Aspartate carbamoyltransferase

Overview
NameAspartate carbamoyltransferase
Smed IDSMED30020687
Length (bp)1449
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Aspartate carbamoyltransferase (SMED30020687) t-SNE clustered cells

Violin plots show distribution of expression levels for Aspartate carbamoyltransferase (SMED30020687) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Aspartate carbamoyltransferase (SMED30020687) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Aspartate carbamoyltransferase (SMED30020687) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020687

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30020687SMESG000012911.1 SmedASXL_018407SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30020687SMESG000012911.1 dd_Smed_v4_7167_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30020687SMESG000012911.1 dd_Smed_v4_7167_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020687SMESG000012911.1 dd_Smed_v4_7167_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020687SMESG000012911.1 Contig48530newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020687SMESG000012911.1 Contig48530uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
zeta neoblastSMED30020687SMESG000012911.1 dd_Smed_v4_7167_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Aspartate carbamoyltransferase vs. Ensembl Human
Match: CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:HGNC Symbol;Acc:HGNC:1424])

HSP 1 Score: 350.132 bits (897), Expect = 1.401e-106
Identity = 167/308 (54.22%), Postives = 223/308 (72.40%), Query Frame = 1
Query:  472 ITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMSHI 1395
            + G H L+V+   K +++H+ N+AH   ++ ++  +L  +L+GKV+  MFYE STRTS SF AAM +LGG+VL+F+E TSSV KGESL D+V+ +S Y D +V+RHP  GA+++ ++   +PVINAGDG GEHPTQALLDIFTIREE GTVN + ITMVGDL +GRTVHSLA LL  Y V LRYVA   S++MP ++  +V S+G  QEE   +E AL D+DV+YMTR+Q+ER     E +     +  +T  +M  AKK+M+VMHP+PR  EIS   DSDPRAAYFRQAE G+Y+RM+LLAT++   
Sbjct: 1921 LVGQHILSVQQFTKDQMSHLFNVAHTLRMMVQKERSLD-ILKGKVMASMFYEVSTRTSSSFAAAMARLGGAVLSFSEATSSVQKGESLADSVQTMSCYADVVVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVSLRYVA-PPSLRMPPTVRAFVASRGTKQEEFESIEEALPDTDVLYMTRIQKERFGSTQEYEA-CFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLATVLGRF 2225          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Human
Match: CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:HGNC Symbol;Acc:HGNC:1424])

HSP 1 Score: 350.132 bits (897), Expect = 1.500e-106
Identity = 167/308 (54.22%), Postives = 223/308 (72.40%), Query Frame = 1
Query:  472 ITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMSHI 1395
            + G H L+V+   K +++H+ N+AH   ++ ++  +L  +L+GKV+  MFYE STRTS SF AAM +LGG+VL+F+E TSSV KGESL D+V+ +S Y D +V+RHP  GA+++ ++   +PVINAGDG GEHPTQALLDIFTIREE GTVN + ITMVGDL +GRTVHSLA LL  Y V LRYVA   S++MP ++  +V S+G  QEE   +E AL D+DV+YMTR+Q+ER     E +     +  +T  +M  AKK+M+VMHP+PR  EIS   DSDPRAAYFRQAE G+Y+RM+LLAT++   
Sbjct: 1858 LVGQHILSVQQFTKDQMSHLFNVAHTLRMMVQKERSLD-ILKGKVMASMFYEVSTRTSSSFAAAMARLGGAVLSFSEATSSVQKGESLADSVQTMSCYADVVVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVSLRYVA-PPSLRMPPTVRAFVASRGTKQEEFESIEEALPDTDVLYMTRIQKERFGSTQEYEA-CFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLATVLGRF 2162          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Human
Match: CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:HGNC Symbol;Acc:HGNC:1424])

HSP 1 Score: 307.76 bits (787), Expect = 9.947e-102
Identity = 154/292 (52.74%), Postives = 194/292 (66.44%), Query Frame = 1
Query:  616 MFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKG--------------------------------ILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMSHI 1395
            MFYE STRTS SF AAM +LGG+VL+F+E TSSV KGESL D+V+ +S Y D +V+RHP  GA+++ ++   +PVINAGDG GEHPTQALLDIFTIREE GTVN + ITMVGDL +GRTVHSLA LL  Y V LRYVA   S++MP ++  +V S+G                                 LQEE   +E AL D+DV+YMTR+Q+ER     E +     +  +T  +M  AKK+M+VMHP+PR  EIS   DSDPRAAYFRQAE G+Y+RM+LLAT++   
Sbjct:    4 MFYEVSTRTSSSFAAAMARLGGAVLSFSEATSSVQKGESLADSVQTMSCYADVVVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVSLRYVA-PPSLRMPPTVRAFVASRGTKQVRPSQPCLEAMEMWVGQSEPSAASTMALLTLQEEFESIEEALPDTDVLYMTRIQKERFGSTQEYEA-CFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLATVLGRF 293          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Human
Match: OTC (ornithine carbamoyltransferase [Source:HGNC Symbol;Acc:HGNC:8512])

HSP 1 Score: 88.9669 bits (219), Expect = 9.591e-19
Identity = 82/325 (25.23%), Postives = 152/325 (46.77%), Query Frame = 1
Query:  451 QEIYNK-EITGHHFLTVKGLDKLKVNHILNLAHNFHI-LSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLR------YVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVV---YMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPR-CEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMS 1389
            Q + NK ++ G   LT+K     ++ ++L L+ +    + ++ E L  LL+GK LG++F + STRT  S       LGG       +   +   ESL DT R+LSS  D ++ R   Q  +D +++ +S P+IN G     HP Q L D  T++E + ++  L ++ +GD  N   +HS+      + + L+      Y       K+ +       +K +L  +   LE+A   + ++   +++  Q E   K     +++     +T +    A      +H LPR  EE+       PR+  F +AE   +  M+++ ++++
Sbjct:   29 QPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQKGEYLP-LLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGVNESLTDTARVLSSMADAVLARVYKQSDLDTLAKEASIPIIN-GLSDLYHPIQILADYLTLQEHYSSLKGLTLSWIGDGNN--ILHSIMMSAAKFGMHLQAATPKGYEPDASVTKLAEQYAKENGTKLLLTND--PLEAAHGGNVLITDTWISMGQEEEKKK----RLQAFQGYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWTIMAVMVSLLT 343          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Celegans
Match: pyr-1 (CAD protein Glutamine-dependent carbamoyl-phosphate synthase Aspartate carbamoyltransferase Dihydroorotase [Source:UniProtKB/Swiss-Prot;Acc:Q18990])

HSP 1 Score: 303.908 bits (777), Expect = 4.684e-91
Identity = 165/325 (50.77%), Postives = 224/325 (68.92%), Query Frame = 1
Query:  460 YNKEITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLY-NVKLRYVAHTDSMKMPQSIVDYVTSKG-ILQEEMPDLESALRDSDVVYMTRVQRERINKLGE-SDVKS---INKNTIT---------SELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMS 1389
            +  E+   + ++VK LDK ++N I  LA  +    E+   L+H+L GKVL  +FYE STRTSCSF+AAMQ+LGGSV++ + ++SSV KGE+LEDTV++L SY D LV+R    GA D  +RV  +PVIN GDG+GEHPTQALLD++TIR+E GTVN L I +VGDL NGRTVHSLAKLLCLY ++ L YVA +  ++MPQ ++DYV+SK   +Q++   L   +   DVVY+TR+Q+ER +   E + VK    IN   +          S L+V A+   IVMHPLPR +EI+   D D RAAYFRQA+ G++VRMS+L+ ++ 
Sbjct: 1870 FPGELLAKNCISVKHLDKGQINRIFELADRYKHDVEKGHPLTHILNGKVLVNLFYEVSTRTSCSFSAAMQRLGGSVISVDSQSSSVQKGETLEDTVQVLGSYGDILVLRSNENGAADRAARVCDQPVINGGDGTGEHPTQALLDVYTIRQEMGTVNGLTIALVGDLKNGRTVHSLAKLLCLYKDITLHYVAPSTELEMPQEVLDYVSSKSNFVQKKFTSLAEGINHVDVVYVTRIQKERFSSPDEYNKVKGSYVINAKLLNEAARDVEEPSSLLVPARSLPIVMHPLPRVDEIAVELDHDERAAYFRQAKNGVFVRMSILSLLLG 2194          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Fly
Match: r (gene:FBgn0003189 transcript:FBtr0089734)

HSP 1 Score: 346.28 bits (887), Expect = 1.370e-105
Identity = 179/335 (53.43%), Postives = 230/335 (68.66%), Query Frame = 1
Query:  409 PKIPL---SNLTKKIKIQEIYNK-----EITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMS 1389
            P+I L   SN T +  +Q   N       + G H L V   +K  +N I NLA    +   ++  +  LL GK++  +FYE STRT CSF AAM +LGG V++ +  TSSV KGESLED+++++SSY D +V+RHP  GA+   +  S KP+INAGDG GEHPTQALLDIFTIREEFGTVN L ITMVGDL NGRTVHSLA+LL LYNV L+YVA  +S++MP  +V +V  +G+ Q    DL++ L D+DV+YMTR+QRER + + E   K      +T E M+ AKKR IV+HPLPR  EIS   DSDPRAAYFRQAEYG+Y+RM+LLA ++ 
Sbjct: 1886 PRIRLDSASNTTLREYLQRTTNSNPVAHSLMGKHILAVDMFNKDHLNDIFNLAQLLKLRGTKDRPVDELLPGKIMASVFYEVSTRTQCSFAAAMLRLGGRVISMDNITSSVKKGESLEDSIKVVSSYADVVVLRHPSPGAVARAATFSRKPLINAGDGVGEHPTQALLDIFTIREEFGTVNGLTITMVGDLKNGRTVHSLARLLTLYNVNLQYVA-PNSLQMPDEVVQFVHQRGVKQLFARDLKNVLPDTDVLYMTRIQRERFDNV-EDYEKCCGHLVLTPEHMMRAKKRSIVLHPLPRLNEISREIDSDPRAAYFRQAEYGMYIRMALLAMVVG 2218          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Fly
Match: r (gene:FBgn0003189 transcript:FBtr0340156)

HSP 1 Score: 346.28 bits (887), Expect = 1.370e-105
Identity = 179/335 (53.43%), Postives = 230/335 (68.66%), Query Frame = 1
Query:  409 PKIPL---SNLTKKIKIQEIYNK-----EITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMS 1389
            P+I L   SN T +  +Q   N       + G H L V   +K  +N I NLA    +   ++  +  LL GK++  +FYE STRT CSF AAM +LGG V++ +  TSSV KGESLED+++++SSY D +V+RHP  GA+   +  S KP+INAGDG GEHPTQALLDIFTIREEFGTVN L ITMVGDL NGRTVHSLA+LL LYNV L+YVA  +S++MP  +V +V  +G+ Q    DL++ L D+DV+YMTR+QRER + + E   K      +T E M+ AKKR IV+HPLPR  EIS   DSDPRAAYFRQAEYG+Y+RM+LLA ++ 
Sbjct: 1886 PRIRLDSASNTTLREYLQRTTNSNPVAHSLMGKHILAVDMFNKDHLNDIFNLAQLLKLRGTKDRPVDELLPGKIMASVFYEVSTRTQCSFAAAMLRLGGRVISMDNITSSVKKGESLEDSIKVVSSYADVVVLRHPSPGAVARAATFSRKPLINAGDGVGEHPTQALLDIFTIREEFGTVNGLTITMVGDLKNGRTVHSLARLLTLYNVNLQYVA-PNSLQMPDEVVQFVHQRGVKQLFARDLKNVLPDTDVLYMTRIQRERFDNV-EDYEKCCGHLVLTPEHMMRAKKRSIVLHPLPRLNEISREIDSDPRAAYFRQAEYGMYIRMALLAMVVG 2218          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Fly
Match: r (gene:FBgn0003189 transcript:FBtr0340155)

HSP 1 Score: 346.28 bits (887), Expect = 1.370e-105
Identity = 179/335 (53.43%), Postives = 230/335 (68.66%), Query Frame = 1
Query:  409 PKIPL---SNLTKKIKIQEIYNK-----EITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMS 1389
            P+I L   SN T +  +Q   N       + G H L V   +K  +N I NLA    +   ++  +  LL GK++  +FYE STRT CSF AAM +LGG V++ +  TSSV KGESLED+++++SSY D +V+RHP  GA+   +  S KP+INAGDG GEHPTQALLDIFTIREEFGTVN L ITMVGDL NGRTVHSLA+LL LYNV L+YVA  +S++MP  +V +V  +G+ Q    DL++ L D+DV+YMTR+QRER + + E   K      +T E M+ AKKR IV+HPLPR  EIS   DSDPRAAYFRQAEYG+Y+RM+LLA ++ 
Sbjct: 1886 PRIRLDSASNTTLREYLQRTTNSNPVAHSLMGKHILAVDMFNKDHLNDIFNLAQLLKLRGTKDRPVDELLPGKIMASVFYEVSTRTQCSFAAAMLRLGGRVISMDNITSSVKKGESLEDSIKVVSSYADVVVLRHPSPGAVARAATFSRKPLINAGDGVGEHPTQALLDIFTIREEFGTVNGLTITMVGDLKNGRTVHSLARLLTLYNVNLQYVA-PNSLQMPDEVVQFVHQRGVKQLFARDLKNVLPDTDVLYMTRIQRERFDNV-EDYEKCCGHLVLTPEHMMRAKKRSIVLHPLPRLNEISREIDSDPRAAYFRQAEYGMYIRMALLAMVVG 2218          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Zebrafish
Match: cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:ZFIN;Acc:ZDB-GENE-021030-4])

HSP 1 Score: 352.443 bits (903), Expect = 1.661e-107
Identity = 169/306 (55.23%), Postives = 221/306 (72.22%), Query Frame = 1
Query:  472 ITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMS 1389
            + G H L+V+   K +++H+ N+AH   ++ ++   L  +L+GKV+  MFYE STRTS SF AAM +LGGSV+ F E TSS  KGESL D+V  +S Y D +V+RHPI GA++  +R   +PVINAGDG GEHPTQALLDIFTIREE GTVN + ITMVGDL +GRTVHSLA+LL  Y + LRYVA   ++ MP  I+D+V SKGI QEE   +E AL D+DV+YMTR+Q+ER +   E +     +  +T  +M  AK++M+VMHPLPR  EIS   D+DPRAAYFRQAE G+Y+RM+LLAT++ 
Sbjct: 1927 LVGQHILSVRQFSKEQMSHLFNVAHTLRLMVQKERPLD-ILKGKVMASMFYEVSTRTSSSFAAAMHRLGGSVVHFCESTSSTQKGESLVDSVNTMSCYADVIVLRHPIPGAVESAARHCRRPVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLARLLTQYRITLRYVA-PKNLSMPAEIIDFVASKGIKQEEFNSIEEALPDTDVLYMTRIQKERFSSEKEYNA-CFGQFILTPHIMTGAKRKMVVMHPLPRVNEISVEVDTDPRAAYFRQAENGMYIRMALLATVLG 2229          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Zebrafish
Match: cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:ZFIN;Acc:ZDB-GENE-021030-4])

HSP 1 Score: 173.711 bits (439), Expect = 3.211e-48
Identity = 81/148 (54.73%), Postives = 106/148 (71.62%), Query Frame = 1
Query:  472 ITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEF 915
            + G H L+V+   K +++H+ N+AH   ++ ++   L  +L+GKV+  MFYE STRTS SF AAM +LGGSV+ F E TSS  KGESL D+V  +S Y D +V+RHPI GA++  +R   +PVINAGDG GEHPTQALLDIFTIREE 
Sbjct:  339 LVGQHILSVRQFSKEQMSHLFNVAHTLRLMVQKERPLD-ILKGKVMASMFYEVSTRTSSSFAAAMHRLGGSVVHFCESTSSTQKGESLVDSVNTMSCYADVIVLRHPIPGAVESAARHCRRPVINAGDGVGEHPTQALLDIFTIREEL 485          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Zebrafish
Match: otc (ornithine carbamoyltransferase [Source:ZFIN;Acc:ZDB-GENE-070912-422])

HSP 1 Score: 90.1225 bits (222), Expect = 2.749e-19
Identity = 86/317 (27.13%), Postives = 141/317 (44.48%), Query Frame = 1
Query:  472 ITGHHFLTVKGLDKLKVNHILNLAHNF-HILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSK-----GILQEEMPDLESALRDSDVV----YMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPR-CEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMS 1389
            + G  FLT+K  +  ++ HIL ++ +  H +  R E+L  LL+GK + ++F + STRT  S       LGG       +   +   E   DT R+LS   D ++ R     +++ + + +S PVIN G     HP Q L D+ T++E +G++    +T +GD  N   +HS    L    V L+    T     P + V     +     G   + + D   A RDS V+    +++  Q E   K     +K  +   IT +    A      +H LPR  EE+        R+  F +AE   +  M L+  I++
Sbjct:   35 LKGRSFLTLKDYNAEEIKHILWVSADLKHRIKHRGEHLP-LLQGKSIAMIFEKRSTRTRMSTETGFSLLGGHPCFLTPQDIHLGVNECTTDTARVLSGLADIVLARVYNHSSLEHLDKDTSIPVIN-GLSDLYHPIQILADLLTLQEHYGSLKGRTLTWIGDGNN--VLHSFMMSLAKLGVNLKVA--TPKGYEPDAAVTEEAQRLAKQFGTRLQFVSDPVEAARDSSVLVTDTWVSMGQEEEKKK----RLKDFSGYQITIQTGSVAAPDWTFLHCLPRKPEEVDDEVFYSQRSLVFEEAENRKWTIMGLMVCILT 341          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Xenopus
Match: CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:NCBI gene;Acc:100125119])

HSP 1 Score: 364.77 bits (935), Expect = 9.094e-112
Identity = 178/306 (58.17%), Postives = 226/306 (73.86%), Query Frame = 1
Query:  472 ITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMS 1389
            + G H LTVK   K +++H+ N+AH   +L ++  NL  +L+GKV+  MF+E STRTS SF AAMQ+LGGSVL+F E TSS  KGESL D+V+ +S Y+D LVVRHP  GA+++ ++   KPVINAGDG GEHPTQALLDIFTIREE GTVN +IITMVGDL +GRTVHSLA LL  Y V LRYV    S++MP +I+ +V SKGI QEE   +E AL D+DV+YMTR+Q+ER N   E +     +  +T  +M  AKK+M+VMHP+PR  EIS   DSDPRAAYFRQAE G+Y+RM+LLAT++ 
Sbjct: 1555 LIGQHILTVKQFSKDQMSHLFNVAHTLRMLVQKERNLD-ILKGKVMASMFFEASTRTSSSFAAAMQRLGGSVLSFCETTSSSQKGESLTDSVQTMSCYSDVLVVRHPEPGAVELAAKHCRKPVINAGDGVGEHPTQALLDIFTIREELGTVNGMIITMVGDLKHGRTVHSLACLLTQYRVTLRYVT-PRSLRMPSNIIHFVASKGIKQEEFESIEEALPDTDVLYMTRIQKERFNSTDEYNA-CFGQFILTPHIMTRAKKKMVVMHPMPRVNEISFEVDSDPRAAYFRQAENGMYIRMALLATVLG 1857          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Xenopus
Match: CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:NCBI gene;Acc:100125119])

HSP 1 Score: 364.385 bits (934), Expect = 1.026e-111
Identity = 178/306 (58.17%), Postives = 226/306 (73.86%), Query Frame = 1
Query:  472 ITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMS 1389
            + G H LTVK   K +++H+ N+AH   +L ++  NL  +L+GKV+  MF+E STRTS SF AAMQ+LGGSVL+F E TSS  KGESL D+V+ +S Y+D LVVRHP  GA+++ ++   KPVINAGDG GEHPTQALLDIFTIREE GTVN +IITMVGDL +GRTVHSLA LL  Y V LRYV    S++MP +I+ +V SKGI QEE   +E AL D+DV+YMTR+Q+ER N   E +     +  +T  +M  AKK+M+VMHP+PR  EIS   DSDPRAAYFRQAE G+Y+RM+LLAT++ 
Sbjct: 1548 LIGQHILTVKQFSKDQMSHLFNVAHTLRMLVQKERNLD-ILKGKVMASMFFEASTRTSSSFAAAMQRLGGSVLSFCETTSSSQKGESLTDSVQTMSCYSDVLVVRHPEPGAVELAAKHCRKPVINAGDGVGEHPTQALLDIFTIREELGTVNGMIITMVGDLKHGRTVHSLACLLTQYRVTLRYVT-PRSLRMPSNIIHFVASKGIKQEEFESIEEALPDTDVLYMTRIQKERFNSTDEYNA-CFGQFILTPHIMTRAKKKMVVMHPMPRVNEISFEVDSDPRAAYFRQAENGMYIRMALLATVLG 1850          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Xenopus
Match: CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:NCBI gene;Acc:100125119])

HSP 1 Score: 363.999 bits (933), Expect = 1.571e-111
Identity = 178/306 (58.17%), Postives = 226/306 (73.86%), Query Frame = 1
Query:  472 ITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMS 1389
            + G H LTVK   K +++H+ N+AH   +L ++  NL  +L+GKV+  MF+E STRTS SF AAMQ+LGGSVL+F E TSS  KGESL D+V+ +S Y+D LVVRHP  GA+++ ++   KPVINAGDG GEHPTQALLDIFTIREE GTVN +IITMVGDL +GRTVHSLA LL  Y V LRYV    S++MP +I+ +V SKGI QEE   +E AL D+DV+YMTR+Q+ER N   E +     +  +T  +M  AKK+M+VMHP+PR  EIS   DSDPRAAYFRQAE G+Y+RM+LLAT++ 
Sbjct: 1691 LIGQHILTVKQFSKDQMSHLFNVAHTLRMLVQKERNLD-ILKGKVMASMFFEASTRTSSSFAAAMQRLGGSVLSFCETTSSSQKGESLTDSVQTMSCYSDVLVVRHPEPGAVELAAKHCRKPVINAGDGVGEHPTQALLDIFTIREELGTVNGMIITMVGDLKHGRTVHSLACLLTQYRVTLRYVT-PRSLRMPSNIIHFVASKGIKQEEFESIEEALPDTDVLYMTRIQKERFNSTDEYNA-CFGQFILTPHIMTRAKKKMVVMHPMPRVNEISFEVDSDPRAAYFRQAENGMYIRMALLATVLG 1993          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Xenopus
Match: otc (ornithine carbamoyltransferase [Source:NCBI gene;Acc:448273])

HSP 1 Score: 87.0409 bits (214), Expect = 4.379e-18
Identity = 79/316 (25.00%), Postives = 145/316 (45.89%), Query Frame = 1
Query:  463 NKEITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMP------DLESALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPR-CEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMS 1389
            N ++ G + LT+K     ++ ++L +A +     ++      +L+GK L ++F + STRT  S       LGG       +   +   ESL+DT R+LS  TD ++ R   Q  +D++++ ++ P++N G     HP Q L D  T++E +G +N L I+ +GD  N   ++S+      + + LR    T     P S V     +   +   P       LE+A   + +V  T V   +  +  +  +K      IT +    A      +H LPR  EE+  +    P++  F +AE   +  M+++  +++
Sbjct:   31 NVQLKGRNLLTLKHYTAEEIQYLLWVAADLKYRIKQKGEYVPVLQGKSLAMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGVNESLKDTARVLSGMTDAVLARVYRQTDLDLLAKEATIPIVN-GLSDMYHPIQILADFLTLQEHYGHLNGLTISWIGDGNN--VLNSIMMSAAKFGMNLRIA--TPKGYEPDSSVISAAEQFSKESGTPLFMTNEPLEAATGANVLVTDTWVSMGKEEEK-KKRLKDFKGYQITMQTGKVASPDWTFLHCLPRKPEEVDDAVFYSPKSLVFPEAENRKWTIMAVMVALLT 340          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Xenopus
Match: otc (ornithine carbamoyltransferase [Source:NCBI gene;Acc:448273])

HSP 1 Score: 82.8037 bits (203), Expect = 8.409e-17
Identity = 49/164 (29.88%), Postives = 86/164 (52.44%), Query Frame = 1
Query:  472 ITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLAN 963
            + G + LT+K     ++ ++L +A +     ++      +L+GK L ++F + STRT  S       LGG       +   +   ESL+DT R+LS  TD ++ R   Q  +D++++ ++ P++N G     HP Q L D  T++E +G +N L I+ +GD  N
Sbjct:   10 LKGRNLLTLKHYTAEEIQYLLWVAADLKYRIKQKGEYVPVLQGKSLAMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGVNESLKDTARVLSGMTDAVLARVYRQTDLDLLAKEATIPIVN-GLSDMYHPIQILADFLTLQEHYGHLNGLTISWIGDGNN 172          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Mouse
Match: Cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:MGI Symbol;Acc:MGI:1916969])

HSP 1 Score: 356.681 bits (914), Expect = 5.264e-109
Identity = 170/308 (55.19%), Postives = 225/308 (73.05%), Query Frame = 1
Query:  472 ITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMSHI 1395
            + G H L+VK   K +++H+ N+AH   ++ ++  +L  +L+GKV+  MFYE STRTS SF AAM +LGG+VL+F+E TSSV KGESL D+V+ +S Y D +V+RHP  GA+++ ++   +PVINAGDG GEHPTQALLDIFTIREE GTVN + ITMVGDL +GRTVHSLA LL  Y V LRYVA   S++MP S+ D+V S+G  QEE   +E AL D+DV+YMTR+Q+ER   + E +     +  +T  +M  AKK+M+VMHP+PR  EIS   DSDPRAAYFRQAE G+Y+RM+LLAT++   
Sbjct: 1858 LVGQHILSVKQFTKDQMSHLFNVAHTLRMMVQKERSLD-ILKGKVMASMFYEVSTRTSSSFAAAMARLGGAVLSFSEATSSVQKGESLADSVQTMSCYADVIVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVSLRYVA-PPSLRMPPSVRDFVASRGTKQEEFESIEEALPDTDVLYMTRIQKERFGSVQEYEA-CFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLATVLGRF 2162          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Mouse
Match: Cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:MGI Symbol;Acc:MGI:1916969])

HSP 1 Score: 356.681 bits (914), Expect = 5.583e-109
Identity = 170/308 (55.19%), Postives = 225/308 (73.05%), Query Frame = 1
Query:  472 ITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMSHI 1395
            + G H L+VK   K +++H+ N+AH   ++ ++  +L  +L+GKV+  MFYE STRTS SF AAM +LGG+VL+F+E TSSV KGESL D+V+ +S Y D +V+RHP  GA+++ ++   +PVINAGDG GEHPTQALLDIFTIREE GTVN + ITMVGDL +GRTVHSLA LL  Y V LRYVA   S++MP S+ D+V S+G  QEE   +E AL D+DV+YMTR+Q+ER   + E +     +  +T  +M  AKK+M+VMHP+PR  EIS   DSDPRAAYFRQAE G+Y+RM+LLAT++   
Sbjct: 1921 LVGQHILSVKQFTKDQMSHLFNVAHTLRMMVQKERSLD-ILKGKVMASMFYEVSTRTSSSFAAAMARLGGAVLSFSEATSSVQKGESLADSVQTMSCYADVIVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVSLRYVA-PPSLRMPPSVRDFVASRGTKQEEFESIEEALPDTDVLYMTRIQKERFGSVQEYEA-CFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLATVLGRF 2225          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Mouse
Match: Cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:MGI Symbol;Acc:MGI:1916969])

HSP 1 Score: 239.965 bits (611), Expect = 1.131e-68
Identity = 114/196 (58.16%), Postives = 144/196 (73.47%), Query Frame = 1
Query:  808 DIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMSHI 1395
            ++ ++   +PVINAGDG GEHPTQALLDIFTIREE GTVN + ITMVGDL +GRTVHSLA LL  Y V LRYVA   S++MP S+ D+V S+G  QEE   +E AL D+DV+YMTR+Q+ER   + E +     +  +T  +M  AKK+M+VMHP+PR  EIS   DSDPRAAYFRQAE G+Y+RM+LLAT++   
Sbjct: 1971 ELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVSLRYVA-PPSLRMPPSVRDFVASRGTKQEEFESIEEALPDTDVLYMTRIQKERFGSVQEYEA-CFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLATVLGRF 2164          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Mouse
Match: Cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:MGI Symbol;Acc:MGI:1916969])

HSP 1 Score: 239.58 bits (610), Expect = 1.546e-68
Identity = 114/197 (57.87%), Postives = 144/197 (73.10%), Query Frame = 1
Query:  805 IDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMSHI 1395
            + + ++   +PVINAGDG GEHPTQALLDIFTIREE GTVN + ITMVGDL +GRTVHSLA LL  Y V LRYVA   S++MP S+ D+V S+G  QEE   +E AL D+DV+YMTR+Q+ER   + E +     +  +T  +M  AKK+M+VMHP+PR  EIS   DSDPRAAYFRQAE G+Y+RM+LLAT++   
Sbjct: 1960 LKLAAKHCRRPVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVSLRYVA-PPSLRMPPSVRDFVASRGTKQEEFESIEEALPDTDVLYMTRIQKERFGSVQEYEA-CFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLATVLGRF 2154          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Mouse
Match: Otc (ornithine transcarbamylase [Source:MGI Symbol;Acc:MGI:97448])

HSP 1 Score: 92.4337 bits (228), Expect = 5.070e-20
Identity = 80/319 (25.08%), Postives = 148/319 (46.39%), Query Frame = 1
Query:  469 EITGHHFLTVKGLDKLKVNHILNLAHNFHI-LSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLR------YVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVV----YMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPR-CEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMS 1389
            ++ G   LT+K     ++ ++L L+ +    + ++ E L  LL+GK LG++F + STRT  S       LGG       +   +   ESL DT R+LSS TD ++ R   Q  +D +++ +S P++N G     HP Q L D  T++E +G++  L ++ +GD  N   +HS+      + + L+      Y    + +K+ +    Y    G       D   A R  +V+    +++  Q +   K     +++     +T +    A      +H LPR  EE+       PR+  F +AE   +  M+++ ++++
Sbjct:   36 QLKGRDLLTLKNFTGEEIQYMLWLSADLKFRIKQKGEYLP-LLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPSFLTTQDIHLGVNESLTDTARVLSSMTDAVLARVYKQSDLDTLAKEASIPIVN-GLSDLYHPIQILADYLTLQEHYGSLKGLTLSWIGDGNN--ILHSIMMSAAKFGMHLQAATPKGYEPDPNIVKLAEQ---YAKENGTKLSMTNDPLEAARGGNVLITDTWISMGQEDEKKK----RLQAFQGYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWTIMAVMVSLLT 343          
BLAST of Aspartate carbamoyltransferase vs. UniProt/SwissProt
Match: sp|B2RQC6|PYR1_MOUSE (CAD protein OS=Mus musculus OX=10090 GN=Cad PE=1 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 3.905e-108
Identity = 170/308 (55.19%), Postives = 225/308 (73.05%), Query Frame = 1
Query:  472 ITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMSHI 1395
            + G H L+VK   K +++H+ N+AH   ++ ++  +L  +L+GKV+  MFYE STRTS SF AAM +LGG+VL+F+E TSSV KGESL D+V+ +S Y D +V+RHP  GA+++ ++   +PVINAGDG GEHPTQALLDIFTIREE GTVN + ITMVGDL +GRTVHSLA LL  Y V LRYVA   S++MP S+ D+V S+G  QEE   +E AL D+DV+YMTR+Q+ER   + E +     +  +T  +M  AKK+M+VMHP+PR  EIS   DSDPRAAYFRQAE G+Y+RM+LLAT++   
Sbjct: 1921 LVGQHILSVKQFTKDQMSHLFNVAHTLRMMVQKERSLD-ILKGKVMASMFYEVSTRTSSSFAAAMARLGGAVLSFSEATSSVQKGESLADSVQTMSCYADVIVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVSLRYVA-PPSLRMPPSVRDFVASRGTKQEEFESIEEALPDTDVLYMTRIQKERFGSVQEYEA-CFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLATVLGRF 2225          
BLAST of Aspartate carbamoyltransferase vs. UniProt/SwissProt
Match: sp|P08955|PYR1_MESAU (CAD protein OS=Mesocricetus auratus OX=10036 GN=CAD PE=1 SV=4)

HSP 1 Score: 356.295 bits (913), Expect = 5.466e-108
Identity = 170/308 (55.19%), Postives = 224/308 (72.73%), Query Frame = 1
Query:  472 ITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMSHI 1395
            + G H L+VK   K +++H+ N+AH   ++ ++  +L  +L+GKV+  MFYE STRTS SF AAM +LGG+VL+F+E TSSV KGESL D+V+ +S Y D +V+RHP  GA+++ ++   +PVINAGDG GEHPTQALLDIFTIREE GTVN + ITMVGDL +GRTVHSLA LL  Y V LRYVA   S++MP S+ D+V S+G  QEE   +E AL D+DV+YMTR+Q+ER     E +     +  +T  +M  AKK+M+VMHP+PR  EIS   DSDPRAAYFRQAE G+Y+RM+LLAT++   
Sbjct: 1921 LVGQHILSVKQFTKDQMSHLFNVAHTLRMMVQKERSLD-ILKGKVMASMFYEVSTRTSSSFAAAMARLGGAVLSFSEATSSVQKGESLADSVQTMSCYADVVVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVSLRYVA-PPSLRMPPSVWDFVASRGTKQEEFESIEEALPDTDVLYMTRIQKERFGSTQEYEA-CFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLATVLGRF 2225          
BLAST of Aspartate carbamoyltransferase vs. UniProt/SwissProt
Match: sp|Q91437|PYR1_SQUAC (CAD protein OS=Squalus acanthias OX=7797 GN=CAD PE=2 SV=1)

HSP 1 Score: 352.058 bits (902), Expect = 1.450e-106
Identity = 171/306 (55.88%), Postives = 224/306 (73.20%), Query Frame = 1
Query:  472 ITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMS 1389
              G H L+VK   K +++H+ N+AHN  +  +++ +L  +L+GKV+  MFYE STRTS SF AAM +LGGSV+ F+E TSSV KGESL D+V+ +S Y D +V+RHP  GA+++ ++ S KP+INAGDG GEHPTQALLDIFTIREE GTVN + ITMVGDL +GRTVHSLA LL LY V LRYV   + ++MP +I+ ++ S+GI QEE   LE AL D+DV+YMTR+Q+ER     E +     +  +T  +M   KK+M+VMHPLPR  E+S   DSDPRAAYFRQAE G+YVRM+LLAT++ 
Sbjct: 1938 FVGQHILSVKRFTKDQLSHLFNVAHNLRLTVQKDRSLD-ILKGKVMASMFYEVSTRTSSSFRAAMHRLGGSVIHFSEATSSVQKGESLLDSVQTMSCYVDVVVLRHPEPGAVELAAKHSRKPIINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLAYLLTLYRVNLRYVTPRN-LRMPPNIIRFLASRGIKQEEFDSLEEALPDTDVLYMTRIQKERFASEEEYEA-CFGQFILTPHIMTKGKKKMVVMHPLPRVNEVSVEVDSDPRAAYFRQAENGMYVRMALLATVLG 2240          
BLAST of Aspartate carbamoyltransferase vs. UniProt/SwissProt
Match: sp|P27708|PYR1_HUMAN (CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3)

HSP 1 Score: 350.132 bits (897), Expect = 6.730e-106
Identity = 167/308 (54.22%), Postives = 223/308 (72.40%), Query Frame = 1
Query:  472 ITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMSHI 1395
            + G H L+V+   K +++H+ N+AH   ++ ++  +L  +L+GKV+  MFYE STRTS SF AAM +LGG+VL+F+E TSSV KGESL D+V+ +S Y D +V+RHP  GA+++ ++   +PVINAGDG GEHPTQALLDIFTIREE GTVN + ITMVGDL +GRTVHSLA LL  Y V LRYVA   S++MP ++  +V S+G  QEE   +E AL D+DV+YMTR+Q+ER     E +     +  +T  +M  AKK+M+VMHP+PR  EIS   DSDPRAAYFRQAE G+Y+RM+LLAT++   
Sbjct: 1921 LVGQHILSVQQFTKDQMSHLFNVAHTLRMMVQKERSLD-ILKGKVMASMFYEVSTRTSSSFAAAMARLGGAVLSFSEATSSVQKGESLADSVQTMSCYADVVVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVSLRYVA-PPSLRMPPTVRAFVASRGTKQEEFESIEEALPDTDVLYMTRIQKERFGSTQEYEA-CFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLATVLGRF 2225          
BLAST of Aspartate carbamoyltransferase vs. UniProt/SwissProt
Match: sp|P05990|PYR1_DROME (CAD protein OS=Drosophila melanogaster OX=7227 GN=r PE=1 SV=3)

HSP 1 Score: 346.28 bits (887), Expect = 1.373e-104
Identity = 179/335 (53.43%), Postives = 230/335 (68.66%), Query Frame = 1
Query:  409 PKIPL---SNLTKKIKIQEIYNK-----EITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMS 1389
            P+I L   SN T +  +Q   N       + G H L V   +K  +N I NLA    +   ++  +  LL GK++  +FYE STRT CSF AAM +LGG V++ +  TSSV KGESLED+++++SSY D +V+RHP  GA+   +  S KP+INAGDG GEHPTQALLDIFTIREEFGTVN L ITMVGDL NGRTVHSLA+LL LYNV L+YVA  +S++MP  +V +V  +G+ Q    DL++ L D+DV+YMTR+QRER + + E   K      +T E M+ AKKR IV+HPLPR  EIS   DSDPRAAYFRQAEYG+Y+RM+LLA ++ 
Sbjct: 1886 PRIRLDSASNTTLREYLQRTTNSNPVAHSLMGKHILAVDMFNKDHLNDIFNLAQLLKLRGTKDRPVDELLPGKIMASVFYEVSTRTQCSFAAAMLRLGGRVISMDNITSSVKKGESLEDSIKVVSSYADVVVLRHPSPGAVARAATFSRKPLINAGDGVGEHPTQALLDIFTIREEFGTVNGLTITMVGDLKNGRTVHSLARLLTLYNVNLQYVA-PNSLQMPDEVVQFVHQRGVKQLFARDLKNVLPDTDVLYMTRIQRERFDNV-EDYEKCCGHLVLTPEHMMRAKKRSIVLHPLPRLNEISREIDSDPRAAYFRQAEYGMYIRMALLAMVVG 2218          
BLAST of Aspartate carbamoyltransferase vs. TrEMBL
Match: A0A183LU66 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS7341 PE=3 SV=1)

HSP 1 Score: 373.629 bits (958), Expect = 4.015e-123
Identity = 189/345 (54.78%), Postives = 245/345 (71.01%), Query Frame = 1
Query:  370 IITEEVNNGLAVHPKIPLSNLTKKIKIQEIYNKEITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAID-IVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKSINKN--TITSELMVSAKKR-MIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMSH 1392
            ++ +   +GL    ++P ++ T    +  ++ + ++G H L+     K  +  + NLAH+F +   +N+ L  +  GKV+G +F+E STRTS SF  AMQ+LGG+V+ F+E TSS +KGE++ DTVR+L+SY DCLV+RHP +GAI  + + +  KP+INAGDG GEHPTQALLD+FTIREE GTVN L ITMVGDLANGRTVHSLA+LLCLY VKLRYV H D  KMP  +  YV  +GI QEEM  LE AL D+DV+YMTRVQ ER+     SD K   ++   +T ELM  AK R MIVMHPLPR  EIS  FDSDPRAAYFRQAEYG +VRM+LLA ++++
Sbjct:   41 VVYQPTASGLIPTAQLPQTHQT----LPSMWLEGLSGKHILSSLDFSKDHLRRLYNLAHSFRVALNKNKPLDQICRGKVMGNLFFEPSTRTSNSFAIAMQRLGGTVMHFSESTSSQTKGETVLDTVRILASYCDCLVIRHPGKGAIHALANSIVHKPIINAGDGIGEHPTQALLDVFTIREEIGTVNGLTITMVGDLANGRTVHSLARLLCLYKVKLRYVTHRDEFKMPPEVKSYVADRGIPQEEMTSLEEALPDTDVLYMTRVQTERM-----SDDKDARRDQFVVTPELMTLAKPRGMIVMHPLPRVGEISPKFDSDPRAAYFRQAEYGTHVRMALLAIVLAN 376          
BLAST of Aspartate carbamoyltransferase vs. TrEMBL
Match: A0A0B6Z6L4 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF48647 PE=3 SV=1)

HSP 1 Score: 382.874 bits (982), Expect = 5.133e-123
Identity = 182/310 (58.71%), Postives = 234/310 (75.48%), Query Frame = 1
Query:  460 YNKEITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMS 1389
            +   +TGHH ++V   +K +++ I NLAHN+ +   ++  L H+L+GKVL  MF+E STRTSCSFT AMQ+LGG+V+ FNE TSS  KGE+LEDTV M++ Y D +V+RHP  GA+   S++S KPV+NAGDG GEHPTQALLD+FTIREE GTVN L IT VGDL NGRTVHSLAKLL LY V LRYV+    ++MP+ I++ V S+GI Q+   +LE AL D+DV+YMTR+Q+ER   + E ++ + N+  +T ELM  AKKRM+VMHPLPR  EIS S D+DPRAAYFRQAE G+YVRM+LLA I+ 
Sbjct:  342 FTPGLTGHHVVSVMSFNKHQLSQIFNLAHNYKVAVSKDRPLDHVLKGKVLASMFFEVSTRTSCSFTVAMQRLGGTVVQFNEITSSAMKGETLEDTVSMMAGYADIIVIRHPKYGAVQAASKISRKPVVNAGDGIGEHPTQALLDVFTIREEIGTVNELTITFVGDLRNGRTVHSLAKLLTLYRVNLRYVS-IPGLEMPEDILNLVKSRGIRQDYFSNLEQALPDTDVLYMTRIQKERFENMEEYNM-ACNQMILTPELMTFAKKRMVVMHPLPRVFEISPSIDTDPRAAYFRQAENGMYVRMALLALILG 649          
BLAST of Aspartate carbamoyltransferase vs. TrEMBL
Match: A0A183JG39 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 PE=3 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 2.631e-122
Identity = 185/329 (56.23%), Postives = 240/329 (72.95%), Query Frame = 1
Query:  415 IPLSNLTKKIK-IQEIYNKEITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAID-IVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKR-MIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMSH 1392
            IP + L +  + +  ++ + ++G H L+     +  +  + NLAH+F +   +N+ L  +  GKV+G +F+E STRTS SF  AMQ+LGG+V+ F+E TSS +KGE++ DTVR+L+SY DCLV+RHP +GAI  + + +  KP+INAGDG GEHPTQALLD+FTIREE GTVN L ITMVGDLANGRTVHSLA+LLCLY VKLRYV H D  KMP  +  YV  +GI QEEM  LE AL D+DV+YMTRVQ ER++   + D +  ++  +T ELM  AK R MIVMHPLPR  EIS  FDSDPRAAYFRQAEYG +VRM+LLA ++++
Sbjct:   52 IPTAQLPQTHQTLPSMWLEGLSGKHILSSLDFSRDHLRRLYNLAHSFRVALNKNKPLDQICRGKVMGNLFFEPSTRTSNSFAIAMQRLGGTVMHFSESTSSQTKGETVLDTVRILASYCDCLVIRHPGKGAIHALANSIVHKPIINAGDGIGEHPTQALLDVFTIREEIGTVNGLTITMVGDLANGRTVHSLARLLCLYKVKLRYVTHRDEFKMPPEVKSYVADRGIPQEEMTSLEEALPDTDVLYMTRVQTERMSD--DRDARR-DQFVVTPELMTLAKPRGMIVMHPLPRVGEISPKFDSDPRAAYFRQAEYGTHVRMALLAIVLAN 377          
BLAST of Aspartate carbamoyltransferase vs. TrEMBL
Match: A0A3P7X706 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS1660 PE=3 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 2.902e-122
Identity = 185/329 (56.23%), Postives = 240/329 (72.95%), Query Frame = 1
Query:  415 IPLSNLTKKIK-IQEIYNKEITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAID-IVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKR-MIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMSH 1392
            IP + L +  + +  ++ + ++G H L+     +  +  + NLAH+F +   +N+ L  +  GKV+G +F+E STRTS SF  AMQ+LGG+V+ F+E TSS +KGE++ DTVR+L+SY DCLV+RHP +GAI  + + +  KP+INAGDG GEHPTQALLD+FTIREE GTVN L ITMVGDLANGRTVHSLA+LLCLY VKLRYV H D  KMP  +  YV  +GI QEEM  LE AL D+DV+YMTRVQ ER++   + D +  ++  +T ELM  AK R MIVMHPLPR  EIS  FDSDPRAAYFRQAEYG +VRM+LLA ++++
Sbjct:   52 IPTAQLPQTHQTLPSMWLEGLSGKHILSSLDFSRDHLRRLYNLAHSFRVALNKNKPLDQICRGKVMGNLFFEPSTRTSNSFAIAMQRLGGTVMHFSESTSSQTKGETVLDTVRILASYCDCLVIRHPGKGAIHALANSIVHKPIINAGDGIGEHPTQALLDVFTIREEIGTVNGLTITMVGDLANGRTVHSLARLLCLYKVKLRYVTHRDEFKMPPEVKSYVADRGIPQEEMTSLEEALPDTDVLYMTRVQTERMSD--DRDARR-DQFVVTPELMTLAKPRGMIVMHPLPRVGEISPKFDSDPRAAYFRQAEYGTHVRMALLAIVLAN 377          
BLAST of Aspartate carbamoyltransferase vs. TrEMBL
Match: A0A131XIN0 (Putative carbamoyl-phosphate synthase large chain (Fragment) OS=Hyalomma excavatum OX=257692 PE=2 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 3.173e-121
Identity = 174/304 (57.24%), Postives = 230/304 (75.66%), Query Frame = 1
Query:  484 HFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMSHI 1395
            H LT     K +++ + NLAH F +  +++  L H+L+GKV+  +FYE STRTSCSF AAMQ+LGGSV+  ++ TSS  KGE+LEDT+ ++S+Y+D +V+RHP  GA+   S+   KPVINAGDG GEHPTQALLDI+TIREE GTVNNL +T+VGDL +GRTVHSLA+LL  YNV LRYVA  + + MPQS+ D V ++G+ QE++  LE+AL D+DV+YMTR+Q+ER + + E + K+     +T +LM  AKKRMIVMHPLPR  EIS  FD+DPRAAYFRQAE G+YVRM+LLA ++  +
Sbjct:    2 HILTADMFSKDQMHSLFNLAHAFSVFVQKDRPLDHVLKGKVMASVFYEVSTRTSCSFAAAMQRLGGSVIHMDQATSSTQKGETLEDTITVMSNYSDVVVLRHPQPGAVLRASKHCRKPVINAGDGIGEHPTQALLDIYTIREEIGTVNNLTVTLVGDLKHGRTVHSLARLLTHYNVHLRYVAPAN-LGMPQSVRDVVAAQGVTQEDIESLEAALPDTDVLYMTRIQKERFSSVEEYE-KACGLYVVTPQLMTKAKKRMIVMHPLPRVFEISPEFDTDPRAAYFRQAEAGMYVRMALLAMVLGRV 303          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Cavefish
Match: cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:ZFIN;Acc:ZDB-GENE-021030-4])

HSP 1 Score: 350.132 bits (897), Expect = 8.312e-107
Identity = 169/307 (55.05%), Postives = 226/307 (73.62%), Query Frame = 1
Query:  472 ITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKS-INKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMS 1389
            + G H L+V+   K +++H+ N+AH   ++ ++  +L  +L+GKV+  MFYE STRTS SF AAMQ+LGGSV+ F+E TSS  KGESL D+V+ +S Y D +V+RHP  GA++  ++   +P+INAGDG GEHPTQALLDIFTIREE GTVN + ITMVGDL +GRTVHSLA+LL  Y + LRYVA   ++ MP  IVD+V SKGI QEE   +E AL D+DV+YMTR+Q+ER   + + D K+   +  +T  +M  AK++M+VMHPLPR  EIS   D+DPRAAYFRQAE G+Y+RM+LLAT++ 
Sbjct: 1917 LVGQHILSVQQFTKEQMSHLFNVAHTLRLMVQKERSLD-ILKGKVMASMFYEVSTRTSSSFAAAMQRLGGSVVHFSECTSSTQKGESLGDSVQTMSCYADVIVLRHPEPGAVEKAAKHCRRPMINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLARLLTQYRITLRYVA-PKNLSMPVEIVDFVASKGIKQEEFNSIEEALPDTDVLYMTRIQKERF--VSKEDYKACFGQFVLTPHIMTGAKRKMVVMHPLPRVNEISVEVDTDPRAAYFRQAENGMYIRMALLATVLG 2219          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Cavefish
Match: cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:ZFIN;Acc:ZDB-GENE-021030-4])

HSP 1 Score: 348.206 bits (892), Expect = 3.955e-106
Identity = 168/309 (54.37%), Postives = 226/309 (73.14%), Query Frame = 1
Query:  472 ITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKS-INKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMSHI 1395
            + G H L+V+   K +++H+ N+AH   ++ ++  +L  +L+GKV+  MFYE STRTS SF AAMQ+LGGSV+ F+E TSS  KGESL D+V+ +S Y D +V+RHP  GA++  ++   +P+INAGDG GEHPTQALLDIFTIREE GTVN + ITMVGDL +GRTVHSLA+LL  Y + LRYVA   ++ MP  IVD+V SKGI QEE   +E AL D+DV+YMTR+Q+ER   + + D K+   +  +T  +M  AK++M+VMHPLPR  EIS   D+DPRAAYFRQAE G+Y+RM+LL T++  +
Sbjct: 1931 LVGQHILSVQQFTKEQMSHLFNVAHTLRLMVQKERSLD-ILKGKVMASMFYEVSTRTSSSFAAAMQRLGGSVVHFSECTSSTQKGESLGDSVQTMSCYADVIVLRHPEPGAVEKAAKHCRRPMINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLARLLTQYRITLRYVA-PKNLSMPVEIVDFVASKGIKQEEFNSIEEALPDTDVLYMTRIQKERF--VSKEDYKACFGQFVLTPHIMTGAKRKMVVMHPLPRVNEISVEVDTDPRAAYFRQAENGMYIRMALLCTVVGPV 2235          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Cavefish
Match: otc (ornithine carbamoyltransferase [Source:NCBI gene;Acc:103045553])

HSP 1 Score: 89.3521 bits (220), Expect = 3.850e-19
Identity = 84/313 (26.84%), Postives = 143/313 (45.69%), Query Frame = 1
Query:  487 FLTVKGLDKLKVNHILNLAHNF-HILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLR------YVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVV----YMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPR-CEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMS 1389
            FLT+K  +  ++ HIL ++ +  H +  + + L  LL+GK + ++F + STRT  S       LGG       +   +   ES  DT R+LS   D ++ R      ++ +S+ +S P+IN G     HP Q L D+ T++E +G++  L +  +GD  N   +HSL   L    V LR      Y       +  Q +     ++  LQ     +E+A + S+V+    +++  Q E   K     +K      IT +    A      +H LPR  EE++      PR+  F +AE   +  M L+  +++
Sbjct:   34 FLTLKDFNPDEIKHILRVSADLKHRIKLQGQYLP-LLQGKSIAMIFEKRSTRTRMSTETGFSLLGGHPCFLTPQDIHLGVNESTTDTARVLSGLADIVLARVYSHSTLEQLSKEASIPIIN-GLSDLYHPIQILADLLTLQEHYGSLKGLTVAWIGDGNN--VLHSLMMSLAKLGVNLRIATPKGYEPDAAVTQEAQRLSKQFGTE--LQLSSEPMEAA-QGSNVLVTDTWISMGQEEEKKK----RIKDFQGYQITMQTGSVAAPDWTFLHCLPRKSEEVNDEVFYSPRSLVFTEAENRKWTIMGLMVCMLT 335          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Cavefish
Match: otc (ornithine carbamoyltransferase [Source:NCBI gene;Acc:103045553])

HSP 1 Score: 88.9669 bits (219), Expect = 3.926e-19
Identity = 84/313 (26.84%), Postives = 143/313 (45.69%), Query Frame = 1
Query:  487 FLTVKGLDKLKVNHILNLAHNF-HILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLR------YVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVV----YMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPR-CEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMS 1389
            FLT+K  +  ++ HIL ++ +  H +  + + L  LL+GK + ++F + STRT  S       LGG       +   +   ES  DT R+LS   D ++ R      ++ +S+ +S P+IN G     HP Q L D+ T++E +G++  L +  +GD  N   +HSL   L    V LR      Y       +  Q +     ++  LQ     +E+A + S+V+    +++  Q E   K     +K      IT +    A      +H LPR  EE++      PR+  F +AE   +  M L+  +++
Sbjct:   23 FLTLKDFNPDEIKHILRVSADLKHRIKLQGQYLP-LLQGKSIAMIFEKRSTRTRMSTETGFSLLGGHPCFLTPQDIHLGVNESTTDTARVLSGLADIVLARVYSHSTLEQLSKEASIPIIN-GLSDLYHPIQILADLLTLQEHYGSLKGLTVAWIGDGNN--VLHSLMMSLAKLGVNLRIATPKGYEPDAAVTQEAQRLSKQFGTE--LQLSSEPMEAA-QGSNVLVTDTWISMGQEEEKKK----RIKDFQGYQITMQTGSVAAPDWTFLHCLPRKSEEVNDEVFYSPRSLVFTEAENRKWTIMGLMVCMLT 324          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Cavefish
Match: otc (ornithine carbamoyltransferase [Source:NCBI gene;Acc:103045553])

HSP 1 Score: 88.9669 bits (219), Expect = 5.712e-19
Identity = 84/313 (26.84%), Postives = 143/313 (45.69%), Query Frame = 1
Query:  487 FLTVKGLDKLKVNHILNLAHNF-HILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLR------YVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVV----YMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPR-CEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMS 1389
            FLT+K  +  ++ HIL ++ +  H +  + + L  LL+GK + ++F + STRT  S       LGG       +   +   ES  DT R+LS   D ++ R      ++ +S+ +S P+IN G     HP Q L D+ T++E +G++  L +  +GD  N   +HSL   L    V LR      Y       +  Q +     ++  LQ     +E+A + S+V+    +++  Q E   K     +K      IT +    A      +H LPR  EE++      PR+  F +AE   +  M L+  +++
Sbjct:   40 FLTLKDFNPDEIKHILRVSADLKHRIKLQGQYLP-LLQGKSIAMIFEKRSTRTRMSTETGFSLLGGHPCFLTPQDIHLGVNESTTDTARVLSGLADIVLARVYSHSTLEQLSKEASIPIIN-GLSDLYHPIQILADLLTLQEHYGSLKGLTVAWIGDGNN--VLHSLMMSLAKLGVNLRIATPKGYEPDAAVTQEAQRLSKQFGTE--LQLSSEPMEAA-QGSNVLVTDTWISMGQEEEKKK----RIKDFQGYQITMQTGSVAAPDWTFLHCLPRKSEEVNDEVFYSPRSLVFTEAENRKWTIMGLMVCMLT 341          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Yeast
Match: URA2 (Bifunctional carbamoylphosphate synthetase/aspartate transcarbamylase; catalyzes the first two enzymatic steps in the de novo biosynthesis of pyrimidines; both activities are subject to feedback inhibition by UTP [Source:SGD;Acc:S000003666])

HSP 1 Score: 254.218 bits (648), Expect = 1.467e-74
Identity = 130/309 (42.07%), Postives = 195/309 (63.11%), Query Frame = 1
Query:  463 NKEITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLES-ALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIM 1386
            N    G H L++K   +   + +  +A        R E +  L++G V+  +F+E STRT  SF AAM++LGG ++  N   SSV KGE+L+DT+R L+ Y+D +V+RH  + ++ I ++ S  P+IN G+GS EHPTQA LD+FTIREE GTVN + +T +GDL +GRTVHSL +LL  Y V++  V+  + +++P+ + + +   G+L  E  +L    +  +DV+Y TRVQ ER N   E   +  +   + ++++  AK+ M +MHPLPR  EI    D D RAAYFRQ +YGL+VRM+LLA +M
Sbjct: 1905 NNPFRGRHILSIKQFKRSDFHVLFAVAQELRAAVAR-EGVLDLMKGHVITTIFFEPSTRTCSSFIAAMERLGGRIVNVNPLVSSVKKGETLQDTIRTLACYSDAIVMRHSEEMSVHIAAKYSPVPIINGGNGSREHPTQAFLDLFTIREEIGTVNGITVTFMGDLKHGRTVHSLCRLLMHYQVRINLVSPPE-LRLPEGLREELRKAGLLGVESIELTPHIISKTDVLYCTRVQEERFNS-PEEYARLKDTYIVDNKILAHAKENMAIMHPLPRVNEIKEEVDYDHRAAYFRQMKYGLFVRMALLAMVM 2210          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Nematostella
Match: EDO37703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF31])

HSP 1 Score: 348.206 bits (892), Expect = 1.198e-106
Identity = 175/306 (57.19%), Postives = 224/306 (73.20%), Query Frame = 1
Query:  472 ITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMS 1389
            ITGH  L+   L K +++ I N+AH+   + +R E     L+G+V+  MFYE STRTS SF+AAMQ+LGG+V+  N   SS  KGESL D+V+++SSY+D +V+RHP  GA+   +    KPVINAGDG GEHPTQALLD+FTIREE GTVN + +TMVGDL NGRTVHSLA+LLCLY V LRYV+   S++MP  + DYV S+GI+QEE   LE AL DSDV+Y+TR+QRER N   E + +      IT +++  AK++M+VMHPLPR  EIS   DSDPRAAYFRQAEYG+YVRM+LLA ++ 
Sbjct: 1908 ITGH-ILSAGQLTKEQLHVIFNVAHDMRRVVKR-EGGVDFLKGRVMASMFYEVSTRTSSSFSAAMQRLGGTVVQMNASDSSAKKGESLADSVQVMSSYSDVVVIRHPKIGAVQEAAAHCRKPVINAGDGVGEHPTQALLDVFTIREEIGTVNGVTVTMVGDLKNGRTVHSLARLLCLYRVTLRYVS-PPSLRMPDKVKDYVRSRGIVQEEYTSLEEALPDSDVLYVTRIQRERFNTQEEYE-QVFGSYVITPQVLNEAKEKMVVMHPLPRVNEISVEVDSDPRAAYFRQAEYGMYVRMALLALLVG 2209          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Nematostella
Match: EDO26385 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TC55])

HSP 1 Score: 132.88 bits (333), Expect = 4.776e-36
Identity = 84/239 (35.15%), Postives = 132/239 (55.23%), Query Frame = 1
Query:  466 KEITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVR-MLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIV-DYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERIN 1176
            KE++ +H + +K ++K  ++ I   A +F  +  R       L    +  +F+E STRT  SF  A ++L   V++F+   SSV KGE+L DTV  +LS   D +V+RH   GA   +S+  +  ++NAGDG+ EHPTQALLD +TIRE+ G V    + +VGD+ + R   S    L +   +++          P +++  Y+ S G+  E  P+L  AL  +DV  M RVQ ER++
Sbjct:    2 KELSVNHLIGIKYINKNDIDXIFETADHFKEVINRPIKKVPSLRDITIANIFFENSTRTKLSFELAQKRLSADVISFSAAQSSVKKGETLIDTVNNILSMKVDMVVMRHSSPGAAHFLSQNVNASIVNAGDGAHEHPTQALLDSYTIREKLGDVAGKKVVIVGDILHSRVALSNIFALQMQGAEVKVCG-------PNTLIPKYIASLGVKVE--PNLRKALEWADVANMLRVQNERLD 231          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Nematostella
Match: EDO44662 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV06])

HSP 1 Score: 80.8777 bits (198), Expect = 1.096e-16
Identity = 78/322 (24.22%), Postives = 144/322 (44.72%), Query Frame = 1
Query:  472 ITGHHFLTVKGLDKLKVNHILNLAH---------NFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQ---EEMPDLESALRDSDVV----YMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPR-CEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIM 1386
            + G +FLT+K     +++++L  A          N+  LSE    LS    GK   L+F + STRT  S    +  LG   +   +K   +   E++ DT R+LS + D ++ R   Q  ++ ++  ++ PV+ +G     HP Q L D+ T++E FG++ N  +  VGD  N   +HS         +KL+          P+ + D +      +   E   D   A   +DVV    +++  Q E       + +K+     +  ELM    +  + +H LPR  EE++       ++  +++AE   +  M+++  ++
Sbjct:   47 VKGRNFLTLKNFTSDEIHYLLWCAADLKARFKDPNWKYLSESFSPLS----GKSAALIFLKRSTRTRISMETGLSLLGCQPVFLTDKDIHLGVNENIYDTARVLSGFVDIILARVNKQEEVESLANNATVPVV-SGLSDLYHPLQILADLQTLQEHFGSLYNHTVAWVGDGNN--ILHSFLMAAPKMGMKLQIATPKGYDPDPEILKDAMEFAKEFKTTIELTRDPREACEKADVVVTDTWVSMGQEEE----SAARLKAFQGYQVNKELMSLTNQDSVFLHCLPRHPEEVTDDVFYSEKSLIWQEAENRKWTAMAVMLCLL 357          
BLAST of Aspartate carbamoyltransferase vs. Ensembl Medaka
Match: otc (ornithine carbamoyltransferase [Source:NCBI gene;Acc:101173100])

HSP 1 Score: 80.4925 bits (197), Expect = 3.999e-16
Identity = 77/317 (24.29%), Postives = 141/317 (44.48%), Query Frame = 1
Query:  472 ITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLR------YVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVV----YMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPR-CEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMS 1389
            + G   LT+K     ++  +L ++ +   L ++ +    LL+GK + ++F + STRT  S    M  LGG       +   +   ES  DT R+LS   D ++ R      ++ + R +S P+IN G     HP Q L D  T++E +G+++ L ++ +GD  N   +HS         V LR      Y A +  ++  +++     ++ +L     D   A   S+V+    +++  Q E   K     ++      IT +    A+     +H LPR  EE+        R+  F +AE   +  M L+ ++++
Sbjct:   40 LKGRSCLTLKDFSSEEITRLLWVSGDLKRLIKQEKQYLPLLQGKSIAMIFEKRSTRTRMSTETGMALLGGHPCFLTSQDIHLGVNESCTDTARVLSGLCDLVLARVYSHSTLEELHREASIPIIN-GLSDLYHPIQILADFLTLQEHYGSLSGLTVSWIGDGNN--VLHSFMMAAAKLGVHLRVATPKGYEADSSVIQEAKNLSKQHGTQLVLTS---DPMEAAHGSNVLVTDTWISMGQEEEKKK----RLRDFQGYQITMKTGSVAEPDWTFLHCLPRKPEEVDDQVFYSTRSLVFNEAENRKWTIMGLMVSLLT 346          
BLAST of Aspartate carbamoyltransferase vs. Planmine SMEST
Match: SMESG000012911.1 (SMESG000012911.1)

HSP 1 Score: 789.645 bits (2038), Expect = 0.000e+0
Identity = 385/385 (100.00%), Postives = 385/385 (100.00%), Query Frame = 1
Query:  241 LTEKGTGRNVALKTLTTPMPHFLRNRHVSSISKVDEDIQELTTIITEEVNNGLAVHPKIPLSNLTKKIKIQEIYNKEITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMSHI 1395
            LTEKGTGRNVALKTLTTPMPHFLRNRHVSSISKVDEDIQELTTIITEEVNNGLAVHPKIPLSNLTKKIKIQEIYNKEITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMSHI
Sbjct: 1814 LTEKGTGRNVALKTLTTPMPHFLRNRHVSSISKVDEDIQELTTIITEEVNNGLAVHPKIPLSNLTKKIKIQEIYNKEITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLLEGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAEYGLYVRMSLLATIMSHI 2198          
BLAST of Aspartate carbamoyltransferase vs. Planmine SMEST
Match: SMESG000035784.1 (SMESG000035784.1)

HSP 1 Score: 62.3882 bits (150), Expect = 1.009e-10
Identity = 62/239 (25.94%), Postives = 114/239 (47.70%), Query Frame = 1
Query:  715 VSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDL------ESALRDSDVVY------MTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPR-CEEISTS-FDSDPRAAYFRQAEYGLYVRMSLLATIMS 1389
            + K E++EDT ++LS + D ++ R      ++ ++  +S PVIN G  +  HP Q L DI T++E +G V  L +  +GD  N    HS         + L+ +A   S +   ++V+Y   + + ++   +L        A+ +S+VV       M R + E + +L +     ++KN     L+  A      +H LPR  +E+S   F    R+  + +AE   +  M++L  ++S
Sbjct:   15 LGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVIN-GLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGD-GNNNMTHSYIVACGKLGLNLK-IASPKSYEPDSNVVNY--GRELFEKNNCNLVLTTNPVEAVHNSEVVVTDTFVSMGR-ETENLIRLRDFTGYQVDKN-----LVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLS 242          
BLAST of Aspartate carbamoyltransferase vs. Planmine SMEST
Match: SMESG000040441.1 (SMESG000040441.1)

HSP 1 Score: 60.077 bits (144), Expect = 9.924e-10
Identity = 62/239 (25.94%), Postives = 113/239 (47.28%), Query Frame = 1
Query:  715 VSKGESLEDTVRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDIFTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSMKMPQSIVDYVTSKGILQEEMPDL------ESALRDSDVVY------MTRVQRERINKLGESDVKSINKNTITSELMVSAKKRMIVMHPLPR-CEEISTS-FDSDPRAAYFRQAEYGLYVRMSLLATIMS 1389
            + K E++EDT ++LS + D ++ R      ++ ++  +S PVIN G  +  HP Q L DI T++E +G V  L +  +GD  N    HS         + L+ +A   S +   ++V+Y   + + ++    L        A+ +S+VV       M R + E + +L +     ++KN     L+  A      +H LPR  +E+S   F    R+  + +AE   +  M++L  ++S
Sbjct:   86 LGKNETIEDTAKVLSKFNDAILARVYEHMDLNTLATYASVPVIN-GLSNSYHPLQLLADILTLQEHYGHVKGLNVAWIGD-GNNNMTHSYIVACGKLGLNLK-IASPKSYEPDSNVVNY--GRELFEKNNCKLVLTTNPVEAVHNSEVVVTDTFVSMGR-ETENLIRLRDFTGYQVDKN-----LVSIASPNWCFLHCLPRKPDEVSDEVFYDKNRSLVWNEAENRKWTVMAVLVNLLS 313          
The following BLAST results are available for this feature:
BLAST of Aspartate carbamoyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CAD1.401e-10654.22carbamoyl-phosphate synthetase 2, aspartate transc... [more]
CAD1.500e-10654.22carbamoyl-phosphate synthetase 2, aspartate transc... [more]
CAD9.947e-10252.74carbamoyl-phosphate synthetase 2, aspartate transc... [more]
OTC9.591e-1925.23ornithine carbamoyltransferase [Source:HGNC Symbol... [more]
back to top
BLAST of Aspartate carbamoyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pyr-14.684e-9150.77CAD protein Glutamine-dependent carbamoyl-phosphat... [more]
back to top
BLAST of Aspartate carbamoyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
r1.370e-10553.43gene:FBgn0003189 transcript:FBtr0089734[more]
r1.370e-10553.43gene:FBgn0003189 transcript:FBtr0340156[more]
r1.370e-10553.43gene:FBgn0003189 transcript:FBtr0340155[more]
back to top
BLAST of Aspartate carbamoyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cad1.661e-10755.23carbamoyl-phosphate synthetase 2, aspartate transc... [more]
cad3.211e-4854.73carbamoyl-phosphate synthetase 2, aspartate transc... [more]
otc2.749e-1927.13ornithine carbamoyltransferase [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Aspartate carbamoyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAD9.094e-11258.17carbamoyl-phosphate synthetase 2, aspartate transc... [more]
CAD1.026e-11158.17carbamoyl-phosphate synthetase 2, aspartate transc... [more]
CAD1.571e-11158.17carbamoyl-phosphate synthetase 2, aspartate transc... [more]
otc4.379e-1825.00ornithine carbamoyltransferase [Source:NCBI gene;A... [more]
otc8.409e-1729.88ornithine carbamoyltransferase [Source:NCBI gene;A... [more]
back to top
BLAST of Aspartate carbamoyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cad5.264e-10955.19carbamoyl-phosphate synthetase 2, aspartate transc... [more]
Cad5.583e-10955.19carbamoyl-phosphate synthetase 2, aspartate transc... [more]
Cad1.131e-6858.16carbamoyl-phosphate synthetase 2, aspartate transc... [more]
Cad1.546e-6857.87carbamoyl-phosphate synthetase 2, aspartate transc... [more]
Otc5.070e-2025.08ornithine transcarbamylase [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Aspartate carbamoyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B2RQC6|PYR1_MOUSE3.905e-10855.19CAD protein OS=Mus musculus OX=10090 GN=Cad PE=1 S... [more]
sp|P08955|PYR1_MESAU5.466e-10855.19CAD protein OS=Mesocricetus auratus OX=10036 GN=CA... [more]
sp|Q91437|PYR1_SQUAC1.450e-10655.88CAD protein OS=Squalus acanthias OX=7797 GN=CAD PE... [more]
sp|P27708|PYR1_HUMAN6.730e-10654.22CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV... [more]
sp|P05990|PYR1_DROME1.373e-10453.43CAD protein OS=Drosophila melanogaster OX=7227 GN=... [more]
back to top
BLAST of Aspartate carbamoyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183LU664.015e-12354.78Uncharacterized protein OS=Schistosoma margrebowie... [more]
A0A0B6Z6L45.133e-12358.71Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
A0A183JG392.631e-12256.23Uncharacterized protein OS=Schistosoma curassoni O... [more]
A0A3P7X7062.902e-12256.23Uncharacterized protein OS=Schistosoma curassoni O... [more]
A0A131XIN03.173e-12157.24Putative carbamoyl-phosphate synthase large chain ... [more]
back to top
BLAST of Aspartate carbamoyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cad8.312e-10755.05carbamoyl-phosphate synthetase 2, aspartate transc... [more]
cad3.955e-10654.37carbamoyl-phosphate synthetase 2, aspartate transc... [more]
otc3.850e-1926.84ornithine carbamoyltransferase [Source:NCBI gene;A... [more]
otc3.926e-1926.84ornithine carbamoyltransferase [Source:NCBI gene;A... [more]
otc5.712e-1926.84ornithine carbamoyltransferase [Source:NCBI gene;A... [more]
back to top
BLAST of Aspartate carbamoyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Aspartate carbamoyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
URA21.467e-7442.07Bifunctional carbamoylphosphate synthetase/asparta... [more]
back to top
BLAST of Aspartate carbamoyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO377031.198e-10657.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO263854.776e-3635.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO446621.096e-1624.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Aspartate carbamoyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
otc3.999e-1624.29ornithine carbamoyltransferase [Source:NCBI gene;A... [more]
back to top
BLAST of Aspartate carbamoyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000012911.10.000e+0100.00SMESG000012911.1[more]
SMESG000035784.11.009e-1025.94SMESG000035784.1[more]
SMESG000040441.19.924e-1025.94SMESG000040441.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020687 ID=SMED30020687|Name=Aspartate carbamoyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1449bp
TCATAGTAATTTGCAGGGAGTAGGTGTGTTATTTTAACTTATATAATCAA
GCCGGGCGCTCTACAGTATATAACTTGTTGCTGAACCGCCCATTTAGCAG
CAGTCACAAGACATGCTATGCGCATCATATTGGCATTTGGTGGAAATAGC
AGTTTATGTGCATAACAATTTGTTTTAGTGCAAGTGGTTAAATTAAAAGA
ATTCTATAAAATAATATTAACTGAGTTTTCAATTTTAGTTTTAACCGAAA
AGGGCACCGGAAGAAATGTGGCATTGAAAACGCTGACTACTCCTATGCCA
CATTTTCTACGTAATCGGCATGTTTCAAGTATTAGCAAAGTTGATGAAGA
CATTCAAGAGTTAACAACAATTATAACTGAAGAGGTCAATAATGGTTTGG
CTGTTCATCCTAAAATTCCTCTTAGTAATTTAACAAAAAAGATAAAAATT
CAAGAGATTTATAATAAAGAAATTACTGGACATCATTTTTTGACTGTAAA
AGGTTTGGATAAACTTAAAGTGAATCATATTTTGAACCTTGCACATAACT
TCCATATATTGTCGGAAAGAAATGAAAATTTAAGTCATCTATTAGAAGGA
AAAGTATTAGGTTTAATGTTTTATGAAACAAGCACGAGAACCTCGTGTTC
TTTTACAGCTGCCATGCAAAAATTAGGGGGTTCTGTTTTGACCTTCAATG
AAAAAACAAGCTCAGTATCGAAAGGAGAGTCTTTAGAAGATACTGTTAGA
ATGTTGTCATCTTATACAGACTGTCTTGTCGTCAGGCATCCAATTCAAGG
TGCAATCGATATTGTTAGTAGAGTGAGCTCTAAACCAGTTATAAATGCTG
GAGACGGGTCAGGCGAACACCCAACTCAAGCTTTATTGGATATTTTTACA
ATACGAGAAGAGTTTGGAACTGTTAATAATTTAATTATCACCATGGTAGG
GGACTTAGCGAATGGTCGAACTGTTCATAGTCTTGCAAAATTGCTCTGTT
TGTACAATGTCAAATTACGATATGTTGCTCATACTGACTCAATGAAAATG
CCTCAATCGATTGTAGATTATGTTACTTCTAAGGGAATACTCCAAGAAGA
AATGCCAGATTTGGAAAGTGCTTTACGAGATTCTGATGTTGTTTATATGA
CCCGTGTTCAACGAGAACGTATAAATAAATTAGGTGAATCAGATGTGAAA
TCAATTAATAAAAATACTATTACATCAGAATTGATGGTGTCGGCAAAGAA
ACGGATGATTGTCATGCATCCGTTACCCCGATGCGAGGAAATTAGCACAT
CCTTTGATTCTGATCCAAGAGCTGCATATTTTAGGCAAGCTGAATATGGA
CTTTATGTACGAATGTCTTTATTAGCTACTATTATGAGCCACATATAAGA
TTATAAATATTAAAATGTGTATAATAATAAATTTAGTTTTGTTAAACAA
back to top

protein sequence of SMED30020687-orf-1

>SMED30020687-orf-1 ID=SMED30020687-orf-1|Name=SMED30020687-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=368bp
MPHFLRNRHVSSISKVDEDIQELTTIITEEVNNGLAVHPKIPLSNLTKKI
KIQEIYNKEITGHHFLTVKGLDKLKVNHILNLAHNFHILSERNENLSHLL
EGKVLGLMFYETSTRTSCSFTAAMQKLGGSVLTFNEKTSSVSKGESLEDT
VRMLSSYTDCLVVRHPIQGAIDIVSRVSSKPVINAGDGSGEHPTQALLDI
FTIREEFGTVNNLIITMVGDLANGRTVHSLAKLLCLYNVKLRYVAHTDSM
KMPQSIVDYVTSKGILQEEMPDLESALRDSDVVYMTRVQRERINKLGESD
VKSINKNTITSELMVSAKKRMIVMHPLPRCEEISTSFDSDPRAAYFRQAE
YGLYVRMSLLATIMSHI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036901Asp/Orn_carbamoylTrfase_sf
IPR001024PLAT/LH2_dom
IPR006130Asp/Orn_carbamoylTrfase
IPR002082Asp_carbamoyltransf
IPR006132Asp/Orn_carbamoyltranf_P-bd
IPR006131Asp_carbamoyltransf_Asp/Orn-bd
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0016597amino acid binding
GO:0016743carboxyl- or carbamoyltransferase activity
GO:0004070aspartate carbamoyltransferase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006520cellular amino acid metabolic process
GO:0006207'de novo' pyrimidine nucleobase biosynthetic process
GO:0006221pyrimidine nucleotide biosynthetic process
GO:0044205'de novo' UMP biosynthetic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00101ATCASEcoord: 191..208
score: 67.52
coord: 283..292
score: 64.36
coord: 323..328
score: 79.06
coord: 137..146
score: 61.79
coord: 99..121
score: 50.95
coord: 345..359
score: 55.56
NoneNo IPR availablePANTHERPTHR11405CARBAMOYLTRANSFERASE FAMILY MEMBERcoord: 58..364
IPR006130Aspartate/ornithine carbamoyltransferasePRINTSPR00100AOTCASEcoord: 109..128
score: 54.42
coord: 192..203
score: 67.42
coord: 319..328
score: 51.04
coord: 329..352
score: 36.15
IPR006130Aspartate/ornithine carbamoyltransferasePROSITEPS00097CARBAMOYLTRANSFERASEcoord: 109..116
IPR006132Aspartate/ornithine carbamoyltransferase, carbamoyl-P bindingPFAMPF02729OTCace_Ncoord: 64..205
e-value: 1.5E-46
score: 158.0
IPR002082Aspartate carbamoyltransferaseTIGRFAMTIGR00670TIGR00670coord: 64..364
e-value: 8.1E-94
score: 312.1
IPR002082Aspartate carbamoyltransferasePANTHERPTHR11405:SF16ASPARTATE CARBAMOYLTRANSFERASE, CHLOROPLASTICcoord: 58..364
IPR006131Aspartate/ornithine carbamoyltransferase, Asp/Orn-binding domainPFAMPF00185OTCacecoord: 212..362
e-value: 5.5E-30
score: 104.5
IPR036901Aspartate/ornithine carbamoyltransferase superfamilyGENE3DG3DSA:3.40.50.1370coord: 64..362
e-value: 8.0E-110
score: 368.5
IPR036901Aspartate/ornithine carbamoyltransferase superfamilyGENE3DG3DSA:3.40.50.1370coord: 192..351
e-value: 8.0E-110
score: 368.5
IPR036901Aspartate/ornithine carbamoyltransferase superfamilySUPERFAMILYSSF53671Aspartate/ornithine carbamoyltransferasecoord: 61..365