Transmembrane protein 80

Overview
NameTransmembrane protein 80
Smed IDSMED30020686
Length (bp)685
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transmembrane protein 80 (SMED30020686) t-SNE clustered cells

Violin plots show distribution of expression levels for Transmembrane protein 80 (SMED30020686) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transmembrane protein 80 (SMED30020686) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transmembrane protein 80 (SMED30020686) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020686

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30020686SMESG000018777.1 SmedASXL_065084SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30020686SMESG000018777.1 dd_Smed_v4_13318_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30020686SMESG000018777.1 dd_Smed_v6_13318_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30020686SMESG000018777.1 dd_Smed_v4_13318_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transmembrane protein 80 vs. Ensembl Human
Match: TMEM216 (transmembrane protein 216 [Source:HGNC Symbol;Acc:HGNC:25018])

HSP 1 Score: 60.8474 bits (146), Expect = 2.904e-11
Identity = 42/129 (32.56%), Postives = 72/129 (55.81%), Query Frame = 2
Query:  161 SLVPYQVVLHFQQYYSAXXXXXXXXXXXXKGQILPYVTVNFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSR 547
            S  P +++     +Y+A +F+ EL I   KG +LPY T N   ++V+LL    +E  R+ +G  GNL ++   +++S  LT P+ +   + L+ QTY   +E +    +L FC  EL+ ++L +  FSR
Sbjct:   16 SSTPLEILFFLNGWYNATYFLLELFIFLYKGVLLPYPTANLVLDVVMLLLYLGIEVIRLFFGTKGNLCQRKMPLSISVALTFPSAMMASYYLLLQTYVLRLEAIMNGILLFFCGSELLLEVLTLAAFSR 144          
BLAST of Transmembrane protein 80 vs. Ensembl Human
Match: TMEM216 (transmembrane protein 216 [Source:HGNC Symbol;Acc:HGNC:25018])

HSP 1 Score: 58.9214 bits (141), Expect = 1.904e-10
Identity = 41/131 (31.30%), Postives = 72/131 (54.96%), Query Frame = 2
Query:  161 SLVPYQVVLHFQQYYSAXXXXXXXXXXXXKGQILPYVTVNFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSRAN 553
            S  P +++     +Y+A +F+ EL I   KG +LPY T N   ++V+LL    +E  R+ +G  GNL ++   +++S  LT P+ +   + L+ QTY   +E +    +L FC  EL+ ++L +  FS  +
Sbjct:   16 SSTPLEILFFLNGWYNATYFLLELFIFLYKGVLLPYPTANLVLDVVMLLLYLGIEVIRLFFGTKGNLCQRKMPLSISVALTFPSAMMASYYLLLQTYVLRLEAIMNGILLFFCGSELLLEVLTLAAFSSMD 146          
BLAST of Transmembrane protein 80 vs. Ensembl Human
Match: TMEM216 (transmembrane protein 216 [Source:HGNC Symbol;Acc:HGNC:25018])

HSP 1 Score: 48.1358 bits (113), Expect = 3.256e-7
Identity = 24/76 (31.58%), Postives = 43/76 (56.58%), Query Frame = 2
Query:  320 LEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSR 547
            +E  R+ +G  GNL ++   +++S  LT P+ +   + L+ QTY   +E +    +L FC  EL+ ++L +  FSR
Sbjct:    8 IEVIRLFFGTKGNLCQRKMPLSISVALTFPSAMMASYYLLLQTYVLRLEAIMNGILLFFCGSELLLEVLTLAAFSR 83          
BLAST of Transmembrane protein 80 vs. Ensembl Human
Match: TMEM80 (transmembrane protein 80 [Source:HGNC Symbol;Acc:HGNC:27453])

HSP 1 Score: 48.9062 bits (115), Expect = 8.322e-7
Identity = 40/133 (30.08%), Postives = 66/133 (49.62%), Query Frame = 2
Query:  149 NNIRSLVPYQVVLHFQQYYSAXXXXXXXXXXXXKGQILPYVTVNFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSR 547
            + + S VP Q++ +    Y AL+F++ LL++  K Q+  Y       ++ LL  M ILE  R+  G  GNLTE    +A S  LT  T +     L+WQ    + +    A +L    +E + +++ I  F+R
Sbjct:   28 STVLSSVPLQMLFYLSGTYYALYFLATLLMITYKSQVFSYPHRYLVLDLALLFLMGILEAVRLYLGTRGNLTEAERPLAASLALTAGTALLSAHFLLWQALVLWADWALSATLLALHGLEAVLQVVAIAAFTR 160          
BLAST of Transmembrane protein 80 vs. Ensembl Human
Match: TMEM80 (transmembrane protein 80 [Source:HGNC Symbol;Acc:HGNC:27453])

HSP 1 Score: 48.1358 bits (113), Expect = 3.090e-6
Identity = 25/79 (31.65%), Postives = 38/79 (48.10%), Query Frame = 2
Query:  311 MAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSR 547
            M ILE  R+  G  GNLTE    +A S  LT  T +     L+WQ    + +    A +L    +E + +++ I  F+R
Sbjct:  138 MGILEAVRLYLGTRGNLTEAERPLAASLALTAGTALLSAHFLLWQALVLWADWALSATLLALHGLEAVLQVVAIAAFTR 216          
BLAST of Transmembrane protein 80 vs. Ensembl Celegans
Match: mks-2 (MecKel-Gruber Syndrome (MKS) homolog [Source:UniProtKB/TrEMBL;Acc:C8JQP7])

HSP 1 Score: 72.7886 bits (177), Expect = 3.769e-16
Identity = 47/135 (34.81%), Postives = 80/135 (59.26%), Query Frame = 2
Query:  149 NNIRSLVPYQVVLHFQQYYSAXXXXXXXXXXXXKGQILPYVTVNFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSRAN 553
            +N+RS + YQ++L  Q+  S ++F+   ++ F KG ILPY       E  +++    +EY RI +G  GNL E + ++A+S +L+IP I+  V+L  +Q Y  +IE +F   M  F ++E +  L++ ITFS + 
Sbjct:    3 SNVRSSLVYQILLSLQKTLSIVYFLVIFILYFYKGAILPYPRYVRVMEFFVIIPFIPIEYLRINWGSRGNLLESTAFLALSTVLSIPIIIILVYLEFFQNYVLFIEEIFTYVMGFFVILETLLSLVLTITFSSSG 137          
BLAST of Transmembrane protein 80 vs. Ensembl Fly
Match: TMEM216 (gene:FBgn0037614 transcript:FBtr0081905)

HSP 1 Score: 50.8322 bits (120), Expect = 5.102e-8
Identity = 31/125 (24.80%), Postives = 67/125 (53.60%), Query Frame = 2
Query:  173 YQVVLHFQQYYSAXXXXXXXXXXXXKGQILPYVTVNFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSR 547
            Y+++++   +Y  ++   E+ +  +K   L Y     S E  +LL++ I+E  RI +G   +L+++ +    S +LT+P++   ++L  +QT+   +E++  A M+     EL++  + I T  R
Sbjct:    7 YEILMYLNSFYFGMYAAFEVGVGVLKAINLNYGENALSREASILLSLCIIETVRIVFGRKSSLSDRGWQATASVILTLPSLAIVIYLCCFQTFVLKLEIILSALMITLQGAELVYASIFICTMCR 131          
BLAST of Transmembrane protein 80 vs. Ensembl Fly
Match: TMEM216 (gene:FBgn0037614 transcript:FBtr0300544)

HSP 1 Score: 50.8322 bits (120), Expect = 5.102e-8
Identity = 31/125 (24.80%), Postives = 67/125 (53.60%), Query Frame = 2
Query:  173 YQVVLHFQQYYSAXXXXXXXXXXXXKGQILPYVTVNFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSR 547
            Y+++++   +Y  ++   E+ +  +K   L Y     S E  +LL++ I+E  RI +G   +L+++ +    S +LT+P++   ++L  +QT+   +E++  A M+     EL++  + I T  R
Sbjct:    7 YEILMYLNSFYFGMYAAFEVGVGVLKAINLNYGENALSREASILLSLCIIETVRIVFGRKSSLSDRGWQATASVILTLPSLAIVIYLCCFQTFVLKLEIILSALMITLQGAELVYASIFICTMCR 131          
BLAST of Transmembrane protein 80 vs. Ensembl Fly
Match: TMEM216 (gene:FBgn0037614 transcript:FBtr0300543)

HSP 1 Score: 50.8322 bits (120), Expect = 5.102e-8
Identity = 31/125 (24.80%), Postives = 67/125 (53.60%), Query Frame = 2
Query:  173 YQVVLHFQQYYSAXXXXXXXXXXXXKGQILPYVTVNFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSR 547
            Y+++++   +Y  ++   E+ +  +K   L Y     S E  +LL++ I+E  RI +G   +L+++ +    S +LT+P++   ++L  +QT+   +E++  A M+     EL++  + I T  R
Sbjct:    7 YEILMYLNSFYFGMYAAFEVGVGVLKAINLNYGENALSREASILLSLCIIETVRIVFGRKSSLSDRGWQATASVILTLPSLAIVIYLCCFQTFVLKLEIILSALMITLQGAELVYASIFICTMCR 131          
BLAST of Transmembrane protein 80 vs. Ensembl Zebrafish
Match: TMEM216 (si:rp71-1d10.5 [Source:NCBI gene;Acc:555988])

HSP 1 Score: 65.4698 bits (158), Expect = 5.389e-13
Identity = 53/145 (36.55%), Postives = 80/145 (55.17%), Query Frame = 2
Query:  119 NLEMHTTKLYNNIRSLVPYQVVLHFQQYYSAXXXXXXXXXXXXKGQILPYVTVNFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSRAN 553
            N+  H  +    + S  P Q++ H   +Y A FF++E+L+   KG ILPY   N   ++VLLL  + LE  R+ YG  GNL ++S  + VS  + +P  V  V+ L+ QT+   +E V  A +L F   EL+  ++ I  FSRAN
Sbjct:   17 NMAAHGRQ---PVLSSTPLQILFHLNGWYFAAFFVAEILMFIYKGVILPYPQDNLILDVVLLLLFSGLETLRLFYGWKGNLCQRSLALFVSVAILVPCAVLSVYYLLLQTFVLRLEFVLNAVLLCFYGFELVLGVMTISIFSRAN 158          
BLAST of Transmembrane protein 80 vs. Ensembl Zebrafish
Match: TMEM216 (si:rp71-1d10.5 [Source:NCBI gene;Acc:555988])

HSP 1 Score: 60.077 bits (144), Expect = 3.851e-11
Identity = 49/129 (37.98%), Postives = 73/129 (56.59%), Query Frame = 2
Query:  161 SLVPYQVVLHFQQYYSAXXXXXXXXXXXXKGQILPYVTVNFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSR 547
            S  P Q++ H   +Y A FF++E+L+   KG ILPY   N   ++VLLL  + LE  R+ YG  GNL ++S  + VS  + +P  V  V+ L+ QT+   +E V  A +L F   EL+  ++ I  FSR
Sbjct:   13 SSTPLQILFHLNGWYFAAFFVAEILMFIYKGVILPYPQDNLILDVVLLLLFSGLETLRLFYGWKGNLCQRSLALFVSVAILVPCAVLSVYYLLLQTFVLRLEFVLNAVLLCFYGFELVLGVMTISIFSR 141          
BLAST of Transmembrane protein 80 vs. Ensembl Xenopus
Match: pkd1 (polycystin 1, transient receptor potential channel interacting [Source:Xenbase;Acc:XB-GENE-483409])

HSP 1 Score: 59.3066 bits (142), Expect = 1.154e-10
Identity = 47/129 (36.43%), Postives = 64/129 (49.61%), Query Frame = 2
Query:  161 SLVPYQVVLHFQQYYSAXXXXXXXXXXXXKGQILPYVTVNFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSR 547
            S  P +V+     +Y A +F+ E LI   KG ILPY T N   E  LL     +E  R+  G  GNL E+   + VS  LTIP  +  V+ L+ QTY   +E V    +L+F  +E I     +IT  R
Sbjct:   15 SSTPLEVLFFLNGWYCASYFLIETLIFIYKGLILPYPTSNLILESFLLFLYLGIEVSRLFLGCRGNLCERKLPLVVSLGLTIPAGLLAVYFLLLQTYALRLETVLNCILLLFYGLEAILSCTALITLCR 143          
BLAST of Transmembrane protein 80 vs. Ensembl Xenopus
Match: TMEM80 (transmembrane protein 80 [Source:NCBI gene;Acc:100486338])

HSP 1 Score: 50.0618 bits (118), Expect = 2.596e-7
Identity = 40/129 (31.01%), Postives = 70/129 (54.26%), Query Frame = 2
Query:  161 SLVPYQVVLHFQQYYSAXXXXXXXXXXXXKGQILPYVTVNFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSR 547
            S VP Q++L+    Y   +F++ LL++  K Q+  Y   N + ++ LL  M ILE  R+  G  GNL E+   +  S L+T+  I   ++ L+WQTY    +++    +L+   +E+I ++L +  F R
Sbjct:   14 SSVPLQMLLYLNIIYYVFYFLATLLMIIYKSQVFSYPGSNLALDLCLLFLMGILEPVRLYLGTQGNLAEEEIPLGSSLLVTVGNIFLAIYFLVWQTYILRADLIINIILLVIYGLEVILEVLTVAAFFR 142          
BLAST of Transmembrane protein 80 vs. Ensembl Mouse
Match: Tmem216 (transmembrane protein 216 [Source:MGI Symbol;Acc:MGI:1920020])

HSP 1 Score: 60.8474 bits (146), Expect = 2.055e-11
Identity = 44/131 (33.59%), Postives = 73/131 (55.73%), Query Frame = 2
Query:  161 SLVPYQVVLHFQQYYSAXXXXXXXXXXXXKGQILPYVTVNFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSRAN 553
            S  P +V+     +Y A +F+ ELLI   KG +LPY T N   ++V+LL    +E  R+ +G  GNL ++   + +S  LT P+ +   + L+ QTY   +E +  + +L FC  EL+ ++L + TFS  +
Sbjct:    9 SSTPLEVLFFLNGWYYATYFLLELLIFLYKGLLLPYPTANLVLDVVMLLLYLGIEVIRLFFGTKGNLCQRKMPLGISVALTFPSAMMASYYLLLQTYVLRLEAIMNSILLFFCGSELLLEMLTLATFSSMD 139          
BLAST of Transmembrane protein 80 vs. Ensembl Mouse
Match: Tmem216 (transmembrane protein 216 [Source:MGI Symbol;Acc:MGI:1920020])

HSP 1 Score: 60.8474 bits (146), Expect = 2.055e-11
Identity = 44/131 (33.59%), Postives = 73/131 (55.73%), Query Frame = 2
Query:  161 SLVPYQVVLHFQQYYSAXXXXXXXXXXXXKGQILPYVTVNFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSRAN 553
            S  P +V+     +Y A +F+ ELLI   KG +LPY T N   ++V+LL    +E  R+ +G  GNL ++   + +S  LT P+ +   + L+ QTY   +E +  + +L FC  EL+ ++L + TFS  +
Sbjct:    9 SSTPLEVLFFLNGWYYATYFLLELLIFLYKGLLLPYPTANLVLDVVMLLLYLGIEVIRLFFGTKGNLCQRKMPLGISVALTFPSAMMASYYLLLQTYVLRLEAIMNSILLFFCGSELLLEMLTLATFSSMD 139          
BLAST of Transmembrane protein 80 vs. Ensembl Mouse
Match: Tmem216 (transmembrane protein 216 [Source:MGI Symbol;Acc:MGI:1920020])

HSP 1 Score: 48.9062 bits (115), Expect = 1.321e-7
Identity = 28/86 (32.56%), Postives = 49/86 (56.98%), Query Frame = 2
Query:  296 VLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSRAN 553
            +LLL + I E  R+ +G  GNL ++   + +S  LT P+ +   + L+ QTY   +E +  + +L FC  EL+ ++L + TFS  +
Sbjct:    1 MLLLYLGI-EVIRLFFGTKGNLCQRKMPLGISVALTFPSAMMASYYLLLQTYVLRLEAIMNSILLFFCGSELLLEMLTLATFSSMD 85          
BLAST of Transmembrane protein 80 vs. Ensembl Mouse
Match: Tmem216 (transmembrane protein 216 [Source:MGI Symbol;Acc:MGI:1920020])

HSP 1 Score: 48.9062 bits (115), Expect = 1.321e-7
Identity = 28/86 (32.56%), Postives = 49/86 (56.98%), Query Frame = 2
Query:  296 VLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSRAN 553
            +LLL + I E  R+ +G  GNL ++   + +S  LT P+ +   + L+ QTY   +E +  + +L FC  EL+ ++L + TFS  +
Sbjct:    1 MLLLYLGI-EVIRLFFGTKGNLCQRKMPLGISVALTFPSAMMASYYLLLQTYVLRLEAIMNSILLFFCGSELLLEMLTLATFSSMD 85          
BLAST of Transmembrane protein 80 vs. Ensembl Mouse
Match: Tmem216 (transmembrane protein 216 [Source:MGI Symbol;Acc:MGI:1920020])

HSP 1 Score: 48.9062 bits (115), Expect = 1.321e-7
Identity = 28/86 (32.56%), Postives = 49/86 (56.98%), Query Frame = 2
Query:  296 VLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSRAN 553
            +LLL + I E  R+ +G  GNL ++   + +S  LT P+ +   + L+ QTY   +E +  + +L FC  EL+ ++L + TFS  +
Sbjct:    1 MLLLYLGI-EVIRLFFGTKGNLCQRKMPLGISVALTFPSAMMASYYLLLQTYVLRLEAIMNSILLFFCGSELLLEMLTLATFSSMD 85          
BLAST of Transmembrane protein 80 vs. UniProt/SwissProt
Match: sp|E7EYQ9|TM216_DANRE (Transmembrane protein 216 OS=Danio rerio OX=7955 GN=tmem216 PE=3 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 4.068e-12
Identity = 53/145 (36.55%), Postives = 80/145 (55.17%), Query Frame = 2
Query:  119 NLEMHTTKLYNNIRSLVPYQVVLHFQQYYSAXXXXXXXXXXXXKGQILPYVTVNFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSRAN 553
            N+  H  +    + S  P Q++ H   +Y A FF++E+L+   KG ILPY   N   ++VLLL  + LE  R+ YG  GNL ++S  + VS  + +P  V  V+ L+ QT+   +E V  A +L F   EL+  ++ I  FSRAN
Sbjct:   17 NMAAHGRQ---PVLSSTPLQILFHLNGWYFAAFFVAEILMFIYKGVILPYPQDNLILDVVLLLLFSGLETLRLFYGWKGNLCQRSLALFVSVAILVPCAVLSVYYLLLQTFVLRLEFVLNAVLLCFYGFELVLGVMTISIFSRAN 158          
BLAST of Transmembrane protein 80 vs. UniProt/SwissProt
Match: sp|Q9P0N5|TM216_HUMAN (Transmembrane protein 216 OS=Homo sapiens OX=9606 GN=TMEM216 PE=1 SV=3)

HSP 1 Score: 60.8474 bits (146), Expect = 1.394e-10
Identity = 42/129 (32.56%), Postives = 72/129 (55.81%), Query Frame = 2
Query:  161 SLVPYQVVLHFQQYYSAXXXXXXXXXXXXKGQILPYVTVNFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSR 547
            S  P +++     +Y+A +F+ EL I   KG +LPY T N   ++V+LL    +E  R+ +G  GNL ++   +++S  LT P+ +   + L+ QTY   +E +    +L FC  EL+ ++L +  FSR
Sbjct:   16 SSTPLEILFFLNGWYNATYFLLELFIFLYKGVLLPYPTANLVLDVVMLLLYLGIEVIRLFFGTKGNLCQRKMPLSISVALTFPSAMMASYYLLLQTYVLRLEAIMNGILLFFCGSELLLEVLTLAAFSR 144          
BLAST of Transmembrane protein 80 vs. UniProt/SwissProt
Match: sp|Q9CQC4|TM216_MOUSE (Transmembrane protein 216 OS=Mus musculus OX=10090 GN=Tmem216 PE=1 SV=2)

HSP 1 Score: 60.8474 bits (146), Expect = 1.438e-10
Identity = 44/131 (33.59%), Postives = 73/131 (55.73%), Query Frame = 2
Query:  161 SLVPYQVVLHFQQYYSAXXXXXXXXXXXXKGQILPYVTVNFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSRAN 553
            S  P +V+     +Y A +F+ ELLI   KG +LPY T N   ++V+LL    +E  R+ +G  GNL ++   + +S  LT P+ +   + L+ QTY   +E +  + +L FC  EL+ ++L + TFS  +
Sbjct:    9 SSTPLEVLFFLNGWYYATYFLLELLIFLYKGLLLPYPTANLVLDVVMLLLYLGIEVIRLFFGTKGNLCQRKMPLGISVALTFPSAMMASYYLLLQTYVLRLEAIMNSILLFFCGSELLLEMLTLATFSSMD 139          
BLAST of Transmembrane protein 80 vs. UniProt/SwissProt
Match: sp|B6ID01|TM216_RAT (Transmembrane protein 216 OS=Rattus norvegicus OX=10116 GN=Tmem216 PE=2 SV=2)

HSP 1 Score: 60.077 bits (144), Expect = 2.323e-10
Identity = 43/131 (32.82%), Postives = 73/131 (55.73%), Query Frame = 2
Query:  161 SLVPYQVVLHFQQYYSAXXXXXXXXXXXXKGQILPYVTVNFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSRAN 553
            S  P +++     +Y A +F+ ELLI   KG +LPY T N   ++V+LL    +E  R+ +G  GNL ++   + +S  LT P+ +   + L+ QTY   +E +  + +L FC  EL+ ++L + TFS  +
Sbjct:    9 SSTPLEILFFLNGWYYATYFLLELLIFLYKGLLLPYPTANLVLDVVMLLLYLGIEVIRLFFGTKGNLCQRKMPLGISVALTFPSAMMASYYLLLQTYVLRLEAIMNSILLFFCGSELLLEMLTLATFSSMD 139          
BLAST of Transmembrane protein 80 vs. UniProt/SwissProt
Match: sp|Q2TA01|TM216_BOVIN (Transmembrane protein 216 OS=Bos taurus OX=9913 GN=TMEM216 PE=2 SV=2)

HSP 1 Score: 53.5286 bits (127), Expect = 7.063e-8
Identity = 35/113 (30.97%), Postives = 60/113 (53.10%), Query Frame = 2
Query:  161 SLVPYQVVLHFQQYYSAXXXXXXXXXXXXKGQILPYVTVNFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFC 499
            S  P +++     +Y A +F+ EL I   KG +LPY T N   ++V+L     +E  R+ +G  GNL ++   + +S  LT P+ +   + L+ QTY   +E +  + +L FC
Sbjct:    9 SSTPLEILFFLNGWYYATYFLLELFIFLYKGLLLPYPTANLVLDVVMLFLYLGVEVIRLFFGTKGNLCQRKMPLGISVALTFPSTMMASYYLLLQTYVLRLEAIMNSILLFFC 121          
BLAST of Transmembrane protein 80 vs. TrEMBL
Match: V3Z4X5 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_204590 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.841e-21
Identity = 51/133 (38.35%), Postives = 88/133 (66.17%), Query Frame = 2
Query:  155 IRSLVPYQVVLHFQQYYSAXXXXXXXXXXXXKGQILPYVTVNFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSRAN 553
            +RS +PYQ++L+   +Y   F ++E+LI   K + LP+ +   + E++L+  +A LE  R+ +G  GNLTEQ+  V +S LL+IP I+  +++L+WQTY   ++V+  A  L F  +EL+F ++ II+F+RA+
Sbjct:   12 VRSSLPYQILLYLNGWYFGFFLLAEVLIFIFKAETLPFASNTLAAEVILVFLLAALEGLRLFFGRKGNLTEQTVGVIISVLLSIPAILGAIFILLWQTYVLRLDVILAAIQLAFIALELVFGVISIISFARAS 144          
BLAST of Transmembrane protein 80 vs. TrEMBL
Match: A0A1S3IQM8 (transmembrane protein 216 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106166380 PE=4 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 2.427e-19
Identity = 53/133 (39.85%), Postives = 86/133 (64.66%), Query Frame = 2
Query:  155 IRSLVPYQVVLHFQQYYSAXXXXXXXXXXXXKGQILPYVTVNFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSRAN 553
            IRS +PYQ++L+   +Y   F+I+E+LI   KG+ LPY     + E+VLL  +  LE  RI +G  GNLTE+   V +  +L++PT+   +++L+WQTY   +EV+  A  L+F  +EL+F ++ ++TF+RA 
Sbjct:   14 IRSSLPYQILLYCNAWYFGFFWIAEILIYIFKGETLPYPNGVLAAEVVLLFFLGGLESLRIFFGQKGNLTERMLTVVLCIVLSLPTLAGILYILLWQTYVLRVEVILSAIELVFIALELLFGIISVVTFARAT 146          
BLAST of Transmembrane protein 80 vs. TrEMBL
Match: A0A1S3IS64 (transmembrane protein 216 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106166380 PE=4 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.403e-18
Identity = 52/131 (39.69%), Postives = 85/131 (64.89%), Query Frame = 2
Query:  155 IRSLVPYQVVLHFQQYYSAXXXXXXXXXXXXKGQILPYVTVNFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSR 547
            IRS +PYQ++L+   +Y   F+I+E+LI   KG+ LPY     + E+VLL  +  LE  RI +G  GNLTE+   V +  +L++PT+   +++L+WQTY   +EV+  A  L+F  +EL+F ++ ++TF+R
Sbjct:   14 IRSSLPYQILLYCNAWYFGFFWIAEILIYIFKGETLPYPNGVLAAEVVLLFFLGGLESLRIFFGQKGNLTERMLTVVLCIVLSLPTLAGILYILLWQTYVLRVEVILSAIELVFIALELLFGIISVVTFAR 144          
BLAST of Transmembrane protein 80 vs. TrEMBL
Match: A0A210Q8E8 (Transmembrane protein 216 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07816 PE=4 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.581e-18
Identity = 54/131 (41.22%), Postives = 81/131 (61.83%), Query Frame = 2
Query:  155 IRSLVPYQVVLHFQQYYSAXXXXXXXXXXXXKGQILPYVTVNFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSR 547
            IRS +PYQV+L+   +Y   FF+ E+LI   KG+ LPY       E++LL  +A +E  RI +   GNLTE+   V VS +L++P I+  ++LL+WQTY   ++V+  A  L F  +ELI  ++ II F+R
Sbjct:   17 IRSSLPYQVLLYLNGWYFGFFFVCEILIFIFKGETLPYADNVLLAEVILLFVLAAIEAMRIFFAQKGNLTERIVGVVVSIMLSVPAILGALFLLLWQTYVLKVDVILAAIQLAFTGLELIMAIVSIINFAR 147          
BLAST of Transmembrane protein 80 vs. TrEMBL
Match: A0A5J4N8N3 (Transmembrane protein 216 OS=Paragonimus westermani OX=34504 GN=DEA37_0011100 PE=4 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.906e-18
Identity = 52/129 (40.31%), Postives = 79/129 (61.24%), Query Frame = 2
Query:  161 SLVPYQVVLHFQQYYSAXXXXXXXXXXXXKGQILPYVTVNFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSR 547
            S VP Q++L +   Y+ ++FI    +   KG  L +   ++  EI+LLL    +E  R+      NL E  F +A+S LL  P +VFCVW+++WQTYTFYIE++   G+L+F L E+I  +L+ ITF+R
Sbjct:   14 SSVPLQILLRYNTVYTTVYFICHATMHAYKGIELRFPRNHYISEIILLLFFMSIESARLLLMHRSNLLESEFEMAMSILLFFPNVVFCVWVVLWQTYTFYIELILTVGLLMFYLSEMIIGILLFITFAR 142          
BLAST of Transmembrane protein 80 vs. Ensembl Cavefish
Match: si:rp71-1d10.5 (transmembrane protein 216 [Source:HGNC Symbol;Acc:HGNC:25018])

HSP 1 Score: 56.9954 bits (136), Expect = 4.180e-10
Identity = 50/131 (38.17%), Postives = 76/131 (58.02%), Query Frame = 2
Query:  161 SLVPYQVVLHFQQYYSAXXXXXXXXXXXXKGQILPYVTVNFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSRAN 553
            S  P QV+ +   +Y A+FFI+E+L+   KG +LPY   N   +IVLLL    LE  R+ YG  GNL E++  +++S  + +P  V  V+ L+ QT+   +E +  A +L F  +ELI  L+ I  F+R N
Sbjct:    7 SSTPLQVLFYLNSWYFAVFFIAEILMFIYKGVLLPYPQSNLILDIVLLLLYLGLETLRLFYGWKGNLCERTLTLSISIGVLVPCTVLSVYYLLLQTFVLRLEFILNAVLLCFYGLELILGLITISAFARYN 137          
BLAST of Transmembrane protein 80 vs. Ensembl Cavefish
Match: ENSAMXT00000052229.1 (transmembrane protein 80 [Source:NCBI gene;Acc:103025724])

HSP 1 Score: 47.3654 bits (111), Expect = 1.096e-6
Identity = 40/137 (29.20%), Postives = 75/137 (54.74%), Query Frame = 2
Query:  146 YNNIRSLVPYQVVLHFQQYYSAXXXXXXXXXXXXKGQILPYVTVNFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMEL--IFKLLVIITFSRA 550
            ++++ S V  Q++L+    Y   +FIS L ++  K Q+L Y   + + ++ LLL MA L+  R+ +G+ GNL E   Y++ +   T  T++  V+ L+WQ+Y    +V+  +  ++ CL  L  +     +  F+RA
Sbjct:    9 HSSVLSSVLLQILLYLSSIYGLFYFISSLCLIIYKSQVLSYPDSDLALDVCLLLLMAGLDVIRLYWGVRGNLLESEKYISANLFSTGATVLLAVYFLVWQSYVLRADVIINS--ILLCLYGLAGVVGFGALARFNRA 143          
BLAST of Transmembrane protein 80 vs. Ensembl Nematostella
Match: EDO31652 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXC1])

HSP 1 Score: 68.5514 bits (166), Expect = 8.837e-15
Identity = 46/133 (34.59%), Postives = 80/133 (60.15%), Query Frame = 2
Query:  161 SLVPYQVVLHFQQYYSAXXXXXXXXXXXXKG----QILPYVTVNFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSR 547
            S +P Q+ L+   +YS +F ++E+L+   KG     +LPY +   + EI+L++  A +E  R+ +G  GNL E+S  + +S +L IP +   +++L+WQTY   IEV+ VA  L F  +E+I  +  ++TF +
Sbjct:   12 SSLPLQIFLYLNVWYSMVFCVAEILLYIYKGIVLSSLLPYTSAALTVEILLVIFWAFMEGVRLFFGYKGNLAERSMALIISIVLGIPVLFIELFVLLWQTYVLRIEVILVAISLAFLGIEIILSIAAMLTFKK 144          
BLAST of Transmembrane protein 80 vs. Ensembl Medaka
Match: si:rp71-1d10.5 (transmembrane protein 216 [Source:HGNC Symbol;Acc:HGNC:25018])

HSP 1 Score: 53.5286 bits (127), Expect = 8.339e-9
Identity = 44/131 (33.59%), Postives = 72/131 (54.96%), Query Frame = 2
Query:  161 SLVPYQVVLHFQQYYSAXXXXXXXXXXXXKGQILPYVTVNFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSRAN 553
            S  P QV+L+   +Y A F+++E+L+   KG +LPY + N   ++VLLL    LE  RI YG  GNL E+S    +S  + +      V+ L+ QT+   +E +  A +L F  +E +   + + +FSR+ 
Sbjct:   11 SSTPLQVLLYLNSWYFAAFYLAEILMFIYKGILLPYPSDNLVLDVVLLLLFLALEALRIFYGWKGNLCERSLTSCLSLFILVSCAALAVYYLLLQTFVLRLEFLLCAVLLCFYGLEFLLGFIALSSFSRSK 141          
BLAST of Transmembrane protein 80 vs. Ensembl Medaka
Match: ENSORLT00000038473.1 (transmembrane protein 80 [Source:NCBI gene;Acc:101157050])

HSP 1 Score: 46.595 bits (109), Expect = 3.656e-6
Identity = 38/130 (29.23%), Postives = 70/130 (53.85%), Query Frame = 2
Query:  104 SNFYHNLEMHTTKLYNNIRSLVPYQVVLHFQQYYSAXXXXXXXXXXXXKGQILPYVTVNFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCVWLLIWQTYTFYIEVVFVAGMLI 493
            S F +++ +    ++  + S VP Q++L     Y  ++F+  L +L  K  +L Y       ++ LL  +A LE   +  G+ GNLTE   Y+  + ++T  TI+  V+ L+WQTY    +V+ ++G+L+
Sbjct:   24 SCFVNDVCLVGRSVHAGVLSSVPLQLLLRLTSIYFIVYFLFTLGLLVKKSVVLSYPPDALVYDVALLFLLAALEVLHLLCGVKGNLTESGGYILANIIVTAATILLTVYFLVWQTYVMRADVI-ISGILL 152          
The following BLAST results are available for this feature:
BLAST of Transmembrane protein 80 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TMEM2162.904e-1132.56transmembrane protein 216 [Source:HGNC Symbol;Acc:... [more]
TMEM2161.904e-1031.30transmembrane protein 216 [Source:HGNC Symbol;Acc:... [more]
TMEM2163.256e-731.58transmembrane protein 216 [Source:HGNC Symbol;Acc:... [more]
TMEM808.322e-730.08transmembrane protein 80 [Source:HGNC Symbol;Acc:H... [more]
TMEM803.090e-631.65transmembrane protein 80 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Transmembrane protein 80 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mks-23.769e-1634.81MecKel-Gruber Syndrome (MKS) homolog [Source:UniP... [more]
back to top
BLAST of Transmembrane protein 80 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
TMEM2165.102e-824.80gene:FBgn0037614 transcript:FBtr0081905[more]
TMEM2165.102e-824.80gene:FBgn0037614 transcript:FBtr0300544[more]
TMEM2165.102e-824.80gene:FBgn0037614 transcript:FBtr0300543[more]
back to top
BLAST of Transmembrane protein 80 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TMEM2165.389e-1336.55si:rp71-1d10.5 [Source:NCBI gene;Acc:555988][more]
TMEM2163.851e-1137.98si:rp71-1d10.5 [Source:NCBI gene;Acc:555988][more]
back to top
BLAST of Transmembrane protein 80 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pkd11.154e-1036.43polycystin 1, transient receptor potential channel... [more]
TMEM802.596e-731.01transmembrane protein 80 [Source:NCBI gene;Acc:100... [more]
back to top
BLAST of Transmembrane protein 80 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tmem2162.055e-1133.59transmembrane protein 216 [Source:MGI Symbol;Acc:M... [more]
Tmem2162.055e-1133.59transmembrane protein 216 [Source:MGI Symbol;Acc:M... [more]
Tmem2161.321e-732.56transmembrane protein 216 [Source:MGI Symbol;Acc:M... [more]
Tmem2161.321e-732.56transmembrane protein 216 [Source:MGI Symbol;Acc:M... [more]
Tmem2161.321e-732.56transmembrane protein 216 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Transmembrane protein 80 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|E7EYQ9|TM216_DANRE4.068e-1236.55Transmembrane protein 216 OS=Danio rerio OX=7955 G... [more]
sp|Q9P0N5|TM216_HUMAN1.394e-1032.56Transmembrane protein 216 OS=Homo sapiens OX=9606 ... [more]
sp|Q9CQC4|TM216_MOUSE1.438e-1033.59Transmembrane protein 216 OS=Mus musculus OX=10090... [more]
sp|B6ID01|TM216_RAT2.323e-1032.82Transmembrane protein 216 OS=Rattus norvegicus OX=... [more]
sp|Q2TA01|TM216_BOVIN7.063e-830.97Transmembrane protein 216 OS=Bos taurus OX=9913 GN... [more]
back to top
BLAST of Transmembrane protein 80 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V3Z4X52.841e-2138.35Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A1S3IQM82.427e-1939.85transmembrane protein 216 isoform X1 OS=Lingula un... [more]
A0A1S3IS641.403e-1839.69transmembrane protein 216 isoform X2 OS=Lingula un... [more]
A0A210Q8E81.581e-1841.22Transmembrane protein 216 OS=Mizuhopecten yessoens... [more]
A0A5J4N8N31.906e-1840.31Transmembrane protein 216 OS=Paragonimus westerman... [more]
back to top
BLAST of Transmembrane protein 80 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:rp71-1d10.54.180e-1038.17transmembrane protein 216 [Source:HGNC Symbol;Acc:... [more]
ENSAMXT00000052229.11.096e-629.20transmembrane protein 80 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Transmembrane protein 80 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 80 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 80 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO316528.837e-1534.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transmembrane protein 80 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:rp71-1d10.58.339e-933.59transmembrane protein 216 [Source:HGNC Symbol;Acc:... [more]
ENSORLT00000038473.13.656e-629.23transmembrane protein 80 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Transmembrane protein 80 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020686 ID=SMED30020686|Name=Transmembrane protein 80|organism=Schmidtea mediterranea sexual|type=transcript|length=685bp
ATAATAATATAATTAATATTTAAAACTAATCATTCAAATTAATTTTATAA
TTTTTATTTATATTTTTAAAAGATTTTCGTGATTTAATGCGACAATAAAT
ATTAGTAATTTTTACCATAATTTAGAAATGCATACTACAAAGTTATACAA
CAATATTCGATCATTAGTTCCATATCAAGTGGTGTTACATTTTCAGCAAT
ATTATTCCGCATTATTTTTTATTTCTGAGCTATTAATACTTTTCATCAAA
GGCCAAATTCTGCCTTATGTAACGGTGAATTTTAGCGGTGAAATTGTGCT
GTTATTGGCGATGGCCATATTAGAGTACTTTCGTATTCGATATGGGATGA
TTGGGAATTTGACGGAACAGTCATTTTATGTTGCAGTATCATTTTTATTA
ACGATTCCAACTATAGTTTTCTGTGTTTGGTTGCTCATCTGGCAAACGTA
TACATTTTATATTGAAGTTGTATTTGTTGCGGGAATGCTGATATTTTGTT
TGATGGAGTTGATATTCAAATTGTTAGTAATTATAACATTTTCCAGGGCT
AATTGATGTCAATAATATATCGCATTTATCATGATTTTGTTTATCATTTT
GATTTTTTATTCTCAAATATTTATACAAACAAATGTTACAAATATTGTTA
TTCTAATAATAATTCGTAAACAAATAGATTCGATT
back to top

protein sequence of SMED30020686-orf-1

>SMED30020686-orf-1 ID=SMED30020686-orf-1|Name=SMED30020686-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=143bp
MHTTKLYNNIRSLVPYQVVLHFQQYYSALFFISELLILFIKGQILPYVTV
NFSGEIVLLLAMAILEYFRIRYGMIGNLTEQSFYVAVSFLLTIPTIVFCV
WLLIWQTYTFYIEVVFVAGMLIFCLMELIFKLLVIITFSRAN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR019184Uncharacterised_TM-17
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019184Uncharacterised protein family, transmembrane-17PFAMPF09799Transmemb_17coord: 1..63
e-value: 6.6E-14
score: 52.4
IPR019184Uncharacterised protein family, transmembrane-17PANTHERPTHR13531FAMILY NOT NAMEDcoord: 1..80
NoneNo IPR availableTMHMMTMhelixcoord: 53..75
NoneNo IPR availableTMHMMTMhelixcoord: 21..43