTTAGATCAAAATTTATTGAAACT
TTGATAATATTTTCAGACAATTCAACACAAATTAGCAGAAATGAAAACCG
CAATTTGCTTTTCTAGGTCATTTGTTGATGATTGCTTGTTATTGTTGAAC
TCAAATAAATTGGATACCCAAACTGCATCTATGGCTAAATATTATACAAG
TGATCTGGTGAATAAAATTTGCTATGATGCCGTTCAGCTGCACGGTGGAT
GGGGTTACATGTGGGACTATCCGGTTTGTAAATCATATGTCGATGCTCGC
GTTCAATCAATTTATGGTGGTGCCAATGAAATAATGAAAGAATTGATTGC
AAGATCTATTGTGAAAGACTAATAATAAAAATTGACAAAACTTTTAATAA
ACTTTTTTATTTAATAAATTGCGGAAATTAATTTCATTTAAATTTTTATA
GATTTGTTAATCGTTGATTATCTTTTCAATTTTTC
back to top

protein sequence of SMED30020701-orf-1

>SMED30020701-orf-1 ID=SMED30020701-orf-1|Name=SMED30020701-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=109bp
MNVRISFSEKNMRNSRALGYHPRPPKTYKKIMWLSRARDDLIIETRCQQI
TVSEQSAALLQIFNEELQARLPSRSLAQQLDIIPAHHLPSKSGNPVISQG
NSPPADGT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
PLANA:0002075pigment cell
PLANA:0002089reproductive organ
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036250AcylCo_DH-like_C
IPR009075AcylCo_DH/oxidase_C
IPR006089Acyl-CoA_DH_CS
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0008152metabolic process
GO:0042758long-chain fatty acid catabolic process
GO:0006629lipid metabolic process
GO:0006631fatty acid metabolic process
Vocabulary: molecular function
TermDefinition
GO:0016627oxidoreductase activity, acting on the CH-CH group of donors
GO:0003995acyl-CoA dehydrogenase activity
GO:0016491oxidoreductase activity
GO:0050660flavin adenine dinucleotide binding
GO:0004466long-chain-acyl-CoA dehydrogenase activity
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005759mitochondrial matrix
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.140.10coord: 1..92
e-value: 5.7E-24
score: 86.7
NoneNo IPR availablePANTHERPTHR43604FAMILY NOT NAMEDcoord: 1..92
NoneNo IPR availablePANTHERPTHR43604:SF5LONG-CHAIN SPECIFIC ACYL-COA DEHYDROGENASE, MITOCHONDRIALcoord: 1..92
IPR009075Acyl-CoA dehydrogenase/oxidase C-terminalPFAMPF00441Acyl-CoA_dh_1coord: 1..90
e-value: 8.3E-21
score: 74.8
IPR006089Acyl-CoA dehydrogenase, conserved sitePROSITEPS00073ACYL_COA_DH_2coord: 49..68
IPR036250Acyl-CoA dehydrogenase-like, C-terminalSUPERFAMILYSSF47203Acyl-CoA dehydrogenase C-terminal domain-likecoord: 1..92