ETS domain-containing protein

Overview
NameETS domain-containing protein
Smed IDSMED30020689
Length (bp)1152
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ETS domain-containing protein (SMED30020689) t-SNE clustered cells

Violin plots show distribution of expression levels for ETS domain-containing protein (SMED30020689) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ETS domain-containing protein (SMED30020689) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ETS domain-containing protein (SMED30020689) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020689

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30020689h1SMcG0014619 dd_Smed_v4_6626_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020689h1SMcG0014619 dd_Smed_v4_6626_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020689h1SMcG0014619 dd_Smed_v4_6626_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020689h1SMcG0014619 dd_Smed_v4_6626_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020689h1SMcG0014619 dd_Smed_v4_6626_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020689h1SMcG0014619 dd_Smed_v4_6626_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ETS domain-containing protein vs. Ensembl Human
Match: ELF2 (E74 like ETS transcription factor 2 [Source:HGNC Symbol;Acc:HGNC:3317])

HSP 1 Score: 110.923 bits (276), Expect = 2.599e-28
Identity = 58/129 (44.96%), Postives = 72/129 (55.81%), Query Frame = 1
Query:  610 DQTNSDSVFLNTELTSKDNNSDINSEPETKSLSMKNSSFHSNSGKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            D      V ++TE +   + S I + P++     K          N  +LW+FLL LL D    P  I W  +    FKLV S  V+KLWG+ K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:   67 DVITETVVEVSTEESEPMDTSPIPTSPDSHEPMKKKKG-------NTTYLWEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 188          
BLAST of ETS domain-containing protein vs. Ensembl Human
Match: ELF4 (E74 like ETS transcription factor 4 [Source:HGNC Symbol;Acc:HGNC:3319])

HSP 1 Score: 112.464 bits (280), Expect = 2.372e-26
Identity = 53/90 (58.89%), Postives = 60/90 (66.67%), Query Frame = 1
Query:  730 SNSGKNG-CHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            S  GK    +LW+FLL LL D    P  I W  +    FKLV S  V+KLWG+QK KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:  201 SKDGKGSTIYLWEFLLALLQDRNTCPKYIKWTQREKGIFKLVDSKAVSKLWGKQKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 290          
BLAST of ETS domain-containing protein vs. Ensembl Human
Match: ELF4 (E74 like ETS transcription factor 4 [Source:HGNC Symbol;Acc:HGNC:3319])

HSP 1 Score: 112.464 bits (280), Expect = 2.372e-26
Identity = 53/90 (58.89%), Postives = 60/90 (66.67%), Query Frame = 1
Query:  730 SNSGKNG-CHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            S  GK    +LW+FLL LL D    P  I W  +    FKLV S  V+KLWG+QK KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:  201 SKDGKGSTIYLWEFLLALLQDRNTCPKYIKWTQREKGIFKLVDSKAVSKLWGKQKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 290          
BLAST of ETS domain-containing protein vs. Ensembl Human
Match: ELF4 (E74 like ETS transcription factor 4 [Source:HGNC Symbol;Acc:HGNC:3319])

HSP 1 Score: 111.694 bits (278), Expect = 3.640e-26
Identity = 53/90 (58.89%), Postives = 60/90 (66.67%), Query Frame = 1
Query:  730 SNSGKNGC-HLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            S  GK    +LW+FLL LL D    P  I W  +    FKLV S  V+KLWG+QK KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:  201 SKDGKGSTIYLWEFLLALLQDRNTCPKYIKWTQREKGIFKLVDSKAVSKLWGKQKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 290          
BLAST of ETS domain-containing protein vs. Ensembl Human
Match: ELF2 (E74 like ETS transcription factor 2 [Source:HGNC Symbol;Acc:HGNC:3317])

HSP 1 Score: 110.538 bits (275), Expect = 6.050e-26
Identity = 57/122 (46.72%), Postives = 71/122 (58.20%), Query Frame = 1
Query:  631 VFLNTELTSKDNNSDINSEPETKSLSMKNSSFHSNSGKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            V ++TE +   + S I + P++     K          N  +LW+FLL LL D    P  I W  +    FKLV S  V+KLWG+ K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:   86 VEVSTEESEPMDTSPIPTSPDSHEPMKKKKG-------NTTYLWEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 200          
BLAST of ETS domain-containing protein vs. Ensembl Celegans
Match: elf-1 (ETS-Like transcription Factor homolog [Source:UniProtKB/TrEMBL;Acc:Q400M2])

HSP 1 Score: 122.479 bits (306), Expect = 5.791e-31
Identity = 56/106 (52.83%), Postives = 71/106 (66.98%), Query Frame = 1
Query:  682 SEPETKSLSMKNSSFHSNSGKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQFI 999
            SEP    L+ +        G+   +LW+FLLRLL D +Y+P  I WID+    FKLV S  V++LWG  K KP MNYETMGRALRYYY R I++K+ GQRLVY+F+
Sbjct:  272 SEPNPAPLAQRTPGKKQKDGQV-TYLWEFLLRLLQDDQYSPKFIKWIDQAKGIFKLVDSKAVSRLWGMHKNKPGMNYETMGRALRYYYQRGILQKVDGQRLVYRFV 376          
BLAST of ETS domain-containing protein vs. Ensembl Celegans
Match: elf-1 (ETS-Like transcription Factor homolog [Source:UniProtKB/TrEMBL;Acc:Q400M2])

HSP 1 Score: 122.479 bits (306), Expect = 5.791e-31
Identity = 56/106 (52.83%), Postives = 71/106 (66.98%), Query Frame = 1
Query:  682 SEPETKSLSMKNSSFHSNSGKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQFI 999
            SEP    L+ +        G+   +LW+FLLRLL D +Y+P  I WID+    FKLV S  V++LWG  K KP MNYETMGRALRYYY R I++K+ GQRLVY+F+
Sbjct:  272 SEPNPAPLAQRTPGKKQKDGQV-TYLWEFLLRLLQDDQYSPKFIKWIDQAKGIFKLVDSKAVSRLWGMHKNKPGMNYETMGRALRYYYQRGILQKVDGQRLVYRFV 376          
BLAST of ETS domain-containing protein vs. Ensembl Celegans
Match: elf-1 (ETS-Like transcription Factor homolog [Source:UniProtKB/TrEMBL;Acc:Q400M2])

HSP 1 Score: 122.094 bits (305), Expect = 8.186e-31
Identity = 56/106 (52.83%), Postives = 71/106 (66.98%), Query Frame = 1
Query:  682 SEPETKSLSMKNSSFHSNSGKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQFI 999
            SEP    L+ +        G+   +LW+FLLRLL D +Y+P  I WID+    FKLV S  V++LWG  K KP MNYETMGRALRYYY R I++K+ GQRLVY+F+
Sbjct:  271 SEPNPAPLAQRTPGKKQKDGQV-TYLWEFLLRLLQDDQYSPKFIKWIDQAKGIFKLVDSKAVSRLWGMHKNKPGMNYETMGRALRYYYQRGILQKVDGQRLVYRFV 375          
BLAST of ETS domain-containing protein vs. Ensembl Celegans
Match: elf-1 (ETS-Like transcription Factor homolog [Source:UniProtKB/TrEMBL;Acc:Q400M2])

HSP 1 Score: 122.094 bits (305), Expect = 8.186e-31
Identity = 56/106 (52.83%), Postives = 71/106 (66.98%), Query Frame = 1
Query:  682 SEPETKSLSMKNSSFHSNSGKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQFI 999
            SEP    L+ +        G+   +LW+FLLRLL D +Y+P  I WID+    FKLV S  V++LWG  K KP MNYETMGRALRYYY R I++K+ GQRLVY+F+
Sbjct:  271 SEPNPAPLAQRTPGKKQKDGQV-TYLWEFLLRLLQDDQYSPKFIKWIDQAKGIFKLVDSKAVSRLWGMHKNKPGMNYETMGRALRYYYQRGILQKVDGQRLVYRFV 375          
BLAST of ETS domain-containing protein vs. Ensembl Celegans
Match: ast-1 (Axon STeering defect [Source:UniProtKB/TrEMBL;Acc:Q22355])

HSP 1 Score: 101.293 bits (251), Expect = 1.301e-23
Identity = 52/103 (50.49%), Postives = 67/103 (65.05%), Query Frame = 1
Query:  688 PETKSLSMKNSSFHSNSGKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            P +K+L+      HS SG+    LWQFLL LL D +Y+  +ITW + T   FKLV    VA+ WGE+K KP MNY+ M RALRYYY +NIM K+ G+R  Y+F
Sbjct:  201 PTSKNLA------HSGSGQ--TQLWQFLLELLSDKRYS-EVITW-EGTQGEFKLVDPDEVARKWGERKSKPNMNYDKMSRALRYYYDKNIMAKVHGKRYAYKF 293          
BLAST of ETS domain-containing protein vs. Ensembl Fly
Match: Eip74EF (gene:FBgn0000567 transcript:FBtr0305796)

HSP 1 Score: 115.546 bits (288), Expect = 1.272e-27
Identity = 49/82 (59.76%), Postives = 60/82 (73.17%), Query Frame = 1
Query:  754 HLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQFI 999
            +LW+FLL+LL D +Y P  I W ++    FKLV S  V++LWG  K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF+
Sbjct:  749 YLWEFLLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQRGILAKVDGQRLVYQFV 830          
BLAST of ETS domain-containing protein vs. Ensembl Fly
Match: Eip74EF (gene:FBgn0000567 transcript:FBtr0075202)

HSP 1 Score: 115.546 bits (288), Expect = 1.284e-27
Identity = 49/82 (59.76%), Postives = 60/82 (73.17%), Query Frame = 1
Query:  754 HLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQFI 999
            +LW+FLL+LL D +Y P  I W ++    FKLV S  V++LWG  K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF+
Sbjct:  734 YLWEFLLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQRGILAKVDGQRLVYQFV 815          
BLAST of ETS domain-containing protein vs. Ensembl Fly
Match: Eip74EF (gene:FBgn0000567 transcript:FBtr0075203)

HSP 1 Score: 115.161 bits (287), Expect = 1.570e-27
Identity = 49/82 (59.76%), Postives = 60/82 (73.17%), Query Frame = 1
Query:  754 HLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQFI 999
            +LW+FLL+LL D +Y P  I W ++    FKLV S  V++LWG  K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF+
Sbjct:  773 YLWEFLLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQRGILAKVDGQRLVYQFV 854          
BLAST of ETS domain-containing protein vs. Ensembl Fly
Match: Eip74EF (gene:FBgn0000567 transcript:FBtr0075204)

HSP 1 Score: 114.775 bits (286), Expect = 1.998e-27
Identity = 49/83 (59.04%), Postives = 60/83 (72.29%), Query Frame = 1
Query:  751 CHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQFI 999
             +LW+FLL+LL D +Y P  I W ++    FKLV S  V++LWG  K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF+
Sbjct:  787 TYLWEFLLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQRGILAKVDGQRLVYQFV 869          
BLAST of ETS domain-containing protein vs. Ensembl Fly
Match: Eip74EF (gene:FBgn0000567 transcript:FBtr0100411)

HSP 1 Score: 114.775 bits (286), Expect = 1.998e-27
Identity = 49/83 (59.04%), Postives = 60/83 (72.29%), Query Frame = 1
Query:  751 CHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQFI 999
             +LW+FLL+LL D +Y P  I W ++    FKLV S  V++LWG  K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF+
Sbjct:  787 TYLWEFLLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQRGILAKVDGQRLVYQFV 869          
BLAST of ETS domain-containing protein vs. Ensembl Zebrafish
Match: elf2b (E74-like factor 2b (ets domain transcription factor) [Source:ZFIN;Acc:ZDB-GENE-031215-1])

HSP 1 Score: 113.62 bits (283), Expect = 2.662e-27
Identity = 52/89 (58.43%), Postives = 59/89 (66.29%), Query Frame = 1
Query:  730 SNSGKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            S  GK   +LW+FLL LL D    P  I W  +    FKLV S  V+KLWG+ K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:   95 SREGKGSTYLWEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 183          
BLAST of ETS domain-containing protein vs. Ensembl Zebrafish
Match: elf2b (E74-like factor 2b (ets domain transcription factor) [Source:ZFIN;Acc:ZDB-GENE-031215-1])

HSP 1 Score: 113.62 bits (283), Expect = 3.283e-27
Identity = 52/89 (58.43%), Postives = 59/89 (66.29%), Query Frame = 1
Query:  730 SNSGKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            S  GK   +LW+FLL LL D    P  I W  +    FKLV S  V+KLWG+ K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:  137 SREGKGSTYLWEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 225          
BLAST of ETS domain-containing protein vs. Ensembl Zebrafish
Match: elf2b (E74-like factor 2b (ets domain transcription factor) [Source:ZFIN;Acc:ZDB-GENE-031215-1])

HSP 1 Score: 113.62 bits (283), Expect = 3.283e-27
Identity = 52/89 (58.43%), Postives = 59/89 (66.29%), Query Frame = 1
Query:  730 SNSGKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            S  GK   +LW+FLL LL D    P  I W  +    FKLV S  V+KLWG+ K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:  137 SREGKGSTYLWEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 225          
BLAST of ETS domain-containing protein vs. Ensembl Zebrafish
Match: elf2b (E74-like factor 2b (ets domain transcription factor) [Source:ZFIN;Acc:ZDB-GENE-031215-1])

HSP 1 Score: 114.005 bits (284), Expect = 3.675e-27
Identity = 52/89 (58.43%), Postives = 59/89 (66.29%), Query Frame = 1
Query:  730 SNSGKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            S  GK   +LW+FLL LL D    P  I W  +    FKLV S  V+KLWG+ K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:  212 SREGKGSTYLWEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 300          
BLAST of ETS domain-containing protein vs. Ensembl Zebrafish
Match: elf2b (E74-like factor 2b (ets domain transcription factor) [Source:ZFIN;Acc:ZDB-GENE-031215-1])

HSP 1 Score: 114.005 bits (284), Expect = 3.675e-27
Identity = 52/89 (58.43%), Postives = 59/89 (66.29%), Query Frame = 1
Query:  730 SNSGKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            S  GK   +LW+FLL LL D    P  I W  +    FKLV S  V+KLWG+ K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:  212 SREGKGSTYLWEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 300          
BLAST of ETS domain-containing protein vs. Ensembl Xenopus
Match: oat (ornithine aminotransferase [Source:Xenbase;Acc:XB-GENE-5969095])

HSP 1 Score: 109.768 bits (273), Expect = 1.568e-25
Identity = 48/81 (59.26%), Postives = 56/81 (69.14%), Query Frame = 1
Query:  754 HLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            +LW+FLL LL D    P  I W  +    FKLV S  V++LWG+ K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:  205 YLWEFLLALLQDKATCPKYIKWTQREKGIFKLVDSKAVSRLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 285          
BLAST of ETS domain-containing protein vs. Ensembl Xenopus
Match: oat (ornithine aminotransferase [Source:Xenbase;Acc:XB-GENE-5969095])

HSP 1 Score: 109.768 bits (273), Expect = 1.743e-25
Identity = 48/81 (59.26%), Postives = 56/81 (69.14%), Query Frame = 1
Query:  754 HLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            +LW+FLL LL D    P  I W  +    FKLV S  V++LWG+ K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:  205 YLWEFLLALLQDKATCPKYIKWTQREKGIFKLVDSKAVSRLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 285          
BLAST of ETS domain-containing protein vs. Ensembl Xenopus
Match: plekhm2 (pleckstrin homology and RUN domain containing M2 [Source:Xenbase;Acc:XB-GENE-5717447])

HSP 1 Score: 108.997 bits (271), Expect = 2.274e-25
Identity = 49/84 (58.33%), Postives = 57/84 (67.86%), Query Frame = 1
Query:  745 NGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            N  +LW+FLL LL D    P  I W  +    FKLV S  V++LWG+ K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:  146 NTTYLWEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSRLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 229          
BLAST of ETS domain-containing protein vs. Ensembl Xenopus
Match: plekhm2 (pleckstrin homology and RUN domain containing M2 [Source:Xenbase;Acc:XB-GENE-5717447])

HSP 1 Score: 108.997 bits (271), Expect = 2.343e-25
Identity = 49/84 (58.33%), Postives = 57/84 (67.86%), Query Frame = 1
Query:  745 NGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            N  +LW+FLL LL D    P  I W  +    FKLV S  V++LWG+ K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:  207 NTTYLWEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSRLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 290          
BLAST of ETS domain-containing protein vs. Ensembl Xenopus
Match: fli1 (Fli-1 proto-oncogene, ETS transcription factor [Source:NCBI gene;Acc:100124738])

HSP 1 Score: 97.4413 bits (241), Expect = 1.074e-21
Identity = 49/105 (46.67%), Postives = 65/105 (61.90%), Query Frame = 1
Query:  682 SEPETKSLSMKNSSFHSNSGKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            S+P+   +    SS  +N G     LWQFLL LL D+  N S ITW + T+  FK+     VA+ WGE+K KP MNY+ + RALRYYY +NIM K+ G+R  Y+F
Sbjct:  260 SQPDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSS-NASCITW-EGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 362          
BLAST of ETS domain-containing protein vs. Ensembl Mouse
Match: Elf4 (E74-like factor 4 (ets domain transcription factor) [Source:MGI Symbol;Acc:MGI:1928377])

HSP 1 Score: 112.464 bits (280), Expect = 2.785e-27
Identity = 53/90 (58.89%), Postives = 60/90 (66.67%), Query Frame = 1
Query:  730 SNSGKNG-CHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            S  GK    +LW+FLL LL D    P  I W  +    FKLV S  V+KLWG+QK KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:  200 SKDGKGSTIYLWEFLLALLQDRNTCPKYIKWTQREKGIFKLVDSKAVSKLWGKQKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 289          
BLAST of ETS domain-containing protein vs. Ensembl Mouse
Match: Elf4 (E74-like factor 4 (ets domain transcription factor) [Source:MGI Symbol;Acc:MGI:1928377])

HSP 1 Score: 112.464 bits (280), Expect = 1.421e-26
Identity = 53/90 (58.89%), Postives = 60/90 (66.67%), Query Frame = 1
Query:  730 SNSGKNG-CHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            S  GK    +LW+FLL LL D    P  I W  +    FKLV S  V+KLWG+QK KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:  200 SKDGKGSTIYLWEFLLALLQDRNTCPKYIKWTQREKGIFKLVDSKAVSKLWGKQKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 289          
BLAST of ETS domain-containing protein vs. Ensembl Mouse
Match: Elf4 (E74-like factor 4 (ets domain transcription factor) [Source:MGI Symbol;Acc:MGI:1928377])

HSP 1 Score: 112.464 bits (280), Expect = 1.421e-26
Identity = 53/90 (58.89%), Postives = 60/90 (66.67%), Query Frame = 1
Query:  730 SNSGKNG-CHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            S  GK    +LW+FLL LL D    P  I W  +    FKLV S  V+KLWG+QK KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:  200 SKDGKGSTIYLWEFLLALLQDRNTCPKYIKWTQREKGIFKLVDSKAVSKLWGKQKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 289          
BLAST of ETS domain-containing protein vs. Ensembl Mouse
Match: Elf2 (E74-like factor 2 [Source:MGI Symbol;Acc:MGI:1916507])

HSP 1 Score: 110.153 bits (274), Expect = 5.484e-26
Identity = 57/122 (46.72%), Postives = 71/122 (58.20%), Query Frame = 1
Query:  631 VFLNTELTSKDNNSDINSEPETKSLSMKNSSFHSNSGKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            V ++TE +   + S I + P++     K          N  +LW+FLL LL D    P  I W  +    FKLV S  V+KLWG+ K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:   86 VEVSTEESEPMDASPIPTSPDSHEPMKKKKG-------NTTYLWEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 200          
BLAST of ETS domain-containing protein vs. Ensembl Mouse
Match: Elf2 (E74-like factor 2 [Source:MGI Symbol;Acc:MGI:1916507])

HSP 1 Score: 110.538 bits (275), Expect = 6.975e-26
Identity = 50/84 (59.52%), Postives = 57/84 (67.86%), Query Frame = 1
Query:  745 NGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            N  +LW+FLL LL D    P  I W  +    FKLV S  V+KLWG+ K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:  206 NTTYLWEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 289          
BLAST of ETS domain-containing protein vs. UniProt/SwissProt
Match: sp|P20105|E74EA_DROME (Ecdysone-induced protein 74EF isoform A OS=Drosophila melanogaster OX=7227 GN=Eip74EF PE=2 SV=2)

HSP 1 Score: 115.546 bits (288), Expect = 1.287e-26
Identity = 49/82 (59.76%), Postives = 60/82 (73.17%), Query Frame = 1
Query:  754 HLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQFI 999
            +LW+FLL+LL D +Y P  I W ++    FKLV S  V++LWG  K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF+
Sbjct:  734 YLWEFLLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQRGILAKVDGQRLVYQFV 815          
BLAST of ETS domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7M3M6|E74EF_DROVI (Ecdysone-induced protein 74EF OS=Drosophila virilis OX=7244 GN=Eip74EF PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.372e-26
Identity = 49/82 (59.76%), Postives = 60/82 (73.17%), Query Frame = 1
Query:  754 HLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQFI 999
            +LW+FLL+LL D +Y P  I W ++    FKLV S  V++LWG  K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF+
Sbjct:  778 YLWEFLLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQRGILAKVDGQRLVYQFV 859          
BLAST of ETS domain-containing protein vs. UniProt/SwissProt
Match: sp|P11536|E74EB_DROME (Ecdysone-induced protein 74EF isoform B OS=Drosophila melanogaster OX=7227 GN=Eip74EF PE=2 SV=2)

HSP 1 Score: 114.775 bits (286), Expect = 2.003e-26
Identity = 49/83 (59.04%), Postives = 60/83 (72.29%), Query Frame = 1
Query:  751 CHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQFI 999
             +LW+FLL+LL D +Y P  I W ++    FKLV S  V++LWG  K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF+
Sbjct:  787 TYLWEFLLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQRGILAKVDGQRLVYQFV 869          
BLAST of ETS domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Z2U4|ELF4_MOUSE (ETS-related transcription factor Elf-4 OS=Mus musculus OX=10090 GN=Elf4 PE=1 SV=2)

HSP 1 Score: 112.464 bits (280), Expect = 9.937e-26
Identity = 53/90 (58.89%), Postives = 60/90 (66.67%), Query Frame = 1
Query:  730 SNSGKNG-CHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            S  GK    +LW+FLL LL D    P  I W  +    FKLV S  V+KLWG+QK KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:  200 SKDGKGSTIYLWEFLLALLQDRNTCPKYIKWTQREKGIFKLVDSKAVSKLWGKQKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 289          
BLAST of ETS domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99607|ELF4_HUMAN (ETS-related transcription factor Elf-4 OS=Homo sapiens OX=9606 GN=ELF4 PE=1 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 1.139e-25
Identity = 53/90 (58.89%), Postives = 60/90 (66.67%), Query Frame = 1
Query:  730 SNSGKNG-CHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            S  GK    +LW+FLL LL D    P  I W  +    FKLV S  V+KLWG+QK KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:  201 SKDGKGSTIYLWEFLLALLQDRNTCPKYIKWTQREKGIFKLVDSKAVSKLWGKQKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 290          
BLAST of ETS domain-containing protein vs. TrEMBL
Match: A0A5J4NSG5 (E74-like factor 1/2/4 OS=Paragonimus westermani OX=34504 GN=DEA37_0007993 PE=3 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 4.582e-31
Identity = 56/81 (69.14%), Postives = 66/81 (81.48%), Query Frame = 1
Query:  757 LWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQFI 999
            L QFL RLL +  YNP +I W+D+T  TFKLV SA VAKLWG  K+KP MNYETMGRA+RYYYA+NI+RK+ GQRLVYQF+
Sbjct:   98 LSQFLRRLLSNADYNPELICWVDQTKNTFKLVNSAAVAKLWGVHKQKPNMNYETMGRAMRYYYAQNILRKVKGQRLVYQFL 178          
BLAST of ETS domain-containing protein vs. TrEMBL
Match: A0A183NIV5 (ETS domain-containing protein OS=Schistosoma mattheei OX=31246 PE=3 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 3.378e-29
Identity = 59/103 (57.28%), Postives = 72/103 (69.90%), Query Frame = 1
Query:  691 ETKSLSMKNSSFHSNSGKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQFI 999
            +++S S+K S F          L QFL  LL  ++YNP +I W+DK+   FKLV SA VA LWG  K KP MNYETMGRALRYYYA+NI+RK+ GQRLVYQF+
Sbjct:   73 KSRSFSLKRSPFK---------LSQFLYYLLNKSEYNPHLICWVDKSQNMFKLVNSAAVAHLWGLHKHKPNMNYETMGRALRYYYAQNILRKVKGQRLVYQFL 166          
BLAST of ETS domain-containing protein vs. TrEMBL
Match: A0A3P7ZHS4 (ETS domain-containing protein (Fragment) OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS2040 PE=3 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 3.413e-29
Identity = 59/103 (57.28%), Postives = 72/103 (69.90%), Query Frame = 1
Query:  691 ETKSLSMKNSSFHSNSGKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQFI 999
            +++S S+K S F          L QFL  LL  ++YNP +I W+DK+   FKLV SA VA LWG  K KP MNYETMGRALRYYYA+NI+RK+ GQRLVYQF+
Sbjct:   73 KSRSFSLKRSPFK---------LSQFLYYLLNKSEYNPHLICWVDKSQNMFKLVNSAAVAHLWGLHKHKPNMNYETMGRALRYYYAQNILRKVKGQRLVYQFL 166          
BLAST of ETS domain-containing protein vs. TrEMBL
Match: A0A2G9U6L1 (Ets-domain protein OS=Teladorsagia circumcincta OX=45464 GN=TELCIR_12433 PE=3 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 4.423e-29
Identity = 52/82 (63.41%), Postives = 63/82 (76.83%), Query Frame = 1
Query:  754 HLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQFI 999
            +LW+FLLRLL D +Y P  I WID++   FKLV S  V++LWG  K KP MNYETMGRALRYYY R I++K+ GQRLVYQF+
Sbjct:   47 YLWEFLLRLLQDKEYCPKFIKWIDQSKGVFKLVDSKAVSRLWGMHKNKPGMNYETMGRALRYYYQRGILQKVDGQRLVYQFV 128          
BLAST of ETS domain-containing protein vs. TrEMBL
Match: A0A0D6M105 (Ets-domain protein OS=Ancylostoma ceylanicum OX=53326 GN=ANCCEY_04867 PE=3 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 5.184e-29
Identity = 52/83 (62.65%), Postives = 63/83 (75.90%), Query Frame = 1
Query:  751 CHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQFI 999
             +LW+FLLRLL D +Y P  I WID++   FKLV S  V++LWG  K KP MNYETMGRALRYYY R I++K+ GQRLVYQF+
Sbjct:   54 TYLWEFLLRLLQDKEYCPKFIKWIDQSKGVFKLVDSKAVSRLWGMHKNKPGMNYETMGRALRYYYQRGILQKVDGQRLVYQFV 136          
BLAST of ETS domain-containing protein vs. Ensembl Cavefish
Match: elf2b (ETS-related transcription factor Elf-2-like [Source:NCBI gene;Acc:103037959])

HSP 1 Score: 113.62 bits (283), Expect = 4.348e-27
Identity = 52/89 (58.43%), Postives = 59/89 (66.29%), Query Frame = 1
Query:  730 SNSGKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            S  GK   +LW+FLL LL D    P  I W  +    FKLV S  V+KLWG+ K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:  142 SREGKGSTYLWEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILSKVEGQRLVYQF 230          
BLAST of ETS domain-containing protein vs. Ensembl Cavefish
Match: elf2b (ETS-related transcription factor Elf-2-like [Source:NCBI gene;Acc:103037959])

HSP 1 Score: 113.62 bits (283), Expect = 4.451e-27
Identity = 52/89 (58.43%), Postives = 59/89 (66.29%), Query Frame = 1
Query:  730 SNSGKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            S  GK   +LW+FLL LL D    P  I W  +    FKLV S  V+KLWG+ K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:  136 SREGKGSTYLWEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILSKVEGQRLVYQF 224          
BLAST of ETS domain-containing protein vs. Ensembl Cavefish
Match: elf2a (ETS-related transcription factor Elf-2 [Source:NCBI gene;Acc:103024970])

HSP 1 Score: 112.464 bits (280), Expect = 7.671e-27
Identity = 50/81 (61.73%), Postives = 58/81 (71.60%), Query Frame = 1
Query:  754 HLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            +LW+FLL LL D +  P  I W +K    FKLV S  V+KLWG+ K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:  164 YLWEFLLDLLQDKETCPKYIKWTEKEKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILSKVEGQRLVYQF 244          
BLAST of ETS domain-containing protein vs. Ensembl Cavefish
Match: elf2a (ETS-related transcription factor Elf-2 [Source:NCBI gene;Acc:103024970])

HSP 1 Score: 112.079 bits (279), Expect = 9.070e-27
Identity = 50/81 (61.73%), Postives = 58/81 (71.60%), Query Frame = 1
Query:  754 HLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            +LW+FLL LL D +  P  I W +K    FKLV S  V+KLWG+ K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:  192 YLWEFLLDLLQDKETCPKYIKWTEKEKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILSKVEGQRLVYQF 272          
BLAST of ETS domain-containing protein vs. Ensembl Cavefish
Match: elf2a (ETS-related transcription factor Elf-2 [Source:NCBI gene;Acc:103024970])

HSP 1 Score: 112.079 bits (279), Expect = 1.008e-26
Identity = 50/81 (61.73%), Postives = 58/81 (71.60%), Query Frame = 1
Query:  754 HLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            +LW+FLL LL D +  P  I W +K    FKLV S  V+KLWG+ K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:  192 YLWEFLLDLLQDKETCPKYIKWTEKEKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILSKVEGQRLVYQF 272          
BLAST of ETS domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010868.1 (pep scaffold:Pmarinus_7.0:GL477036:347958:349079:-1 gene:ENSPMAG00000009848.1 transcript:ENSPMAT00000010868.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.612 bits (270), Expect = 1.737e-29
Identity = 49/82 (59.76%), Postives = 58/82 (70.73%), Query Frame = 1
Query:  751 CHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
             +LW+FLL LL D    P +I W +K    FKLV S  V++LWG+ K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:    4 VYLWEFLLSLLQDKNTCPRLIKWTEKEKGIFKLVDSKAVSRLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 85          
BLAST of ETS domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010869.1 (pep scaffold:Pmarinus_7.0:GL477036:348366:352508:-1 gene:ENSPMAG00000009848.1 transcript:ENSPMAT00000010869.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.923 bits (276), Expect = 1.070e-28
Identity = 63/142 (44.37%), Postives = 80/142 (56.34%), Query Frame = 1
Query:  577 LTREDFKKNKLDQTNSDSVFLNTELTSKDNNSDINSE--PETKSLSMKNSSFHSNSGKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            L   +F K +L    ++   L + LT K  +S   S   P    L  K+   H+       +LW+FLL LL D    P +I W +K    FKLV S  V++LWG+ K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:   84 LVELNFAKARLSSPVNELTSLGS-LTRKPKSSRPCSPILPTDGPLRKKSREGHT------VYLWEFLLSLLQDKNTCPRLIKWTEKEKGIFKLVDSKAVSRLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 218          
BLAST of ETS domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010870.1 (pep scaffold:Pmarinus_7.0:GL477036:348390:353437:-1 gene:ENSPMAG00000009848.1 transcript:ENSPMAT00000010870.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.923 bits (276), Expect = 1.374e-28
Identity = 49/81 (60.49%), Postives = 58/81 (71.60%), Query Frame = 1
Query:  754 HLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            +LW+FLL LL D    P +I W +K    FKLV S  V++LWG+ K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:  156 YLWEFLLSLLQDKNTCPRLIKWTEKEKGIFKLVDSKAVSRLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 236          
BLAST of ETS domain-containing protein vs. Ensembl Sea Lamprey
Match: fli1a (Fli-1 proto-oncogene, ETS transcription factor a [Source:ZFIN;Acc:ZDB-GENE-980526-426])

HSP 1 Score: 93.5893 bits (231), Expect = 1.162e-22
Identity = 48/114 (42.11%), Postives = 70/114 (61.40%), Query Frame = 1
Query:  655 SKDNNSDINSEPETKSLSMKNSSFHSNSGKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            S + +++  ++P+   +    SS  +N G     LWQFLL LL D+  N + ITW + T+  FK+     VA+ WGE+K KP MNY+ + RALRYYY +NIM K+ G+R  Y+F
Sbjct:    2 SLNKSTEGRTQPDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSS-NANCITW-EGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 113          
BLAST of ETS domain-containing protein vs. Ensembl Sea Lamprey
Match: ehf (ets homologous factor [Source:ZFIN;Acc:ZDB-GENE-060312-7])

HSP 1 Score: 84.7297 bits (208), Expect = 1.068e-20
Identity = 36/83 (43.37%), Postives = 55/83 (66.27%), Query Frame = 1
Query:  748 GCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            G HLW+F+  LL   + NP ++ W D+    F+ V+S  VA+LWG++K    M YE + RA+RYYY + I+ ++ G+RLVY+F
Sbjct:    2 GNHLWEFIRDLLLQPEQNPGLLKWEDRRQGVFRFVKSDAVARLWGKKKNNSSMTYEKLSRAMRYYYKKEILDRVDGRRLVYKF 84          
BLAST of ETS domain-containing protein vs. Ensembl Nematostella
Match: EDO49143 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH18])

HSP 1 Score: 101.293 bits (251), Expect = 1.599e-26
Identity = 44/85 (51.76%), Postives = 59/85 (69.41%), Query Frame = 1
Query:  754 HLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQFIASS 1008
            HLW+FL  LL + +  P  ITWI +    F+LV S  VAKLWG++K +  MNYE M RALRYYY R+I+ ++ GQRL+Y+F A +
Sbjct:    3 HLWEFLKELLENEETCPRYITWISREEGVFRLVNSGAVAKLWGQRKNRRNMNYEKMSRALRYYYERHILERVPGQRLIYKFAADT 87          
BLAST of ETS domain-containing protein vs. Ensembl Nematostella
Match: EDO44339 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW27])

HSP 1 Score: 97.0561 bits (240), Expect = 3.994e-25
Identity = 43/81 (53.09%), Postives = 59/81 (72.84%), Query Frame = 1
Query:  754 HLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            HLW+FLL LL D +Y+ SII+W ++ S  FKL+    VA+ WG  K +P MNY+ + RALRYYY + I++K+ GQRLVY+F
Sbjct:    4 HLWEFLLDLLADGRYS-SIISWTNRESGEFKLLNQEEVARRWGHLKHRPGMNYDKLSRALRYYYQKGIIKKVHGQRLVYKF 83          
BLAST of ETS domain-containing protein vs. Ensembl Nematostella
Match: EDO46190 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM1])

HSP 1 Score: 93.5893 bits (231), Expect = 8.075e-24
Identity = 40/81 (49.38%), Postives = 55/81 (67.90%), Query Frame = 1
Query:  754 HLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            HLW+FL  LL +  Y+P  ITW+ +    F+LV S  VA+LWG++K +  M YE M RA+RYYY R I++ + GQ+L YQF
Sbjct:    2 HLWEFLEELLDNKAYSPKFITWVSRDDGMFRLVDSKAVARLWGQRKNRHDMTYEKMSRAIRYYYERKIIKHVDGQKLNYQF 82          
BLAST of ETS domain-containing protein vs. Ensembl Nematostella
Match: EDO45310 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSZ6])

HSP 1 Score: 92.0485 bits (227), Expect = 3.769e-23
Identity = 42/82 (51.22%), Postives = 58/82 (70.73%), Query Frame = 1
Query:  754 HLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQFI 999
            HLW+FLL LL D     S+I+W  K    FKL     VA+ WG+ K++P MNY+ + RALRYYY +NI++K++GQRLVY+F+
Sbjct:    4 HLWEFLLELLADESC-ASMISWTKKEEGEFKLRNQEEVARRWGDLKQRPGMNYDKLSRALRYYYQKNIIKKVNGQRLVYKFV 84          
BLAST of ETS domain-containing protein vs. Ensembl Nematostella
Match: EDO39973 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8F6])

HSP 1 Score: 90.8929 bits (224), Expect = 1.738e-22
Identity = 46/96 (47.92%), Postives = 60/96 (62.50%), Query Frame = 1
Query:  709 MKNSSFHSNSGKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            M + +    +G     LWQFLL LL D K N + I W + T+  FKLV    VA+ WGE+K KP MNY+ + RALRYYY +NIM KI G+R  Y++
Sbjct:    1 MPHRADTPATGSGQIQLWQFLLELLSDPK-NANCIAW-EGTNGEFKLVDPDEVARRWGERKNKPNMNYDKLSRALRYYYDKNIMTKIHGKRYAYKY 94          
BLAST of ETS domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000027249.1 (ETS-related transcription factor Elf-1-like [Source:NCBI gene;Acc:105358126])

HSP 1 Score: 118.242 bits (295), Expect = 1.052e-29
Identity = 55/105 (52.38%), Postives = 69/105 (65.71%), Query Frame = 1
Query:  682 SEPETKSLSMKNSSFHSNSGKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            +E  T  +++K   +  N G N  +LWQFL+ LL D +  P  I W +  +  FKLV S  VA+LWG+ K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:  154 AESPTPEITVKKDKY--NKGGNTLYLWQFLMELLQDRQVCPRYIKWTNPQAGIFKLVNSKAVARLWGKHKNKPDMNYETMGRALRYYYQRGILNKVEGQRLVYQF 256          
BLAST of ETS domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000030194.1 (ETS-related transcription factor Elf-1-like [Source:NCBI gene;Acc:105358126])

HSP 1 Score: 118.627 bits (296), Expect = 2.641e-29
Identity = 55/107 (51.40%), Postives = 70/107 (65.42%), Query Frame = 1
Query:  682 SEPETKSLSMKNSSFHSNSGKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQFIA 1002
            +E  T  +++K   +  N G N  +LWQFL+ LL D +  P  I W +  +  FKLV S  VA+LWG+ K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF +
Sbjct:  154 AESPTPEITVKKDKY--NKGGNTLYLWQFLMELLQDRQVCPRYIKWTNPQAGIFKLVNSKAVARLWGKHKNKPDMNYETMGRALRYYYQRGILNKVEGQRLVYQFTS 258          
BLAST of ETS domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000038111.1 (ETS-related transcription factor Elf-1-like [Source:NCBI gene;Acc:105358126])

HSP 1 Score: 114.005 bits (284), Expect = 1.217e-28
Identity = 55/107 (51.40%), Postives = 70/107 (65.42%), Query Frame = 1
Query:  682 SEPETKSLSMKNSSFHSNSGKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQFIA 1002
            +E  T  +++K   +  N G N  +LWQFL+ LL D +  P  I W +  +  FKLV S  VA+LWG+ K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF +
Sbjct:  145 AESPTPEITVKKDKY--NKG-NTLYLWQFLMELLQDRQVCPRYIKWTNPQAGIFKLVNSKAVARLWGKHKNKPDMNYETMGRALRYYYQRGILNKVEGQRLVYQFTS 248          
BLAST of ETS domain-containing protein vs. Ensembl Medaka
Match: elf1 (E74 like ETS transcription factor 4 [Source:NCBI gene;Acc:101161899])

HSP 1 Score: 112.079 bits (279), Expect = 1.519e-26
Identity = 53/90 (58.89%), Postives = 60/90 (66.67%), Query Frame = 1
Query:  730 SNSGK-NGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            S  GK N  +LW+FLL LL D    P  I W  +    FKLV S  V+KLWG+ K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:  195 SKEGKGNTIYLWEFLLALLQDKNTCPKYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 284          
BLAST of ETS domain-containing protein vs. Ensembl Medaka
Match: elf1 (E74 like ETS transcription factor 4 [Source:NCBI gene;Acc:101161899])

HSP 1 Score: 112.079 bits (279), Expect = 1.519e-26
Identity = 53/90 (58.89%), Postives = 60/90 (66.67%), Query Frame = 1
Query:  730 SNSGK-NGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            S  GK N  +LW+FLL LL D    P  I W  +    FKLV S  V+KLWG+ K KP MNYETMGRALRYYY R I+ K+ GQRLVYQF
Sbjct:  195 SKEGKGNTIYLWEFLLALLQDKNTCPKYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 284          
BLAST of ETS domain-containing protein vs. Planmine SMEST
Match: SMESG000009191.1 (SMESG000009191.1)

HSP 1 Score: 473.781 bits (1218), Expect = 1.210e-169
Identity = 244/246 (99.19%), Postives = 245/246 (99.59%), Query Frame = 1
Query:  286 MENTIKAHSNSERKNEKSHQTLFPDIPLDLSRTNQKLEENSNGKNQMLQYLQSNPVYIEQMFKALSDLNNQRGFISGNMFNCFYQXXXXXXXXXXXXLTREDFKKNKLDQTNSDSVFLNTELTSKDNNSDINSEPETKSLSMKNSSFHSNSGKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQFIASSDSNLT 1023
            MENTIKAHSNSERKNEKSHQTLFPDIPLDLSRTNQKLEENSNGKNQMLQYLQSNPVYIEQMFKALSDLNNQRGFISGN+FNCFYQNFSNFNNVISNNLTREDFKKNKLDQTNSDSVFLNTELTSKDNNSDINSEPETKSLSMKNSSFHSNSGKNGCHLWQFLLRLLGDTKYNPSIITWIDK SKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQFIASSDSNLT
Sbjct:    1 MENTIKAHSNSERKNEKSHQTLFPDIPLDLSRTNQKLEENSNGKNQMLQYLQSNPVYIEQMFKALSDLNNQRGFISGNIFNCFYQNFSNFNNVISNNLTREDFKKNKLDQTNSDSVFLNTELTSKDNNSDINSEPETKSLSMKNSSFHSNSGKNGCHLWQFLLRLLGDTKYNPSIITWIDKNSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQFIASSDSNLT 246          
BLAST of ETS domain-containing protein vs. Planmine SMEST
Match: SMESG000008885.1 (SMESG000008885.1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.217e-21
Identity = 41/80 (51.25%), Postives = 59/80 (73.75%), Query Frame = 1
Query:  757 LWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            LWQFLL LL D++++  +I W  +  K FKL++   VA+LWG QK +P MNY+ + R+LRYYY +NIM+K+ G+R VY+F
Sbjct:  188 LWQFLLSLLHDSRHS-RVICWTGR-DKEFKLIEPEEVARLWGAQKNRPAMNYDKLSRSLRYYYDKNIMQKVPGERYVYKF 265          
BLAST of ETS domain-containing protein vs. Planmine SMEST
Match: SMESG000033317.1 (SMESG000033317.1)

HSP 1 Score: 94.7449 bits (234), Expect = 4.535e-21
Identity = 47/90 (52.22%), Postives = 60/90 (66.67%), Query Frame = 1
Query:  733 NSGKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQFIA 1002
            NS K    LWQFL  LL + K N  IITW  K S  FKL+    VAKLWG QK +P MNY+ + R+LRYYY + IM+K++G+R +Y+FI 
Sbjct:  143 NSQKRSLQLWQFLKSLLDNHK-NIHIITWTGK-SLEFKLIDPEEVAKLWGLQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYMYKFIC 230          
BLAST of ETS domain-containing protein vs. Planmine SMEST
Match: SMESG000080027.1 (SMESG000080027.1)

HSP 1 Score: 93.9745 bits (232), Expect = 7.326e-21
Identity = 45/86 (52.33%), Postives = 57/86 (66.28%), Query Frame = 1
Query:  739 GKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            G     LWQFLL LL D++ N S I W + T+  FKLV    VA+ WGE+K KP MNY+ + RALRYYY +NIM K+ G+R  Y+F
Sbjct:  134 GSGQIQLWQFLLELLSDSR-NISCIIW-EGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKF 217          
BLAST of ETS domain-containing protein vs. Planmine SMEST
Match: SMESG000078333.1 (SMESG000078333.1)

HSP 1 Score: 93.2041 bits (230), Expect = 7.987e-21
Identity = 44/86 (51.16%), Postives = 58/86 (67.44%), Query Frame = 1
Query:  739 GKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGEQKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQF 996
            G     LWQFLL LL D++ N + ITW + T+  FKL+    VA+ WGE+K KP MNY+ + RALRYYY +NIM K+ G+R  Y+F
Sbjct:   77 GSGQIQLWQFLLELLSDSR-NTTFITW-EGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 160          
The following BLAST results are available for this feature:
BLAST of ETS domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ELF22.599e-2844.96E74 like ETS transcription factor 2 [Source:HGNC S... [more]
ELF42.372e-2658.89E74 like ETS transcription factor 4 [Source:HGNC S... [more]
ELF42.372e-2658.89E74 like ETS transcription factor 4 [Source:HGNC S... [more]
ELF43.640e-2658.89E74 like ETS transcription factor 4 [Source:HGNC S... [more]
ELF26.050e-2646.72E74 like ETS transcription factor 2 [Source:HGNC S... [more]
back to top
BLAST of ETS domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
elf-15.791e-3152.83ETS-Like transcription Factor homolog [Source:Uni... [more]
elf-15.791e-3152.83ETS-Like transcription Factor homolog [Source:Uni... [more]
elf-18.186e-3152.83ETS-Like transcription Factor homolog [Source:Uni... [more]
elf-18.186e-3152.83ETS-Like transcription Factor homolog [Source:Uni... [more]
ast-11.301e-2350.49Axon STeering defect [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of ETS domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eip74EF1.272e-2759.76gene:FBgn0000567 transcript:FBtr0305796[more]
Eip74EF1.284e-2759.76gene:FBgn0000567 transcript:FBtr0075202[more]
Eip74EF1.570e-2759.76gene:FBgn0000567 transcript:FBtr0075203[more]
Eip74EF1.998e-2759.04gene:FBgn0000567 transcript:FBtr0075204[more]
Eip74EF1.998e-2759.04gene:FBgn0000567 transcript:FBtr0100411[more]
back to top
BLAST of ETS domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
elf2b2.662e-2758.43E74-like factor 2b (ets domain transcription facto... [more]
elf2b3.283e-2758.43E74-like factor 2b (ets domain transcription facto... [more]
elf2b3.283e-2758.43E74-like factor 2b (ets domain transcription facto... [more]
elf2b3.675e-2758.43E74-like factor 2b (ets domain transcription facto... [more]
elf2b3.675e-2758.43E74-like factor 2b (ets domain transcription facto... [more]
back to top
BLAST of ETS domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
oat1.568e-2559.26ornithine aminotransferase [Source:Xenbase;Acc:XB-... [more]
oat1.743e-2559.26ornithine aminotransferase [Source:Xenbase;Acc:XB-... [more]
plekhm22.274e-2558.33pleckstrin homology and RUN domain containing M2 [... [more]
plekhm22.343e-2558.33pleckstrin homology and RUN domain containing M2 [... [more]
fli11.074e-2146.67Fli-1 proto-oncogene, ETS transcription factor [So... [more]
back to top
BLAST of ETS domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Elf42.785e-2758.89E74-like factor 4 (ets domain transcription factor... [more]
Elf41.421e-2658.89E74-like factor 4 (ets domain transcription factor... [more]
Elf41.421e-2658.89E74-like factor 4 (ets domain transcription factor... [more]
Elf25.484e-2646.72E74-like factor 2 [Source:MGI Symbol;Acc:MGI:19165... [more]
Elf26.975e-2659.52E74-like factor 2 [Source:MGI Symbol;Acc:MGI:19165... [more]
back to top
BLAST of ETS domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P20105|E74EA_DROME1.287e-2659.76Ecdysone-induced protein 74EF isoform A OS=Drosoph... [more]
sp|Q7M3M6|E74EF_DROVI1.372e-2659.76Ecdysone-induced protein 74EF OS=Drosophila virili... [more]
sp|P11536|E74EB_DROME2.003e-2659.04Ecdysone-induced protein 74EF isoform B OS=Drosoph... [more]
sp|Q9Z2U4|ELF4_MOUSE9.937e-2658.89ETS-related transcription factor Elf-4 OS=Mus musc... [more]
sp|Q99607|ELF4_HUMAN1.139e-2558.89ETS-related transcription factor Elf-4 OS=Homo sap... [more]
back to top
BLAST of ETS domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NSG54.582e-3169.14E74-like factor 1/2/4 OS=Paragonimus westermani OX... [more]
A0A183NIV53.378e-2957.28ETS domain-containing protein OS=Schistosoma matth... [more]
A0A3P7ZHS43.413e-2957.28ETS domain-containing protein (Fragment) OS=Schist... [more]
A0A2G9U6L14.423e-2963.41Ets-domain protein OS=Teladorsagia circumcincta OX... [more]
A0A0D6M1055.184e-2962.65Ets-domain protein OS=Ancylostoma ceylanicum OX=53... [more]
back to top
BLAST of ETS domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
elf2b4.348e-2758.43ETS-related transcription factor Elf-2-like [Sourc... [more]
elf2b4.451e-2758.43ETS-related transcription factor Elf-2-like [Sourc... [more]
elf2a7.671e-2761.73ETS-related transcription factor Elf-2 [Source:NCB... [more]
elf2a9.070e-2761.73ETS-related transcription factor Elf-2 [Source:NCB... [more]
elf2a1.008e-2661.73ETS-related transcription factor Elf-2 [Source:NCB... [more]
back to top
BLAST of ETS domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010868.11.737e-2959.76pep scaffold:Pmarinus_7.0:GL477036:347958:349079:-... [more]
ENSPMAT00000010869.11.070e-2844.37pep scaffold:Pmarinus_7.0:GL477036:348366:352508:-... [more]
ENSPMAT00000010870.11.374e-2860.49pep scaffold:Pmarinus_7.0:GL477036:348390:353437:-... [more]
fli1a1.162e-2242.11Fli-1 proto-oncogene, ETS transcription factor a [... [more]
ehf1.068e-2043.37ets homologous factor [Source:ZFIN;Acc:ZDB-GENE-06... [more]
back to top
BLAST of ETS domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ETS domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO491431.599e-2651.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO443393.994e-2553.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461908.075e-2449.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453103.769e-2351.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399731.738e-2247.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ETS domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000027249.11.052e-2952.38ETS-related transcription factor Elf-1-like [Sourc... [more]
ENSORLT00000030194.12.641e-2951.40ETS-related transcription factor Elf-1-like [Sourc... [more]
ENSORLT00000038111.11.217e-2851.40ETS-related transcription factor Elf-1-like [Sourc... [more]
elf11.519e-2658.89E74 like ETS transcription factor 4 [Source:NCBI g... [more]
elf11.519e-2658.89E74 like ETS transcription factor 4 [Source:NCBI g... [more]
back to top
BLAST of ETS domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009191.11.210e-16999.19SMESG000009191.1[more]
SMESG000008885.11.217e-2151.25SMESG000008885.1[more]
SMESG000033317.14.535e-2152.22SMESG000033317.1[more]
SMESG000080027.17.326e-2152.33SMESG000080027.1[more]
SMESG000078333.17.987e-2151.16SMESG000078333.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020689 ID=SMED30020689|Name=ETS domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1152bp
AACCTAGATACTGAATGTATTGTATTGAAACACTTACCTAACCTGGTAGT
TGGTCTCACAAGTATTTGATAACCAATTTAAAAGCACGCTAACAACTACG
GCACACTTGTGTAAAAGGATCCAGATTTCGATTAGTCAGTACGATTATCA
TTTAAAAATTTCTGCTGTTTTACTCAGTTGGCATCAACTATAAACAGTTT
TTTTTTCACTGATAGTTTTTTATTTCTTATTTTTATACTTCCATAAATAT
TCTGTGGGAATCTTTTTTTTAATTTTTTATGGATAATGGAAAACACAATT
AAAGCCCATTCAAATTCAGAAAGAAAAAATGAGAAATCACACCAGACTTT
ATTTCCTGATATCCCATTGGATTTATCGAGGACCAATCAGAAATTGGAAG
AGAATTCAAATGGAAAAAATCAAATGCTACAATATCTTCAAAGTAACCCA
GTATATATAGAACAAATGTTTAAAGCATTGTCTGATTTGAATAATCAGCG
TGGATTTATTTCAGGAAATATGTTCAATTGCTTTTACCAGAATTTTTCCA
ATTTTAATAACGTGATATCGAATAATTTGACGCGCGAAGATTTCAAAAAG
AATAAACTTGATCAAACTAACTCAGATTCTGTATTCCTCAACACAGAGTT
GACTTCGAAAGATAATAATTCCGATATCAATTCTGAACCAGAAACAAAAT
CATTGTCCATGAAAAATTCATCGTTTCACTCAAATTCCGGCAAAAACGGT
TGTCACCTGTGGCAATTTCTTTTACGTCTTCTCGGTGATACAAAGTACAA
CCCCAGCATCATCACTTGGATTGATAAAACTTCGAAAACATTTAAATTAG
TTCAAAGTGCAACAGTTGCAAAACTGTGGGGAGAACAGAAAAAGAAGCCT
CGAATGAATTACGAAACGATGGGTCGGGCGTTAAGATATTATTATGCGCG
AAATATTATGAGAAAAATAAGTGGTCAGCGTTTAGTCTATCAATTTATTG
CCAGCTCTGATTCAAATTTAACTTGATAAATATTACCAAATGTTTCCTTT
CGTAAATGATATTGCTCAAAGATATTTTTTGTTTAAATTACATTTTCCTT
CAATTTTTATTAAGAGATGAAAATTGCTCATCTTATTAAATCTTTATCGT
TT
back to top

protein sequence of SMED30020689-orf-1

>SMED30020689-orf-1 ID=SMED30020689-orf-1|Name=SMED30020689-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=247bp
MENTIKAHSNSERKNEKSHQTLFPDIPLDLSRTNQKLEENSNGKNQMLQY
LQSNPVYIEQMFKALSDLNNQRGFISGNMFNCFYQNFSNFNNVISNNLTR
EDFKKNKLDQTNSDSVFLNTELTSKDNNSDINSEPETKSLSMKNSSFHSN
SGKNGCHLWQFLLRLLGDTKYNPSIITWIDKTSKTFKLVQSATVAKLWGE
QKKKPRMNYETMGRALRYYYARNIMRKISGQRLVYQFIASSDSNLT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR000418Ets_dom
IPR011991WHTH_DNA-bd_dom
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000418Ets domainPRINTSPR00454ETSDOMAINcoord: 220..238
score: 45.35
coord: 156..169
score: 54.63
coord: 182..200
score: 39.62
coord: 201..219
score: 61.09
IPR000418Ets domainSMARTSM00413etsneu2coord: 155..242
e-value: 1.7E-47
score: 173.8
IPR000418Ets domainPFAMPF00178Etscoord: 157..238
e-value: 2.3E-32
score: 111.3
IPR000418Ets domainPROSITEPS00346ETS_DOMAIN_2coord: 204..219
IPR000418Ets domainPROSITEPS00345ETS_DOMAIN_1coord: 158..166
IPR000418Ets domainPROSITEPS50061ETS_DOMAIN_3coord: 156..238
score: 26.846
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 117..246
e-value: 8.8E-40
score: 137.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 126..145
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..22
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..20
NoneNo IPR availablePANTHERPTHR11849:SF191ECDYSONE-INDUCED PROTEIN 74EF ISOFORM Bcoord: 45..239
NoneNo IPR availablePANTHERPTHR11849ETScoord: 45..239
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 154..239