Neural cell adhesion molecule 1

Overview
NameNeural cell adhesion molecule 1
Smed IDSMED30020684
Length (bp)3004
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neural cell adhesion molecule 1 (SMED30020684) t-SNE clustered cells

Violin plots show distribution of expression levels for Neural cell adhesion molecule 1 (SMED30020684) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neural cell adhesion molecule 1 (SMED30020684) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neural cell adhesion molecule 1 (SMED30020684) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Human
Match: NCAM2 (neural cell adhesion molecule 2 [Source:HGNC Symbol;Acc:HGNC:7657])

HSP 1 Score: 122.865 bits (307), Expect = 8.055e-28
Identity = 156/718 (21.73%), Postives = 290/718 (40.39%), Query Frame = 1
Query:  367 WYDPNMEPVVNYFTDPQKAQTNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGNPKVV----IDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSP-DNHKFSFIENHQTL-----RISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPS--VTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSM-GKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAP-NVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDF--EVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEV-MTKHLGRPVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQS 2466
            WY+P               Q  KI     ++ + +G++   L I +    + GIY+C    +  +T     ++   + +    + SP  Q  ++G+   + C     P   V W +  E ++   +++F+ + N+        +  E   R  G+   + E+ F D               I VIV   P IS    S   T ++ E            +   C + G P P I+WF++ K+I          +E Y  +   + L +  +   D G Y C ++       +     +      QP  +++    N T+  +  V L C   G     +T     + F    F   +KS+ G+  V+             +L I D+K  D+G Y C+A+ R   +     +  + + YAP+ + +  T+Y  W    + + C  K+ P  +  W      LP + N   +KT +       E  I P   ND  FG Y C+A N +G   +    + A  P +P  V + +++ +T ++        GG+P+ HY++  K+   E+ ++   +      + + L++L+PNT Y++ ++A +  G+G  + IE+  T  +  P    ++   +  KSF L      DGGAPI+ Y V  +  D    ++  +  ++   K++++           +  L+    YE+  TA N  G S
Sbjct:   53 WYNP---------------QGEKIISTQRVVVQKEGVRS-RLTIYNANIEDAGIYRCQATDAKGQTQEATVVLEIYQKLTFREVVSP--QEFKQGEDAEVVCRVSSSPAPAVSWLYHNEEVTTISDNRFAMLANNNLQILNINKSDEGIYRCEGRVEARGEIDFRD---------------IIVIVNVPPAISMPQKSFNATAERGE-----------EMTFSCRASGSPEPAISWFRNGKLIEE--------NEKYILKGSNTELTVRNIINSDGGPYVCRATNKAGEDEKQAFLQV----FVQPHIIQLK---NETTYENGQVTLVCDAEGEPIPEITWKRAVDGFT---FTEGDKSLDGRIEVKGQH-------GSSSLHIKDVKLSDSGRYDCEAASRIGGH---QKSMYLDIEYAPKFI-SNQTIYYSWEGNPINISCDVKSNPPASIHWRRDKLVLPAK-NTTNLKTYSTGRKMILE--IAPTSDND--FGRYNCTATNHIGTRFQEYILALADVPSSPYGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASEIWKIVRSHGVQ---TMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPILEYIVKYRSKD---KEDQWLEKKVQGNKDHII-----------LEHLQWTMGYEVQITAANRLGYS 675          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Human
Match: NCAM2 (neural cell adhesion molecule 2 [Source:HGNC Symbol;Acc:HGNC:7657])

HSP 1 Score: 122.479 bits (306), Expect = 8.982e-28
Identity = 156/718 (21.73%), Postives = 290/718 (40.39%), Query Frame = 1
Query:  367 WYDPNMEPVVNYFTDPQKAQTNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGNPKVV----IDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSP-DNHKFSFIENHQTL-----RISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPS--VTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSM-GKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAP-NVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDF--EVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEV-MTKHLGRPVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQS 2466
            WY+P               Q  KI     ++ + +G++   L I +    + GIY+C    +  +T     ++   + +    + SP  Q  ++G+   + C     P   V W +  E ++   +++F+ + N+        +  E   R  G+   + E+ F D               I VIV   P IS    S   T ++ E            +   C + G P P I+WF++ K+I          +E Y  +   + L +  +   D G Y C ++       +     +      QP  +++    N T+  +  V L C   G     +T     + F    F   +KS+ G+  V+             +L I D+K  D+G Y C+A+ R   +     +  + + YAP+ + +  T+Y  W    + + C  K+ P  +  W      LP + N   +KT +       E  I P   ND  FG Y C+A N +G   +    + A  P +P  V + +++ +T ++        GG+P+ HY++  K+   E+ ++   +      + + L++L+PNT Y++ ++A +  G+G  + IE+  T  +  P    ++   +  KSF L      DGGAPI+ Y V  +  D    ++  +  ++   K++++           +  L+    YE+  TA N  G S
Sbjct:   35 WYNP---------------QGEKIISTQRVVVQKEGVRS-RLTIYNANIEDAGIYRCQATDAKGQTQEATVVLEIYQKLTFREVVSP--QEFKQGEDAEVVCRVSSSPAPAVSWLYHNEEVTTISDNRFAMLANNNLQILNINKSDEGIYRCEGRVEARGEIDFRD---------------IIVIVNVPPAISMPQKSFNATAERGE-----------EMTFSCRASGSPEPAISWFRNGKLIEE--------NEKYILKGSNTELTVRNIINSDGGPYVCRATNKAGEDEKQAFLQV----FVQPHIIQLK---NETTYENGQVTLVCDAEGEPIPEITWKRAVDGFT---FTEGDKSLDGRIEVKGQH-------GSSSLHIKDVKLSDSGRYDCEAASRIGGH---QKSMYLDIEYAPKFI-SNQTIYYSWEGNPINISCDVKSNPPASIHWRRDKLVLPAK-NTTNLKTYSTGRKMILE--IAPTSDND--FGRYNCTATNHIGTRFQEYILALADVPSSPYGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASEIWKIVRSHGVQ---TMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPILEYIVKYRSKD---KEDQWLEKKVQGNKDHII-----------LEHLQWTMGYEVQITAANRLGYS 657          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Human
Match: NCAM1 (neural cell adhesion molecule 1 [Source:HGNC Symbol;Acc:HGNC:7656])

HSP 1 Score: 111.694 bits (278), Expect = 2.061e-24
Identity = 163/682 (23.90%), Postives = 274/682 (40.18%), Query Frame = 1
Query:  517 NNGIYKCD-TVQSNNKTPSKINIIGNPKVVI-DSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEH--LSPDNHKFSFIENHQTLR----ISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEF-IFQPRFLKIGTNLNATSLTDKSVNLSCSVFG----AFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPST----ITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIE-----LVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRT 2493
            + GIYKC  T +  +++ + +N+    K++  ++P  Q   EG+   I C         ++W  +G    L  D        N+  +R      E T R  G+ L + E++F D               I VIV   P         T+Q  +  +  T     ++ + CD+ G P P ++W KD + I        +  E Y   +  S L I  V   D   Y C +       +++  ++ T    +F    +    N  A  L ++ V L+C   G    + + R +   I  +          +S  + S               +LT+  I+  DAG Y C A   S+     S +  + V YAP+ L     +Y  W    V + C+  AYP+ T  W F+D  L    N   +K  N    S S L + P+ +ND  FG Y C+A N +G         QA  P +P+++  +  +ST Q+       +GG+P+  Y+  ++      V+   +Y    ++    +T+  LKP T Y + L+A +  G G   +I   ++   +PV E     L      D  S  ++ +   DGG+PI  Y V  + +    S   K   R+ +  ++++           + SL  N  YE+   A N  G+S     +FRT
Sbjct:   90 DAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKD---------------IQVIVNVPP---------TIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQE-----EDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAE------NKAGEQDATIHLKVFAKPKITYVENQTAMEL-EEQVTLTCEASGDPIPSITWRTSTRNISSEEKTLDGHMVVRSHARVS---------------SLTLKSIQYTDAGEYICTA---SNTIGQDSQSMYLEVQYAPK-LQGPVAVY-TWEGNQVNITCEVFAYPSATISW-FRDGQLLPSSNYSNIKIYNT--PSASYLEVTPDSEND--FGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVG-EEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLG---EISAASEFKTQPVREPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRAL----SSEWKPEIRLPSGSDHVM-----------LKSLDWNAEYEVYVVAENQQGKSKAAHFVFRT 691          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Human
Match: NCAM1 (neural cell adhesion molecule 1 [Source:HGNC Symbol;Acc:HGNC:7656])

HSP 1 Score: 109.768 bits (273), Expect = 8.707e-24
Identity = 164/695 (23.60%), Postives = 281/695 (40.43%), Query Frame = 1
Query:  517 NNGIYKCD-TVQSNNKTPSKINIIGNPKVVI-DSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEH--LSPDNHKFSFIENHQTLR----ISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYI---SHY---TLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPST----ITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVI------ELVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRTLDEHALAKAEG 2526
            + GIYKC  T +  +++ + +N+    K++  ++P  Q   EG+   I C         ++W  +G    L  D        N+  +R      E T R  G+ L + E++F D               I VIV   P         T+Q  +  +  T     ++ + CD+ G P P ++W KD + I        +  E Y   +  S L I  V   D   Y C +         ++   +      +P+   +  N  A  L ++ V L+C   G     +T       +  S    +++    ++    Q+  + ++   SH    +LT+  I+  DAG Y C AS   +     S +  + V YAP+ L     +Y  W    V + C+  AYP+ T  W F+D  L    N   +K  N    S S L + P+ +ND  FG Y C+A N +G         QA  P +P+++  +  +ST Q+       +GG+P+  Y+  ++      V+   +Y    ++    +T+  LKP T Y + L+A +  G G   +I   ++   +PV       +L      D  S  ++ +   DGG+PI  Y V  + +    S   K   R+ +  ++++           + SL  N  YE+   A N  G+S     +FRT  +     A G
Sbjct:   90 DAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKD---------------IQVIVNVPP---------TIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQE-----EDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATIHLKV----FAKPKITYV-ENQTAMEL-EEQVTLTCEASGDPIPSIT-------WRTSTRNISSEEKASWTRPEKQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTAS---NTIGQDSQSMYLEVQYAPK-LQGPVAVY-TWEGNQVNITCEVFAYPSATISW-FRDGQLLPSSNYSNIKIYNT--PSASYLEVTPDSEND--FGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVG-EEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLG---EISAASEFKTQPVQGEPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRAL----SSEWKPEIRLPSGSDHVM-----------LKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANG 713          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Human
Match: NCAM1 (neural cell adhesion molecule 1 [Source:HGNC Symbol;Acc:HGNC:7656])

HSP 1 Score: 109.768 bits (273), Expect = 1.070e-23
Identity = 164/695 (23.60%), Postives = 281/695 (40.43%), Query Frame = 1
Query:  517 NNGIYKCD-TVQSNNKTPSKINIIGNPKVVI-DSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEH--LSPDNHKFSFIENHQTLR----ISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYI---SHY---TLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPST----ITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPV------IELVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRTLDEHALAKAEG 2526
            + GIYKC  T +  +++ + +N+    K++  ++P  Q   EG+   I C         ++W  +G    L  D        N+  +R      E T R  G+ L + E++F D               I VIV   P         T+Q  +  +  T     ++ + CD+ G P P ++W KD + I        +  E Y   +  S L I  V   D   Y C +         ++   +      +P+   +  N  A  L ++ V L+C   G     +T       +  S    +++    ++    Q+  + ++   SH    +LT+  I+  DAG Y C AS   +     S +  + V YAP+ L     +Y  W    V + C+  AYP+ T  W F+D  L    N   +K  N    S S L + P+ +ND  FG Y C+A N +G         QA  P +P+++  +  +ST Q+       +GG+P+  Y+  ++      V+   +Y    ++    +T+  LKP T Y + L+A +  G G   +I   ++   +PV       +L      D  S  ++ +   DGG+PI  Y V  + +    S   K   R+ +  ++++           + SL  N  YE+   A N  G+S     +FRT  +     A G
Sbjct:   90 DAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKD---------------IQVIVNVPP---------TIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQE-----EDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATIHLKV----FAKPKITYV-ENQTAMEL-EEQVTLTCEASGDPIPSIT-------WRTSTRNISSEEKASWTRPEKQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTAS---NTIGQDSQSMYLEVQYAPK-LQGPVAVY-TWEGNQVNITCEVFAYPSATISW-FRDGQLLPSSNYSNIKIYNT--PSASYLEVTPDSEND--FGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVG-EEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLG---EISAASEFKTQPVPGEPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRAL----SSEWKPEIRLPSGSDHVM-----------LKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANG 713          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Celegans
Match: ncam-1 (NCAM (Neural cell adhesion molecule) homolog [Source:UniProtKB/TrEMBL;Acc:Q8MQ86])

HSP 1 Score: 73.9442 bits (180), Expect = 4.005e-13
Identity = 144/666 (21.62%), Postives = 244/666 (36.64%), Query Frame = 1
Query:  487 HLIIKDFKPANNGIYKCDT-VQSNNKTPS-KINIIGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHK-FSFIENHQTLRISEVT-ERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMI------NHTVDPRVQISESYYSRN----------------------VYSVLKI-----YPVQAQDIGVYTCNSSYSYHGFSRSVARNIT--PEFIFQPRFLKIGTN--LNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKP---------NPYIS------HYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLK--CKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTA------STIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVN---PSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIELVNSSTADSKS--FNLHWVVDTDGGAPIIRY 2277
             L+I   K ++ G Y C T +Q   +  S +I+ +  PK  ++    Q  EEG    I C   G  +++V W F G  L   + + + F EN+Q L I   T ++  G Y C A            + S  E L ++V  Y         P++TV     G +G   E   +E++C + G P P   WF +   +       H V+  + I ES  S +                      V+   K+     Y V+  D     C    SYHG     A+ ++   EF  +   +  G +  +   S   + V  +       S +  V     +  N   ++T++       E  + K          N  IS         LTI  I  +DA  Y C  S  +     ++  GI+     P  L   +  +   +  N +   C   A P+P W W      +  + N   ++        +S  + L NF     FG Y C A N +G + K I   +   P  P+   CK          + +  +    +S    +     + ++ E +  +  +  PV+      +T+ +L  NT+Y +   A +EAG    +  E ++     P       S A   S    + W    D G+P++++
Sbjct:   83 QLMINRPKISDGGKYTCKTEIQGEQQEVSAEISFVDPPKF-LNVQESQHPEEGTRAEIVCEVEGTDQLEVFWQFNGVTLDETSQRGYEFSENNQILYIPHFTAKKDDGIYNCNA-----------AQYSSFETLSVNVTGYA-------RPTITVFDVPNGNRG--IEGHTIELKCGAVGKPKPTYKWFFEDDEVPIARSDKHNVEEGLLIIESLNSEDAGTYKCVANNTVGSNERTFDLAVFLKPKVDLKHEYVVKEGDDVELVC----SYHGEGHVTAKFVSGHSEFAVRNEAVSAGNSEEIRPESNESEEVTTTSENSEETSTQDEVELKSAENVNDEEDHTSQQDDGEQDEQEESKKWKRFADDVNNQRISVRAEENKLILTIKSISLEDAADYTCAVSNDAGTVNKVTQVGIIH----PPTLRHYTGPHIRSFDGNTVSVYCDVSAVPSPKWHWFKNGKEV--EANGVSIQIFTQ---GSSTKLTLENFDGSDNFGVYTCRADNGVGQLEKQIDVIKVVSPATPSGMNCKKMVYPNYGKCSFESDIYEKEESKPQTMELLVAKLEEMESDYNWS-HAQPVSVPFEDDLTIPNLTSNTQYVIKARAVNEAGSSEYS--EEISLETTDPWAPQAPGSVAMKCSDYCTVSWDTPNDHGSPLLKF 711          

HSP 2 Score: 59.6918 bits (143), Expect = 9.390e-9
Identity = 74/290 (25.52%), Postives = 123/290 (42.41%), Query Frame = 1
Query: 1027 KITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSE--LIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQP 1890
            KI W++D K+I     PR   S     R   + L I   +  D G YTC +     G  + V+  I+  F+  P+FL +  + +    T     + C V G  +++L V +    FN    + T++   ++S    ++    YI H+T        +D G Y C A+  S  + +LS N          +    +   G+      LKC A   P PT++W F+D  +P          I  +D    E  L+I+ +  N    GTY+C A N++G+  +T   +   +P
Sbjct:   57 KIEWYRDGKLI-----PRFG-STMTIERTYSNQLMINRPKISDGGKYTCKTEI--QGEQQEVSAEIS--FVDPPKFLNVQESQHPEEGT--RAEIVCEVEG--TDQLEVFW---QFNGVTLDETSQRGYEFS----ENNQILYIPHFTA------KKDDGIYNCNAAQYS-SFETLSVNVTGYARPTITVFDVPNGNRGIEGHTIELKCGAVGKPKPTYKWFFEDDEVP----------IARSDKHNVEEGLLIIESL-NSEDAGTYKCVANNTVGSNERTFDLAVFLKP 307          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Celegans
Match: ncam-1 (NCAM (Neural cell adhesion molecule) homolog [Source:UniProtKB/TrEMBL;Acc:Q8MQ86])

HSP 1 Score: 73.9442 bits (180), Expect = 4.217e-13
Identity = 144/666 (21.62%), Postives = 244/666 (36.64%), Query Frame = 1
Query:  487 HLIIKDFKPANNGIYKCDT-VQSNNKTPS-KINIIGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHK-FSFIENHQTLRISEVT-ERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMI------NHTVDPRVQISESYYSRN----------------------VYSVLKI-----YPVQAQDIGVYTCNSSYSYHGFSRSVARNIT--PEFIFQPRFLKIGTN--LNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKP---------NPYIS------HYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLK--CKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTA------STIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVN---PSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIELVNSSTADSKS--FNLHWVVDTDGGAPIIRY 2277
             L+I   K ++ G Y C T +Q   +  S +I+ +  PK  ++    Q  EEG    I C   G  +++V W F G  L   + + + F EN+Q L I   T ++  G Y C A            + S  E L ++V  Y         P++TV     G +G   E   +E++C + G P P   WF +   +       H V+  + I ES  S +                      V+   K+     Y V+  D     C    SYHG     A+ ++   EF  +   +  G +  +   S   + V  +       S +  V     +  N   ++T++       E  + K          N  IS         LTI  I  +DA  Y C  S  +     ++  GI+     P  L   +  +   +  N +   C   A P+P W W      +  + N   ++        +S  + L NF     FG Y C A N +G + K I   +   P  P+   CK          + +  +    +S    +     + ++ E +  +  +  PV+      +T+ +L  NT+Y +   A +EAG    +  E ++     P       S A   S    + W    D G+P++++
Sbjct:   83 QLMINRPKISDGGKYTCKTEIQGEQQEVSAEISFVDPPKF-LNVQESQHPEEGTRAEIVCEVEGTDQLEVFWQFNGVTLDETSQRGYEFSENNQILYIPHFTAKKDDGIYNCNA-----------AQYSSFETLSVNVTGYA-------RPTITVFDVPNGNRG--IEGHTIELKCGAVGKPKPTYKWFFEDDEVPIARSDKHNVEEGLLIIESLNSEDAGTYKCVANNTVGSNERTFDLAVFLKPKVDLKHEYVVKEGDDVELVC----SYHGEGHVTAKFVSGHSEFAVRNEAVSAGNSEEIRPESNESEEVTTTSENSEETSTQDEVELKSAENVNDEEDHTSQQDDGEQDEQEESKKWKRFADDVNNQRISVRAEENKLILTIKSISLEDAADYTCAVSNDAGTVNKVTQVGIIH----PPTLRHYTGPHIRSFDGNTVSVYCDVSAVPSPKWHWFKNGKEV--EANGVSIQIFTQ---GSSTKLTLENFDGSDNFGVYTCRADNGVGQLEKQIDVIKVVSPATPSGMNCKKMVYPNYGKCSFESDIYEKEESKPQTMELLVAKLEEMESDYNWS-HAQPVSVPFEDDLTIPNLTSNTQYVIKARAVNEAGSSEYS--EEISLETTDPWAPQAPGSVAMKCSDYCTVSWDTPNDHGSPLLKF 711          

HSP 2 Score: 59.6918 bits (143), Expect = 1.070e-8
Identity = 74/290 (25.52%), Postives = 123/290 (42.41%), Query Frame = 1
Query: 1027 KITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSE--LIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQP 1890
            KI W++D K+I     PR   S     R   + L I   +  D G YTC +     G  + V+  I+  F+  P+FL +  + +    T     + C V G  +++L V +    FN    + T++   ++S    ++    YI H+T        +D G Y C A+  S  + +LS N          +    +   G+      LKC A   P PT++W F+D  +P          I  +D    E  L+I+ +  N    GTY+C A N++G+  +T   +   +P
Sbjct:   57 KIEWYRDGKLI-----PRFG-STMTIERTYSNQLMINRPKISDGGKYTCKTEI--QGEQQEVSAEIS--FVDPPKFLNVQESQHPEEGT--RAEIVCEVEG--TDQLEVFW---QFNGVTLDETSQRGYEFS----ENNQILYIPHFTA------KKDDGIYNCNAAQYS-SFETLSVNVTGYARPTITVFDVPNGNRGIEGHTIELKCGAVGKPKPTYKWFFEDDEVP----------IARSDKHNVEEGLLIIESL-NSEDAGTYKCVANNTVGSNERTFDLAVFLKP 307          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Celegans
Match: ncam-1 (NCAM (Neural cell adhesion molecule) homolog [Source:UniProtKB/TrEMBL;Acc:Q8MQ86])

HSP 1 Score: 73.1738 bits (178), Expect = 7.562e-13
Identity = 144/666 (21.62%), Postives = 243/666 (36.49%), Query Frame = 1
Query:  487 HLIIKDFKPANNGIYKCDT-VQSNNKTPS-KINIIGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHK-FSFIENHQTLRISEVT-ERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMI------NHTVDPRVQISESYYSRN----------------------VYSVLKI-----YPVQAQDIGVYTCNSSYSYHGFSRSVARNIT--PEFIFQPRFLKIGTN--LNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKP---------NPYIS------HYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLK--CKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTA------STIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVN---PSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIELVNSSTADSKS--FNLHWVVDTDGGAPIIRY 2277
             L+I   K ++ G Y C T +Q   +  S +I+ +  PK  ++    Q  EEG    I C   G  +++V W F G  L   + + + F EN+Q L I   T ++  G Y C A            + S  E L ++V  Y  P I+       V     GI+G       +E++C + G P P   WF +   +       H V+  + I ES  S +                      V+   K+     Y V+  D     C    SYHG     A+ ++   EF  +   +  G +  +   S   + V  +       S +  V     +  N   ++T++       E  + K          N  IS         LTI  I  +DA  Y C  S  +     ++  GI+     P  L   +  +   +  N +   C   A P+P W W      +  + N   ++        +S  + L NF     FG Y C A N +G + K I   +   P  P+   CK          + +  +    +S    +     + ++ E +  +  +  PV+      +T+ +L  NT+Y +   A +EAG    +  E ++     P       S A   S    + W    D G+P++++
Sbjct:  110 QLMINRPKISDGGKYTCKTEIQGEQQEVSAEISFVDPPKF-LNVQESQHPEEGTRAEIVCEVEGTDQLEVFWQFNGVTLDETSQRGYEFSENNQILYIPHFTAKKDDGIYNCNA-----------AQYSSFETLSVNVTGYARPTIT----VFDVPNGNRGIEGHT-----IELKCGAVGKPKPTYKWFFEDDEVPIARSDKHNVEEGLLIIESLNSEDAGTYKCVANNTVGSNERTFDLAVFLKPKVDLKHEYVVKEGDDVELVC----SYHGEGHVTAKFVSGHSEFAVRNEAVSAGNSEEIRPESNESEEVTTTSENSEETSTQDEVELKSAENVNDEEDHTSQQDDGEQDEQEESKKWKRFADDVNNQRISVRAEENKLILTIKSISLEDAADYTCAVSNDAGTVNKVTQVGIIH----PPTLRHYTGPHIRSFDGNTVSVYCDVSAVPSPKWHWFKNGKEV--EANGVSIQIFTQ---GSSTKLTLENFDGSDNFGVYTCRADNGVGQLEKQIDVIKVVSPATPSGMNCKKMVYPNYGKCSFESDIYEKEESKPQTMELLVAKLEEMESDYNWS-HAQPVSVPFEDDLTIPNLTSNTQYVIKARAVNEAGSSEYS--EEISLETTDPWAPQAPGSVAMKCSDYCTVSWDTPNDHGSPLLKF 738          

HSP 2 Score: 59.3066 bits (142), Expect = 1.355e-8
Identity = 74/290 (25.52%), Postives = 123/290 (42.41%), Query Frame = 1
Query: 1027 KITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSE--LIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQP 1890
            KI W++D K+I     PR   S     R   + L I   +  D G YTC +     G  + V+  I+  F+  P+FL +  + +    T     + C V G  +++L V +    FN    + T++   ++S    ++    YI H+T        +D G Y C A+  S  + +LS N          +    +   G+      LKC A   P PT++W F+D  +P          I  +D    E  L+I+ +  N    GTY+C A N++G+  +T   +   +P
Sbjct:   84 KIEWYRDGKLI-----PRFG-STMTIERTYSNQLMINRPKISDGGKYTCKTEI--QGEQQEVSAEIS--FVDPPKFLNVQESQHPEEGT--RAEIVCEVEG--TDQLEVFW---QFNGVTLDETSQRGYEFS----ENNQILYIPHFTA------KKDDGIYNCNAAQYS-SFETLSVNVTGYARPTITVFDVPNGNRGIEGHTIELKCGAVGKPKPTYKWFFEDDEVP----------IARSDKHNVEEGLLIIESL-NSEDAGTYKCVANNTVGSNERTFDLAVFLKP 334          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 73.1738 bits (178), Expect = 1.133e-12
Identity = 112/470 (23.83%), Postives = 181/470 (38.51%), Query Frame = 1
Query:  490 LIIKDFKPANNGIYKCDTVQSNNKTPSK----INIIGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRL-TVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYG----LWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISF 1872
            L I++   A+ G Y C  + SN    +     I++   P        +  +E G++  I C   GHP+  + W   G   + DN   S      TL I +      G Y C A  S+ D E               V VY  P I       T+ ++   + G     G + ++C   G P P +TW +    + +  D R  I  +Y        LKI  V  +D G Y+C +       +   A     E I +P F++ G NL    + + ++ + C   G  S  L ++S+   D    ++ Y      +YS+       +P  SH  +TI+  K  D G Y C+A   S++  +   + I+ +L  P+I   KS + G    +  +   L+C     P P   WT     +       R+    NN+T   E + + +       G Y C+A N  G      S 
Sbjct: 3264 LHIRNATRADEGKYSC--IASNEAGTAVADFLIDVFTKPTFETHETTFNIVE-GESAKIECKIDGHPKPTISWLKGGRPFNMDNIILS--PRGDTLMILKAQRFDGGLYTCVATNSYGDSEQ-----------DFKVNVYTKPYIDE-----TIDQTPKAVAG-----GEIILKCPVLGNPTPTVTWKRGDDAVPN--DSRHTIVNNYD-------LKINSVTTEDAGQYSCIAVNEAGNLTTHYAA----EVIGKPTFVRKGGNLYEV-IENDTITMDC---GVTSRPLPSISWFRGD--KPVYLYD-----RYSI-------SPDGSH--ITINKAKLSDGGKYICRA---SNEAGTSDIDLILKILVPPKI--DKSNIIGNPLAIVARTIYLECPISGIPQPDVIWTKNGMDI--NMTDSRVILAQNNETFGIENVQVTD------QGRYTCTATNRGGKASHDFSL 3661          

HSP 2 Score: 68.9366 bits (167), Expect = 2.084e-11
Identity = 97/450 (21.56%), Postives = 168/450 (37.33%), Query Frame = 1
Query:  379 NMEPVVNYFTDPQKAQTNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTV--QSNNKTPSKINIIGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSK---MINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPL 1710
            N EPVVN+  D +   +       D+L  +  +  +HL  ++   A+ G Y C        ++T + + ++  P++  D  R    +EG T  ++C   G P   V W   G+ +     +F+ +     L I   T    GKY C A             G+ +    ID  V+  P         T +  ET     I E  + +IEC   G P P I+W K  +   M N  + PR               L I   Q  D G+YTC ++ SY    +    N     ++   ++    +    ++    + L C V G  +  +T     +   N                   D  +  +++Y L I+ +  +DAG Y C   +  ++  +L+ +    V+  P  +     LY +     + + C   + P P+  W   D P+
Sbjct: 3153 NPEPVVNWLKDGEPYTS-------DLLQFSTKLSYLHL--RETTLADGGTYTCIATNKAGESQTTTDVEVLVPPRIE-DEERVLQGKEGNTYMVHCQVTGRPVPYVTWKRNGKEI----EQFNPV-----LHIRNATRADEGKYSCIASNE---------AGTAVADFLID--VFTKP---------TFETHETTFN--IVEGESAKIECKIDGHPKPTISWLKGGRPFNMDNIILSPR------------GDTLMILKAQRFDGGLYTCVATNSYGDSEQDFKVN-----VYTKPYIDETIDQTPKAVAGGEIILKCPVLGNPTPTVTWKRGDDAVPN-------------------DSRHTIVNNYDLKINSVTTEDAGQYSC---IAVNEAGNLTTHYAAEVIGKPTFVRKGGNLYEVIENDTITMDCGVTSRPLPSISWFRGDKPV 3522          

HSP 3 Score: 64.6994 bits (156), Expect = 4.610e-10
Identity = 53/221 (23.98%), Postives = 95/221 (42.99%), Query Frame = 1
Query:  514 ANNGIYKCDTVQSNNKTPSKINI-IGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTC 1173
            ++ G Y C           K N+ +G    +++ PR Q + +G    + C + G P+  + W+ + E L+      +     +++  S ++    G Y CKAE      E+            ID+IV   PE+ P+  +V+     T  + T+F      + C++ G+P P I+W +DS +        +Q +E Y  + + + L I  V   D G Y C
Sbjct: 4290 SDQGEYSCTAANKAGNATQKTNLNVGVAPKIMERPRTQVVHKGDQVTLWCEASGVPQPAITWYKDNELLTNTGVDETATTKKKSVIFSSISPSQAGVYTCKAENWVASTEE-----------DIDLIVMIPPEVVPERMNVS-----TNPRQTVF------LSCNATGIPEPVISWMRDSNIA-------IQNNEKY--QILGTTLAIRNVLPDDDGFYHC 4479          

HSP 4 Score: 63.929 bits (154), Expect = 7.029e-10
Identity = 89/427 (20.84%), Postives = 163/427 (38.17%), Query Frame = 1
Query:  460 NKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINI-IGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDS-RGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTC----NSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKAS---VRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAK-AYPNPTWEWTFQDYPL 1710
            N   G   +H + +    A+ G+Y+C    +   +  K+ + I  P  V  +P+  +    +   ++C + G P+ +V W+F+G HL  D +K+   ++ + L I + T    G Y C+A        D             D+++   P++      + V + +            +  EC + RG P PKI WFK+ K +    D  ++I+E          L I   + +D G Y+C     +       + SV R   P  I  P  +++          ++ V L C   G     +    I     N +    N    +Y+           ++   L I+D + +D G + C A     +  +  +L   G+VS +    + P +  + G   +   L C      P P+  W   D P+
Sbjct:  569 NPTNGTLKIHHVTR----ADAGVYECMARNAGGMSTRKMRLDIMEPPSVKVTPQDVYFNMREGVNLSCEAMGDPKPEVHWYFKGRHLLND-YKYQVGQDSKFLYIRDATHHDEGTYECRAMSQAGQARDT-----------TDLMLATPPKVEIIQNKMMVGRGD-----------RVSFECKTIRGKPHPKIRWFKNGKDLIKP-DDYIKINEGQ--------LHIMGAKDEDAGAYSCVGENMAGKDVQVANLSVGR--VPTIIESPHTVRVN--------IERQVTLQCLAVG-----IPPPEIEWQKGNVLLATLNNP--RYT----------QLADGNLLITDAQIEDQGQFTCIARNTYGQQSQSTTLMVTGLVSPVLG-HVPPEEQLIEG---QDLTLSCVVVLGTPKPSIVWIKDDKPV 928          

HSP 5 Score: 61.2326 bits (147), Expect = 4.730e-9
Identity = 91/400 (22.75%), Postives = 158/400 (39.50%), Query Frame = 1
Query:  688 VVWF--FEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPE-----ILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPL-PNQ----FNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGN 1851
            ++W   ++   L  ++ + + + N + L I  VTE   G+Y C+  V  D  E+     + + V P  +++ KD             K++T +     E   + + C + G P P ITWFKD + I H  +    I     + N    LKI  ++  D G YTC +  S    + SV +++    I  P+  K G   +  S  ++ V +SC V+     ++T     +   +  F  T+ +  K                  L +  ++  D+  Y C   + +++  +   +  VS+L AP      I+   +   G     + L C AK  P+PT  W      + PN     F+  R   I+  + S                G Y C A NS+G+
Sbjct: 2224 IIWLRNYQPIDLEAEDARITRLSNDRRLTILNVTENDEGQYSCR--VKNDAGENSFDFKATVLVPPTIIMLDKD-------------KNKTAV-----EHSTVTLSCPATGKPEPDITWFKDGEAI-HIENIADIIPNGELNGN---QLKITRIKEGDAGKYTCEADNS----AGSVEQDVNVNVITIPKIEKDGIPSDYESQQNERVVISCPVYARPPAKITWLKAGKPLQSDKFVKTSANGQK------------------LYLFKLRETDSSKYTC---IATNEAGTDKRDFKVSMLVAPSFDEPNIVRRITVNSG---NPSTLHCPAKGSPSPTITWLKDGNAIEPNDRYVFFDAGRQLQISKTEGSDQ--------------GRYTCIATNSVGS 2557          

HSP 6 Score: 59.6918 bits (143), Expect = 1.416e-8
Identity = 136/612 (22.22%), Postives = 219/612 (35.78%), Query Frame = 1
Query:  142 VFNFMNVESNKYSECENLPANSIKILDHKNEMKVWFGSEVSLTCCMKENLKFNDNSDFYEDDFEIANSKNSPPLIWYDPNMEPVVNY----FTDPQKAQTNKIFMIPDMLNKAK---GIQVVHLIIKDFKPANNGIYKC----------DTVQSNNKTPSKINIIGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHL-SPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEI--SPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYI--SHYTLTISDIKPQDAGSYYCKAS--------------VRSDKYFSLSHNGIV-----SVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNND-TSTSELIILPNFQNDAIFGTYECSARNSLGN 1851
            VFN  N E N        P N    + H         ++  +  CM  N           D  E  + K +P  +++  NM   VN       DP K + +  F    +LN  K   G     L I+D    + G Y+C          DT      TP K+ II N  +V    R  F  E KT       RG P   + WF  G+ L  PD++      N   L I    +   G Y C  E       +M   G  ++V   ++ V + P I  SP +  V +++  T             ++C + G+PPP+I W K + ++    +PR       Y++     L I   Q +D G +TC +  +Y   S+S    +T   +  P    +        +  + + LSC V    + + ++ +I +D                  + +++ P   I      L +    P+D G Y C A               ++  ++      GIV     S +    +    ST   L  +   + C     P P   W     P+          T N+ D T T++  ++    + +  G Y C A NS G+
Sbjct:  560 VFNGPNTERN--------PTNGTLKIHHVTR------ADAGVYECMARNAGGMSTRKMRLDIMEPPSVKVTPQDVYF--NMREGVNLSCEAMGDP-KPEVHWYFKGRHLLNDYKYQVGQDSKFLYIRDATHHDEGTYECRAMSQAGQARDTTDLMLATPPKVEIIQNKMMVGRGDRVSF--ECKT------IRGKPHPKIRWFKNGKDLIKPDDY---IKINEGQLHIMGAKDEDAGAYSCVGE-------NM--AGKDVQVA--NLSVGRVPTIIESPHTVRVNIERQVT-------------LQCLAVGIPPPEIEWQKGNVLLATLNNPR-------YTQLADGNLLITDAQIEDQGQFTCIARNTYGQQSQSTTLMVT--GLVSPVLGHVPPEEQL--IEGQDLTLSCVVVLG-TPKPSIVWIKDD------------------KPVEEGPTIKIEGGGSLLRLRGGNPKDEGKYTCIAVSPAGNSTLHINVQLIKKPEFVYKPEGGIVFKPTISGMDEKHVAVVNSTHDVLDGEGFAIPCVVSGTPPPIITWYLDGRPI----------TPNSRDFTVTADNTLIVRKADKSYSGVYTCQATNSAGD 1079          

HSP 7 Score: 58.5362 bits (140), Expect = 3.318e-8
Identity = 100/477 (20.96%), Postives = 174/477 (36.48%), Query Frame = 1
Query:  490 LIIKDFKPANNGIYKCDTVQSNNKTPS--KINIIGNPKVVIDSPRYQF---IEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVD-PRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKAS--VRSDKYFSLSHNGIVSVLYAPEIL--PTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQP 1890
            L I      N G+Y C  +    +     K+ I+  P  VID  R      +   +   + C   GHP   + W   G+ ++ D+     +E  Q L+I        GK+ C AE             + ++ L + + V+  P +S  S +      ET           + + C++ G P P++ W K   +I  + D  R+ +  +         L I  ++  D+G YTC +  +      SV+ ++    +  P   + G +++      +S+ L C   G       V  +    N +   ++   +   S                + I+++   D G Y C A     SD   +L +N  V V+ AP I    TK  + G   +  V++C  + YP P   W      +       R        T    L I+     D+  G Y CSA N  G+ ++  +      P
Sbjct: 3730 LTISQASLENAGLYTCIALNRAGEASLEFKVEILSPP--VIDISRNDVQPQVAVNQPTIMRCAVTGHPFPSIKWLKNGKEVT-DDENIRIVEQGQVLQILRTDSDHAGKWSCVAE-----------NDAGVKELEMVLDVFTPPVVSVKSDNPIKALGET-----------ITLFCNASGNPYPQLKWAKGGSLIFDSPDGARISLKGAR--------LDIPHLKKTDVGDYTCQALNAAGTSEASVSVDV----LVPPEINRDGIDMSPRLPAQQSLTLQCLAQGK-----PVPQMRWTLNGTALTHSTPGITVASDSTF------------IQINNVSLSDKGVYTCYAENVAGSD---NLMYN--VDVVQAPVISNGGTKQVIEG---ELAVIECLVEGYPAPQVSWLRNGNRVETGVQGVRYV------TDGRMLTIIEARSLDS--GIYLCSATNEAGSAQQAYTLEVLVSP 4136          

HSP 8 Score: 56.225 bits (134), Expect = 1.415e-7
Identity = 56/233 (24.03%), Postives = 92/233 (39.48%), Query Frame = 1
Query:  490 LIIKDFKPANNGIYKCDT--VQSNNKTPSKINIIGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSS 1182
            L++++ K  N G++ C    +   +     + +   PK++ + P    + +G T  I C + G P +   W   G  L  D  KFS ++N  TLRI E  +   G Y C         +           +   V V + P I P     + Q + T + G       +E++C     PP  +TWF+    I    D +  + ES         L I     +D  +YTC +S
Sbjct: 1234 LVLQNVKLENTGVFVCQVSNLAGEDSLSYTLTVHEKPKIISEVPGVVDVVKGFTIEIPCRATGVPEVIRTWNKNGIDLKMDEKKFS-VDNLGTLRIYEADKNDIGNYNCVVTNEAGTSQ-----------MTTHVDVQEPPIILP-----STQTNNTAVVGD-----RVELKCYVEASPPASVTWFRRGIAIG--TDTKGYVVES------DGTLVIQSASVEDATIYTCKAS 1436          

HSP 9 Score: 54.299 bits (129), Expect = 5.786e-7
Identity = 123/529 (23.25%), Postives = 195/529 (36.86%), Query Frame = 1
Query:  487 HLIIKDFKPANNGIYKCDTVQS--NNKTPSKINIIGNPKVVIDSPRYQFIE--EGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKF-SFIE---NHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRS--VARNITPEFIFQPR---FLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKA---SVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPN--VNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVN 2019
             L I   + ++ G Y C    S  ++   + + +I  P  VID  R + +   EG +  + C S     +DV W  +G  ++ D  +  SFI+   + + +      +   G+Y C             P G   ++    V          D PS++ + S   IQ TI     +EI C   G P PK+ W  D K       P    S +Y   N    LKI   Q +  G YTC +  +  G +R   + R   P    + R     ++G  +  T   + SV LS   + A           E   N +         KY+            +  TL +++I+  D G YYC A   +  + K+F L       V+  P  L  +     +  K+  L C A   P PT  +           +  R+   +  D   S L+I  N Q + + G Y C A N  G   K +       P      +NV +V A        P  D+ G+ +T      KD +++
Sbjct: 2533 QLQISKTEGSDQGRYTCIATNSVGSDDLENTLEVIIPP--VIDGERREAVAVIEGFSSELFCDSNST-GVDVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCIVR---------NPAGEARKLFDFAV---------NDPPSISDELSSANIQ-TIVPYYPVEINCVVSGSPHPKVYWLFDDK-------PLEPDSAAYELTNNGETLKIVRSQVEHAGTYTCEAQNNV-GKARKDFLVRVTAPPHFEKEREEVVARVGDTMLLTCNAESSVPLSSVYWHAHD---------ESVQNGVI------TSKYAA-----------NEKTLNVTNIQLDDEGFYYCTAVNEAGITKKFFKL------IVIETPYFLDQQKLYPIILGKRLTLDCSATGTPPPTILF---------MKDGKRLNESDEVDIIGSTLVI-DNPQKE-VEGRYTCIAENKAGRSEKDMMVEVLLPPKLSKEWINV-EVQAGDPLTLECPIEDTSGVHITWSRQFGKDGQLD 2987          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 73.1738 bits (178), Expect = 1.133e-12
Identity = 112/470 (23.83%), Postives = 181/470 (38.51%), Query Frame = 1
Query:  490 LIIKDFKPANNGIYKCDTVQSNNKTPSK----INIIGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRL-TVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYG----LWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISF 1872
            L I++   A+ G Y C  + SN    +     I++   P        +  +E G++  I C   GHP+  + W   G   + DN   S      TL I +      G Y C A  S+ D E               V VY  P I       T+ ++   + G     G + ++C   G P P +TW +    + +  D R  I  +Y        LKI  V  +D G Y+C +       +   A     E I +P F++ G NL    + + ++ + C   G  S  L ++S+   D    ++ Y      +YS+       +P  SH  +TI+  K  D G Y C+A   S++  +   + I+ +L  P+I   KS + G    +  +   L+C     P P   WT     +       R+    NN+T   E + + +       G Y C+A N  G      S 
Sbjct: 3264 LHIRNATRADEGKYSC--IASNEAGTAVADFLIDVFTKPTFETHETTFNIVE-GESAKIECKIDGHPKPTISWLKGGRPFNMDNIILS--PRGDTLMILKAQRFDGGLYTCVATNSYGDSEQ-----------DFKVNVYTKPYIDE-----TIDQTPKAVAG-----GEIILKCPVLGNPTPTVTWKRGDDAVPN--DSRHTIVNNYD-------LKINSVTTEDAGQYSCIAVNEAGNLTTHYAA----EVIGKPTFVRKGGNLYEV-IENDTITMDC---GVTSRPLPSISWFRGD--KPVYLYD-----RYSI-------SPDGSH--ITINKAKLSDGGKYICRA---SNEAGTSDIDLILKILVPPKI--DKSNIIGNPLAIVARTIYLECPISGIPQPDVIWTKNGMDI--NMTDSRVILAQNNETFGIENVQVTD------QGRYTCTATNRGGKASHDFSL 3661          

HSP 2 Score: 69.3218 bits (168), Expect = 1.791e-11
Identity = 97/450 (21.56%), Postives = 168/450 (37.33%), Query Frame = 1
Query:  379 NMEPVVNYFTDPQKAQTNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTV--QSNNKTPSKINIIGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSK---MINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPL 1710
            N EPVVN+  D +   +       D+L  +  +  +HL  ++   A+ G Y C        ++T + + ++  P++  D  R    +EG T  ++C   G P   V W   G+ +     +F+ +     L I   T    GKY C A             G+ +    ID  V+  P         T +  ET     I E  + +IEC   G P P I+W K  +   M N  + PR               L I   Q  D G+YTC ++ SY    +    N     ++   ++    +    ++    + L C V G  +  +T     +   N                   D  +  +++Y L I+ +  +DAG Y C   +  ++  +L+ +    V+  P  +     LY +     + + C   + P P+  W   D P+
Sbjct: 3153 NPEPVVNWLKDGEPYTS-------DLLQFSTKLSYLHL--RETTLADGGTYTCIATNKAGESQTTTDVEVLVPPRIE-DEERVLQGKEGNTYMVHCQVTGRPVPYVTWKRNGKEI----EQFNPV-----LHIRNATRADEGKYSCIASNE---------AGTAVADFLID--VFTKP---------TFETHETTFN--IVEGESAKIECKIDGHPKPTISWLKGGRPFNMDNIILSPR------------GDTLMILKAQRFDGGLYTCVATNSYGDSEQDFKVN-----VYTKPYIDETIDQTPKAVAGGEIILKCPVLGNPTPTVTWKRGDDAVPN-------------------DSRHTIVNNYDLKINSVTTEDAGQYSC---IAVNEAGNLTTHYAAEVIGKPTFVRKGGNLYEVIENDTITMDCGVTSRPLPSISWFRGDKPV 3522          

HSP 3 Score: 64.3142 bits (155), Expect = 4.850e-10
Identity = 53/221 (23.98%), Postives = 95/221 (42.99%), Query Frame = 1
Query:  514 ANNGIYKCDTVQSNNKTPSKINI-IGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTC 1173
            ++ G Y C           K N+ +G    +++ PR Q + +G    + C + G P+  + W+ + E L+      +     +++  S ++    G Y CKAE      E+            ID+IV   PE+ P+  +V+     T  + T+F      + C++ G+P P I+W +DS +        +Q +E Y  + + + L I  V   D G Y C
Sbjct: 4290 SDQGEYSCTAANKAGNATQKTNLNVGVAPKIMERPRTQVVHKGDQVTLWCEASGVPQPAITWYKDNELLTNTGVDETATTKKKSVIFSSISPSQAGVYTCKAENWVASTEE-----------DIDLIVMIPPEVVPERMNVS-----TNPRQTVF------LSCNATGIPEPVISWMRDSNI-------AIQNNEKY--QILGTTLAIRNVLPDDDGFYHC 4479          

HSP 4 Score: 63.929 bits (154), Expect = 6.855e-10
Identity = 89/427 (20.84%), Postives = 163/427 (38.17%), Query Frame = 1
Query:  460 NKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINI-IGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDS-RGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTC----NSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKAS---VRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAK-AYPNPTWEWTFQDYPL 1710
            N   G   +H + +    A+ G+Y+C    +   +  K+ + I  P  V  +P+  +    +   ++C + G P+ +V W+F+G HL  D +K+   ++ + L I + T    G Y C+A        D             D+++   P++      + V + +            +  EC + RG P PKI WFK+ K +    D  ++I+E          L I   + +D G Y+C     +       + SV R   P  I  P  +++          ++ V L C   G     +    I     N +    N    +Y+           ++   L I+D + +D G + C A     +  +  +L   G+VS +    + P +  + G   +   L C      P P+  W   D P+
Sbjct:  569 NPTNGTLKIHHVTR----ADAGVYECMARNAGGMSTRKMRLDIMEPPSVKVTPQDVYFNMREGVNLSCEAMGDPKPEVHWYFKGRHLLND-YKYQVGQDSKFLYIRDATHHDEGTYECRAMSQAGQARDT-----------TDLMLATPPKVEIIQNKMMVGRGD-----------RVSFECKTIRGKPHPKIRWFKNGKDLIKP-DDYIKINEGQ--------LHIMGAKDEDAGAYSCVGENMAGKDVQVANLSVGR--VPTIIESPHTVRVN--------IERQVTLQCLAVG-----IPPPEIEWQKGNVLLATLNNP--RYT----------QLADGNLLITDAQIEDQGQFTCIARNTYGQQSQSTTLMVTGLVSPVLG-HVPPEEQLIEG---QDLTLSCVVVLGTPKPSIVWIKDDKPV 928          

HSP 5 Score: 61.2326 bits (147), Expect = 4.691e-9
Identity = 91/400 (22.75%), Postives = 158/400 (39.50%), Query Frame = 1
Query:  688 VVWF--FEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPE-----ILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPL-PNQ----FNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGN 1851
            ++W   ++   L  ++ + + + N + L I  VTE   G+Y C+  V  D  E+     + + V P  +++ KD             K++T +     E   + + C + G P P ITWFKD + I H  +    I     + N    LKI  ++  D G YTC +  S    + SV +++    I  P+  K G   +  S  ++ V +SC V+     ++T     +   +  F  T+ +  K                  L +  ++  D+  Y C   + +++  +   +  VS+L AP      I+   +   G     + L C AK  P+PT  W      + PN     F+  R   I+  + S                G Y C A NS+G+
Sbjct: 2224 IIWLRNYQPIDLEAEDARITRLSNDRRLTILNVTENDEGQYSCR--VKNDAGENSFDFKATVLVPPTIIMLDKD-------------KNKTAV-----EHSTVTLSCPATGKPEPDITWFKDGEAI-HIENIADIIPNGELNGN---QLKITRIKEGDAGKYTCEADNS----AGSVEQDVNVNVITIPKIEKDGIPSDYESQQNERVVISCPVYARPPAKITWLKAGKPLQSDKFVKTSANGQK------------------LYLFKLRETDSSKYTC---IATNEAGTDKRDFKVSMLVAPSFDEPNIVRRITVNSG---NPSTLHCPAKGSPSPTITWLKDGNAIEPNDRYVFFDAGRQLQISKTEGSDQ--------------GRYTCIATNSVGS 2557          

HSP 6 Score: 59.6918 bits (143), Expect = 1.280e-8
Identity = 136/612 (22.22%), Postives = 219/612 (35.78%), Query Frame = 1
Query:  142 VFNFMNVESNKYSECENLPANSIKILDHKNEMKVWFGSEVSLTCCMKENLKFNDNSDFYEDDFEIANSKNSPPLIWYDPNMEPVVNY----FTDPQKAQTNKIFMIPDMLNKAK---GIQVVHLIIKDFKPANNGIYKC----------DTVQSNNKTPSKINIIGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHL-SPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEI--SPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYI--SHYTLTISDIKPQDAGSYYCKAS--------------VRSDKYFSLSHNGIV-----SVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNND-TSTSELIILPNFQNDAIFGTYECSARNSLGN 1851
            VFN  N E N        P N    + H         ++  +  CM  N           D  E  + K +P  +++  NM   VN       DP K + +  F    +LN  K   G     L I+D    + G Y+C          DT      TP K+ II N  +V    R  F  E KT       RG P   + WF  G+ L  PD++      N   L I    +   G Y C  E       +M   G  ++V   ++ V + P I  SP +  V +++  T             ++C + G+PPP+I W K + ++    +PR       Y++     L I   Q +D G +TC +  +Y   S+S    +T   +  P    +        +  + + LSC V    + + ++ +I +D                  + +++ P   I      L +    P+D G Y C A               ++  ++      GIV     S +    +    ST   L  +   + C     P P   W     P+          T N+ D T T++  ++    + +  G Y C A NS G+
Sbjct:  560 VFNGPNTERN--------PTNGTLKIHHVTR------ADAGVYECMARNAGGMSTRKMRLDIMEPPSVKVTPQDVYF--NMREGVNLSCEAMGDP-KPEVHWYFKGRHLLNDYKYQVGQDSKFLYIRDATHHDEGTYECRAMSQAGQARDTTDLMLATPPKVEIIQNKMMVGRGDRVSF--ECKT------IRGKPHPKIRWFKNGKDLIKPDDY---IKINEGQLHIMGAKDEDAGAYSCVGE-------NM--AGKDVQVA--NLSVGRVPTIIESPHTVRVNIERQVT-------------LQCLAVGIPPPEIEWQKGNVLLATLNNPR-------YTQLADGNLLITDAQIEDQGQFTCIARNTYGQQSQSTTLMVT--GLVSPVLGHVPPEEQL--IEGQDLTLSCVVVLG-TPKPSIVWIKDD------------------KPVEEGPTIKIEGGGSLLRLRGGNPKDEGKYTCIAVSPAGNSTLHINVQLIKKPEFVYKPEGGIVFKPTISGMDEKHVAVVNSTHDVLDGEGFAIPCVVSGTPPPIITWYLDGRPI----------TPNSRDFTVTADNTLIVRKADKSYSGVYTCQATNSAGD 1079          

HSP 7 Score: 58.5362 bits (140), Expect = 3.291e-8
Identity = 100/477 (20.96%), Postives = 174/477 (36.48%), Query Frame = 1
Query:  490 LIIKDFKPANNGIYKCDTVQSNNKTPS--KINIIGNPKVVIDSPRYQF---IEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVD-PRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKAS--VRSDKYFSLSHNGIVSVLYAPEIL--PTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQP 1890
            L I      N G+Y C  +    +     K+ I+  P  VID  R      +   +   + C   GHP   + W   G+ ++ D+     +E  Q L+I        GK+ C AE             + ++ L + + V+  P +S  S +      ET           + + C++ G P P++ W K   +I  + D  R+ +  +         L I  ++  D+G YTC +  +      SV+ ++    +  P   + G +++      +S+ L C   G    ++  +       +S    T  S   +                 + I+++   D G Y C A     SD   +L +N  V V+ AP I    TK  + G   +  V++C  + YP P   W      +       R        T    L I+     D+  G Y CSA N  G+ ++  +      P
Sbjct: 3730 LTISQASLENAGLYTCIALNRAGEASLEFKVEILSPP--VIDISRNDVQPQVAVNQPTIMRCAVTGHPFPSIKWLKNGKEVT-DDENIRIVEQGQVLQILRTDSDHAGKWSCVAE-----------NDAGVKELEMVLDVFTPPVVSVKSDNPIKALGET-----------ITLFCNASGNPYPQLKWAKGGSLIFDSPDGARISLKGAR--------LDIPHLKKTDVGDYTCQALNAAGTSEASVSVDV----LVPPEINRDGIDMSPRLPAQQSLTLQCLAQGKPVPQMRWTLNGTALTHSTPGITVASDSTF-----------------IQINNVSLSDKGVYTCYAENVAGSD---NLMYN--VDVVQAPVISNGGTKQVIEG---ELAVIECLVEGYPAPQVSWLRNGNRVETGVQGVRYV------TDGRMLTIIEARSLDS--GIYLCSATNEAGSAQQAYTLEVLVSP 4136          

HSP 8 Score: 56.6102 bits (135), Expect = 1.357e-7
Identity = 56/233 (24.03%), Postives = 92/233 (39.48%), Query Frame = 1
Query:  490 LIIKDFKPANNGIYKCDT--VQSNNKTPSKINIIGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSS 1182
            L++++ K  N G++ C    +   +     + +   PK++ + P    + +G T  I C + G P +   W   G  L  D  KFS ++N  TLRI E  +   G Y C         +           +   V V + P I P     + Q + T + G       +E++C     PP  +TWF+    I    D +  + ES         L I     +D  +YTC +S
Sbjct: 1234 LVLQNVKLENTGVFVCQVSNLAGEDSLSYTLTVHEKPKIISEVPGVVDVVKGFTIEIPCRATGVPEVIRTWNKNGIDLKMDEKKFS-VDNLGTLRIYEADKNDIGNYNCVVTNEAGTSQ-----------MTTHVDVQEPPIILP-----STQTNNTAVVGD-----RVELKCYVEASPPASVTWFRRGIAIG--TDTKGYVVES------DGTLVIQSASVEDATIYTCKAS 1436          

HSP 9 Score: 54.299 bits (129), Expect = 5.548e-7
Identity = 123/529 (23.25%), Postives = 195/529 (36.86%), Query Frame = 1
Query:  487 HLIIKDFKPANNGIYKCDTVQS--NNKTPSKINIIGNPKVVIDSPRYQFIE--EGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKF-SFIE---NHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRS--VARNITPEFIFQPR---FLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKA---SVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPN--VNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVN 2019
             L I   + ++ G Y C    S  ++   + + +I  P  VID  R + +   EG +  + C S     +DV W  +G  ++ D  +  SFI+   + + +      +   G+Y C             P G   ++    V          D PS++ + S   IQ TI     +EI C   G P PK+ W  D K       P    S +Y   N    LKI   Q +  G YTC +  +  G +R   + R   P    + R     ++G  +  T   + SV LS   + A           E   N +         KY+            +  TL +++I+  D G YYC A   +  + K+F L       V+  P  L  +     +  K+  L C A   P PT  +           +  R+   +  D   S L+I  N Q + + G Y C A N  G   K +       P      +NV +V A        P  D+ G+ +T      KD +++
Sbjct: 2533 QLQISKTEGSDQGRYTCIATNSVGSDDLENTLEVIIPP--VIDGERREAVAVIEGFSSELFCDSNST-GVDVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCIVR---------NPAGEARKLFDFAV---------NDPPSISDELSSANIQ-TIVPYYPVEINCVVSGSPHPKVYWLFDDK-------PLEPDSAAYELTNNGETLKIVRSQVEHAGTYTCEAQNNV-GKARKDFLVRVTAPPHFEKEREEVVARVGDTMLLTCNAESSVPLSSVYWHAHD---------ESVQNGVI------TSKYAA-----------NEKTLNVTNIQLDDEGFYYCTAVNEAGITKKFFKL------IVIETPYFLDQQKLYPIILGKRLTLDCSATGTPPPTILF---------MKDGKRLNESDEVDIIGSTLVI-DNPQKE-VEGRYTCIAENKAGRSEKDMMVEVLLPPKLSKEWINV-EVQAGDPLTLECPIEDTSGVHITWSRQFGKDGQLD 2987          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Fly
Match: Fas2 (gene:FBgn0000635 transcript:FBtr0336884)

HSP 1 Score: 112.849 bits (281), Expect = 5.344e-25
Identity = 158/731 (21.61%), Postives = 280/731 (38.30%), Query Frame = 1
Query:  448 PDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGNPKVVI--DSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSF--IHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKST--LYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPG-APNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDF---EVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIE----LVNSSTAD----------SKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRT---LDEHALAKAEGLKQYYSEAAIL 2559
            P M  +    + + L+I        G Y C    +N +   K   I     +   ++P  Q+   G+   + C  +  P   + W   G+ +   N K+    N   L I  V E   G Y C+A V           G  +E   I V V+  PEI      +++  +   ++G  F        C +RG P P+I+W +D+  +N     R Q++          ++ I  V   D G YTC +        +    N+    + +P+  ++    N T    K + ++C   G  +  +T       E++ N   +   + + + + +  + +     S  TL IS+ +  D G Y C A  +    +   H   ++V +AP+    K    ++    +K  L C A   PN T EW +    + + ++   +K +       S+LI+ P  +    +  Y+C A N  G     +   +A  P         ++TA+T+   +   S   GLP+  Y +++K+    + +  +   + P +P  +    L+P T Y    +A ++ G G N  +        R   E    L N    D          S  F L W V  D G PI RY +            +++ N    V+             F +  L  NT+Y +   A N+ G S    +I +T   +D   +A+    +Q +S AAI+
Sbjct:  102 PPMYTETLPGESLALMITSLSVEMGGKYYCTASYANTEILEKGVTIKTYVAITWTNAPENQYPTLGQDYVVMCEVKADPNPTIDWLRNGDPIRTTNDKYVVQTNG--LLIRNVQESDEGIYTCRAAVI--------ETGELLERT-IRVEVFIQPEI------ISLPTNLEAVEGKPFA-----ANCTARGKPVPEISWIRDATQLNVATADRFQVNPQ------TGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNV----LVRPQIYEL---YNVTGARTKEIAITCRAKGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEPNFDEERGE-----STGTLRISNAERSDDGLYQCIARNKGADAYKTGH---ITVEFAPDFSHMKELPPVFSWEQRKANLSCLAMGIPNATIEWHWNGRKIKDLYDT-NLKIVGTG--PRSDLIVHPVTRQ--YYSGYKCIATNIHGTAEHDMQLKEARVPDFVSEAKPSQLTATTMTFDIRGPSTELGLPILAYSVQYKEALNPDWSTAYNRSWSPDSPYIV--EGLRPQTEYSFRFAARNQVGLG-NWGVNQQQSTPRRSAPEEPKPLHNPVQHDKEEPVVVSPYSDHFELRWGVPADNGEPIDRYQIKYCPGVKISGTWTELENSCNTVEVMETTS-------FEMTQLVGNTYYRIELKAHNAIGYSSPASIIMKTTRGIDVIQVAE----RQVFSSAAIV 770          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Fly
Match: Fas2 (gene:FBgn0000635 transcript:FBtr0343524)

HSP 1 Score: 112.849 bits (281), Expect = 5.581e-25
Identity = 158/731 (21.61%), Postives = 280/731 (38.30%), Query Frame = 1
Query:  448 PDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGNPKVVI--DSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSF--IHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKST--LYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPG-APNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDF---EVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIE----LVNSSTAD----------SKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRT---LDEHALAKAEGLKQYYSEAAIL 2559
            P M  +    + + L+I        G Y C    +N +   K   I     +   ++P  Q+   G+   + C  +  P   + W   G+ +   N K+    N   L I  V E   G Y C+A V           G  +E   I V V+  PEI      +++  +   ++G  F        C +RG P P+I+W +D+  +N     R Q++          ++ I  V   D G YTC +        +    N+    + +P+  ++    N T    K + ++C   G  +  +T       E++ N   +   + + + + +  + +     S  TL IS+ +  D G Y C A  +    +   H   ++V +AP+    K    ++    +K  L C A   PN T EW +    + + ++   +K +       S+LI+ P  +    +  Y+C A N  G     +   +A  P         ++TA+T+   +   S   GLP+  Y +++K+    + +  +   + P +P  +    L+P T Y    +A ++ G G N  +        R   E    L N    D          S  F L W V  D G PI RY +            +++ N    V+             F +  L  NT+Y +   A N+ G S    +I +T   +D   +A+    +Q +S AAI+
Sbjct:   87 PPMYTETLPGESLALMITSLSVEMGGKYYCTASYANTEILEKGVTIKTYVAITWTNAPENQYPTLGQDYVVMCEVKADPNPTIDWLRNGDPIRTTNDKYVVQTNG--LLIRNVQESDEGIYTCRAAVI--------ETGELLERT-IRVEVFIQPEI------ISLPTNLEAVEGKPFA-----ANCTARGKPVPEISWIRDATQLNVATADRFQVNPQ------TGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNV----LVRPQIYEL---YNVTGARTKEIAITCRAKGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEPNFDEERGE-----STGTLRISNAERSDDGLYQCIARNKGADAYKTGH---ITVEFAPDFSHMKELPPVFSWEQRKANLSCLAMGIPNATIEWHWNGRKIKDLYDT-NLKIVGTG--PRSDLIVHPVTRQ--YYSGYKCIATNIHGTAEHDMQLKEARVPDFVSEAKPSQLTATTMTFDIRGPSTELGLPILAYSVQYKEALNPDWSTAYNRSWSPDSPYIV--EGLRPQTEYSFRFAARNQVGLG-NWGVNQQQSTPRRSAPEEPKPLHNPVQHDKEEPVVVSPYSDHFELRWGVPADNGEPIDRYQIKYCPGVKISGTWTELENSCNTVEVMETTS-------FEMTQLVGNTYYRIELKAHNAIGYSSPASIIMKTTRGIDVIQVAE----RQVFSSAAIV 755          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Fly
Match: Fas2 (gene:FBgn0000635 transcript:FBtr0343523)

HSP 1 Score: 112.464 bits (280), Expect = 7.891e-25
Identity = 158/731 (21.61%), Postives = 280/731 (38.30%), Query Frame = 1
Query:  448 PDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGNPKVVI--DSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSF--IHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKST--LYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPG-APNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDF---EVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIE----LVNSSTAD----------SKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRT---LDEHALAKAEGLKQYYSEAAIL 2559
            P M  +    + + L+I        G Y C    +N +   K   I     +   ++P  Q+   G+   + C  +  P   + W   G+ +   N K+    N   L I  V E   G Y C+A V           G  +E   I V V+  PEI      +++  +   ++G  F        C +RG P P+I+W +D+  +N     R Q++          ++ I  V   D G YTC +        +    N+    + +P+  ++    N T    K + ++C   G  +  +T       E++ N   +   + + + + +  + +     S  TL IS+ +  D G Y C A  +    +   H   ++V +AP+    K    ++    +K  L C A   PN T EW +    + + ++   +K +       S+LI+ P  +    +  Y+C A N  G     +   +A  P         ++TA+T+   +   S   GLP+  Y +++K+    + +  +   + P +P  +    L+P T Y    +A ++ G G N  +        R   E    L N    D          S  F L W V  D G PI RY +            +++ N    V+             F +  L  NT+Y +   A N+ G S    +I +T   +D   +A+    +Q +S AAI+
Sbjct:   87 PPMYTETLPGESLALMITSLSVEMGGKYYCTASYANTEILEKGVTIKTYVAITWTNAPENQYPTLGQDYVVMCEVKADPNPTIDWLRNGDPIRTTNDKYVVQTNG--LLIRNVQESDEGIYTCRAAVIET--------GELLERT-IRVEVFIQPEI------ISLPTNLEAVEGKPFA-----ANCTARGKPVPEISWIRDATQLNVATADRFQVNPQ------TGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNV----LVRPQIYEL---YNVTGARTKEIAITCRAKGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEPNFDEERGE-----STGTLRISNAERSDDGLYQCIARNKGADAYKTGH---ITVEFAPDFSHMKELPPVFSWEQRKANLSCLAMGIPNATIEWHWNGRKIKDLYDT-NLKIVGTG--PRSDLIVHPVTRQ--YYSGYKCIATNIHGTAEHDMQLKEARVPDFVSEAKPSQLTATTMTFDIRGPSTELGLPILAYSVQYKEALNPDWSTAYNRSWSPDSPYIV--EGLRPQTEYSFRFAARNQVGLG-NWGVNQQQSTPRRSAPEEPKPLHNPVQHDKEEPVVVSPYSDHFELRWGVPADNGEPIDRYQIKYCPGVKISGTWTELENSCNTVEVMETTS-------FEMTQLVGNTYYRIELKAHNAIGYSSPASIIMKTTRGIDVIQVAE----RQVFSSAAIV 755          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Fly
Match: Fas2 (gene:FBgn0000635 transcript:FBtr0336882)

HSP 1 Score: 112.079 bits (279), Expect = 9.961e-25
Identity = 158/731 (21.61%), Postives = 280/731 (38.30%), Query Frame = 1
Query:  448 PDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGNPKVVI--DSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSF--IHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKST--LYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPG-APNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDF---EVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIE----LVNSSTAD----------SKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRT---LDEHALAKAEGLKQYYSEAAIL 2559
            P M  +    + + L+I        G Y C    +N +   K   I     +   ++P  Q+   G+   + C  +  P   + W   G+ +   N K+    N   L I  V E   G Y C+A V           G  +E   I V V+  PEI      +++  +   ++G  F        C +RG P P+I+W +D+  +N     R Q++          ++ I  V   D G YTC +        +    N+    + +P+  ++    N T    K + ++C   G  +  +T       E++ N   +   + + + + +  + +     S  TL IS+ +  D G Y C A  +    +   H   ++V +AP+    K    ++    +K  L C A   PN T EW +    + + ++   +K +       S+LI+ P  +    +  Y+C A N  G     +   +A  P         ++TA+T+   +   S   GLP+  Y +++K+    + +  +   + P +P  +    L+P T Y    +A ++ G G N  +        R   E    L N    D          S  F L W V  D G PI RY +            +++ N    V+             F +  L  NT+Y +   A N+ G S    +I +T   +D   +A+    +Q +S AAI+
Sbjct:   87 PPMYTETLPGESLALMITSLSVEMGGKYYCTASYANTEILEKGVTIKTYVAITWTNAPENQYPTLGQDYVVMCEVKADPNPTIDWLRNGDPIRTTNDKYVVQTNG--LLIRNVQESDEGIYTCRAAVIET--------GELLERT-IRVEVFIQPEI------ISLPTNLEAVEGKPFA-----ANCTARGKPVPEISWIRDATQLNVATADRFQVNPQ------TGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNV----LVRPQIYEL---YNVTGARTKEIAITCRAKGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEPNFDEERGE-----STGTLRISNAERSDDGLYQCIARNKGADAYKTGH---ITVEFAPDFSHMKELPPVFSWEQRKANLSCLAMGIPNATIEWHWNGRKIKDLYDT-NLKIVGTG--PRSDLIVHPVTRQ--YYSGYKCIATNIHGTAEHDMQLKEARVPDFVSEAKPSQLTATTMTFDIRGPSTELGLPILAYSVQYKEALNPDWSTAYNRSWSPDSPYIV--EGLRPQTEYSFRFAARNQVGLG-NWGVNQQQSTPRRSAPEEPKPLHNPVQHDKEEPVVVSPYSDHFELRWGVPADNGEPIDRYQIKYCPGVKISGTWTELENSCNTVEVMETTS-------FEMTQLVGNTYYRIELKAHNAIGYSSPASIIMKTTRGIDVIQVAE----RQVFSSAAIV 755          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Fly
Match: Fas2 (gene:FBgn0000635 transcript:FBtr0070665)

HSP 1 Score: 112.079 bits (279), Expect = 1.022e-24
Identity = 158/731 (21.61%), Postives = 280/731 (38.30%), Query Frame = 1
Query:  448 PDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGNPKVVI--DSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSF--IHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKST--LYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPG-APNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDF---EVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIE----LVNSSTAD----------SKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRT---LDEHALAKAEGLKQYYSEAAIL 2559
            P M  +    + + L+I        G Y C    +N +   K   I     +   ++P  Q+   G+   + C  +  P   + W   G+ +   N K+    N   L I  V E   G Y C+A V           G  +E   I V V+  PEI      +++  +   ++G  F        C +RG P P+I+W +D+  +N     R Q++          ++ I  V   D G YTC +        +    N+    + +P+  ++    N T    K + ++C   G  +  +T       E++ N   +   + + + + +  + +     S  TL IS+ +  D G Y C A  +    +   H   ++V +AP+    K    ++    +K  L C A   PN T EW +    + + ++   +K +       S+LI+ P  +    +  Y+C A N  G     +   +A  P         ++TA+T+   +   S   GLP+  Y +++K+    + +  +   + P +P  +    L+P T Y    +A ++ G G N  +        R   E    L N    D          S  F L W V  D G PI RY +            +++ N    V+             F +  L  NT+Y +   A N+ G S    +I +T   +D   +A+    +Q +S AAI+
Sbjct:   87 PPMYTETLPGESLALMITSLSVEMGGKYYCTASYANTEILEKGVTIKTYVAITWTNAPENQYPTLGQDYVVMCEVKADPNPTIDWLRNGDPIRTTNDKYVVQTNG--LLIRNVQESDEGIYTCRAAVIET--------GELLERT-IRVEVFIQPEI------ISLPTNLEAVEGKPFA-----ANCTARGKPVPEISWIRDATQLNVATADRFQVNPQ------TGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNV----LVRPQIYEL---YNVTGARTKEIAITCRAKGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEPNFDEERGE-----STGTLRISNAERSDDGLYQCIARNKGADAYKTGH---ITVEFAPDFSHMKELPPVFSWEQRKANLSCLAMGIPNATIEWHWNGRKIKDLYDT-NLKIVGTG--PRSDLIVHPVTRQ--YYSGYKCIATNIHGTAEHDMQLKEARVPDFVSEAKPSQLTATTMTFDIRGPSTELGLPILAYSVQYKEALNPDWSTAYNRSWSPDSPYIV--EGLRPQTEYSFRFAARNQVGLG-NWGVNQQQSTPRRSAPEEPKPLHNPVQHDKEEPVVVSPYSDHFELRWGVPADNGEPIDRYQIKYCPGVKISGTWTELENSCNTVEVMETTS-------FEMTQLVGNTYYRIELKAHNAIGYSSPASIIMKTTRGIDVIQVAE----RQVFSSAAIV 755          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Zebrafish
Match: ncam2 (neural cell adhesion molecule 2 [Source:ZFIN;Acc:ZDB-GENE-010822-1])

HSP 1 Score: 122.479 bits (306), Expect = 5.311e-28
Identity = 156/699 (22.32%), Postives = 273/699 (39.06%), Query Frame = 1
Query:  385 EPVVNYFTDPQKAQTNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINI--IGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAP-NVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIE-VMTKHLGRPVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQS 2466
            EPV   + +PQ     ++   P +    +GI+   L + + K  + GIY+C    +  +T     +  I       D    Q   +G+   + C     P   V WF+    ++ D  KF  ++N+  L++ +VT+   G Y C+A V    + D      F  ++ + V V     +   S + T    E+           +   C + G P P +TW        H    ++Q SE Y  R   + L +  +Q  D G YTC +S      +  V   +  +   QP   K+    N T++   +  +SC   G       +S+      +S  +      G+  V               LTI  +K  D G + C+A  R   +     +  + + YAP+      T++  W    V + C   + P  T  W  +   +P++     M+       S  E+  +    +D  FG Y C+ARN++G   +    +QA  P  P +V +  V      +  T     GG+P++HY +++KD   ++ +         + + L++L+PNT Y++ +SA +  G+G  +  E   T  +  P    V       K++ L  V   DGG PI+ Y                +  +    + +M   +        +  L+ NT YE+  TA N  G S
Sbjct:   46 EPVKLEWFNPQG---ERMVASPRVALHNEGIRS-RLTLYNAKIEDAGIYRCQATDAQGETQEATVVLEIYQKLTFRDVRSPQEFRQGEVAEVVCDVTSSPVPVVSWFYNNIEITEDTEKFELLQNN-NLQVQKVTKADEGVYRCEARVEARGEID------FRNII-LVVNVPPVVSVPQQSFNATADYGES-----------VTFTCRAYGSPEPDVTW--------HRKGVQLQESERYVMRARGTTLTVRNIQQDDGGSYTCRASNK----AGEVEHELFLKVFVQPHITKL---RNVTAVEGSAAMISCKAEG--EPLPEISWRRASDGHSFSDGDKSPDGRVEV-------RGRYGESMLTIVVVKLSDWGRFDCEALSRIGGH---QKSMFLDIEYAPK-FQANHTIFFSWEGNPVNISCDVMSNPPATMLWRREKLTIPSE-GAGNMRVYTAPGRSLLEVTPM----SDRDFGRYNCTARNNIGMRFQEFILAQADVPSNPYSVRLSSVAQRVATVTFTKPDSHGGVPISHYLVKYKDIS-SQDWKDVKSLGTQTIVLLTNLEPNTTYEVRVSAVNGKGQGEFSHTESFQTLPIREPSPPSVQGQRGVGKAYRLGLVKQDDGGMPILEYI---------------VKYKTDKEEQWMTKLVPGVNDFVLLQPLQWNTQYEVEITARNVKGLS 672          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Zebrafish
Match: ncam2 (neural cell adhesion molecule 2 [Source:ZFIN;Acc:ZDB-GENE-010822-1])

HSP 1 Score: 122.479 bits (306), Expect = 5.643e-28
Identity = 156/699 (22.32%), Postives = 273/699 (39.06%), Query Frame = 1
Query:  385 EPVVNYFTDPQKAQTNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINI--IGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAP-NVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIE-VMTKHLGRPVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQS 2466
            EPV   + +PQ     ++   P +    +GI+   L + + K  + GIY+C    +  +T     +  I       D    Q   +G+   + C     P   V WF+    ++ D  KF  ++N+  L++ +VT+   G Y C+A V    + D      F  ++ + V V     +   S + T    E+           +   C + G P P +TW        H    ++Q SE Y  R   + L +  +Q  D G YTC +S      +  V   +  +   QP   K+    N T++   +  +SC   G       +S+      +S  +      G+  V               LTI  +K  D G + C+A  R   +     +  + + YAP+      T++  W    V + C   + P  T  W  +   +P++     M+       S  E+  +    +D  FG Y C+ARN++G   +    +QA  P  P +V +  V      +  T     GG+P++HY +++KD   ++ +         + + L++L+PNT Y++ +SA +  G+G  +  E   T  +  P    V       K++ L  V   DGG PI+ Y                +  +    + +M   +        +  L+ NT YE+  TA N  G S
Sbjct:   46 EPVKLEWFNPQG---ERMVASPRVALHNEGIRS-RLTLYNAKIEDAGIYRCQATDAQGETQEATVVLEIYQKLTFRDVRSPQEFRQGEVAEVVCDVTSSPVPVVSWFYNNIEITEDTEKFELLQNN-NLQVQKVTKADEGVYRCEARVEARGEID------FRNII-LVVNVPPVVSVPQQSFNATADYGES-----------VTFTCRAYGSPEPDVTW--------HRKGVQLQESERYVMRARGTTLTVRNIQQDDGGSYTCRASNK----AGEVEHELFLKVFVQPHITKL---RNVTAVEGSAAMISCKAEG--EPLPEISWRRASDGHSFSDGDKSPDGRVEV-------RGRYGESMLTIVVVKLSDWGRFDCEALSRIGGH---QKSMFLDIEYAPK-FQANHTIFFSWEGNPVNISCDVMSNPPATMLWRREKLTIPSE-GAGNMRVYTAPGRSLLEVTPM----SDRDFGRYNCTARNNIGMRFQEFILAQADVPSNPYSVRLSSVAQRVATVTFTKPDSHGGVPISHYLVKYKDIS-SQDWKDVKSLGTQTIVLLTNLEPNTTYEVRVSAVNGKGQGEFSHTESFQTLPIREPSPPSVQGQRGVGKAYRLGLVKQDDGGMPILEYI---------------VKYKTDKEEQWMTKLVPGVNDFVLLQPLQWNTQYEVEITARNVKGLS 672          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Zebrafish
Match: ncam1a (neural cell adhesion molecule 1a [Source:ZFIN;Acc:ZDB-GENE-990415-31])

HSP 1 Score: 119.398 bits (298), Expect = 5.964e-27
Identity = 159/705 (22.55%), Postives = 281/705 (39.86%), Query Frame = 1
Query:  523 GIYKCDTVQSNNKTPSKINIIGNPKVVID-SPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPR--FLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKA--SVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGR----PVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRTLDEHALAKAEGLKQYYSEAAILMQSRLSLMMAVFLFLVL 2610
            G+YKC       ++   I +    K+    +P  Q   EG    I C     P   ++W ++   + P+      + ++  L+I  + +   G Y C+  +    + D+      + VLP                  +++   T +  T   +  + + C + G P P + W + +          ++  E Y      S L I  V   D G Y C +       S  V  N+      QP+  FL+   N  A+ L ++ + L+C   G  +  +  SF        +F    +S+    V     + +  +S  +LT+  ++  DAG Y C A  S+  D       +  + V YAP+I   ++         N+  C+A A+P  +  W      LP+  N   +K  N    + S L + P+ QND  FG+Y C+A N +G   K     QA  P AP++   +  +ST  +     + SGG+P+  Y+  ++    +     Y      + IT+  LKP T Y++ +SA +  G G ++  E       R    P +E    ST +     +H++   DGG+PI  Y V  +  +     + K   R+ +  +Y+V           +  L  NT YE+   A N  G+S    + FRTL E             + + +   + + +++ VF+ L+ 
Sbjct:   90 GMYKCVAKSGEKESQGTIIVKIFQKLTFQYAPSPQEFNEGDDADIICDVISSPPPTIIWRYKKMRIQPETDVRLKVLSNNHLQIRGIKKTDEGDYTCEGRIMARGEIDLRVIKVIVNVLP------------------SIRTRYTELNATADINQAVTLACHADGYPEPTVKWARGNT--------ELESDEKYSLNEDGSELTIKDVNKLDEGDYKCIARNKAGERSEEVTLNV----FVQPKITFLE---NQTASEL-EEQITLTCEATGDPTPNIIWSF-----GRRVFTENEQSLDGNVVV----RSDARVS--SLTLKYVQFTDAGQYLCTARNSIGQD-----IQSMYLEVRYAPKIQGPQAVFTWEGNPANIT-CEALAHPGASVLWFRDGQQLPSA-NTTNVKIYNT--PTVSFLEVTPDSQND--FGSYNCTATNVIGTESKEFILVQADVPSAPSIERVEPYSSTAMIEFEEPASSGGVPVLKYKAEWRIAGQDWTDREYELEDGLNLITIVGLKPETTYEVKISAINGKGEGESSAPESFKTQPVREPNPPKLEAKPQSTGN--EMKVHFIKQDDGGSPIKHYLVRYRAKN---RQDWKPEIRMPDASDYIV-----------LRGLDWNTEYEVYVIAENQRGRSEPGTLSFRTLPEPTAIPE-------TSSGLGTGAIVGILIVVFILLLF 715          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Zebrafish
Match: ncam1a (neural cell adhesion molecule 1a [Source:ZFIN;Acc:ZDB-GENE-990415-31])

HSP 1 Score: 116.316 bits (290), Expect = 5.442e-26
Identity = 154/676 (22.78%), Postives = 270/676 (39.94%), Query Frame = 1
Query:  610 SPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPR--FLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDF-NNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKA--SVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGR----PVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRTLDEHALAKAEGLKQYYSEAAILMQSRLSLMMAVFLFLVL 2610
            +P  Q   EG    I C     P   ++W ++   + P+      + ++  L+I  + +   G Y C+  +    + D+      + VLP                  +++   T +  T   +  + + C + G P P + W + +          ++  E Y      S L I  V   D G Y C +       S  V  N+      QP+  FL+   N  A+ L ++ + L+C   G  +  +  SF    F  N    +T     K     +  + +  +S  +LT+  ++  DAG Y C A  S+  D       +  + V YAP+I   ++         N+  C+A A+P  +  W      LP+  N   +K  N    + S L + P+ QND  FG+Y C+A N +G   K     QA  P AP++   +  +ST  +     + SGG+P+  Y+  ++    +     Y      + IT+  LKP T Y++ +SA +  G G ++  E       R    P +E    ST +     +H++   DGG+PI  Y V  +  +     + K   R+ +  +Y+V           +  L  NT YE+   A N  G+S    + FRTL E             + + +   + + +++ VF+ L+ 
Sbjct:   30 APSPQEFNEGDDADIICDVISSPPPTIIWRYKKMRIQPETDVRLKVLSNNHLQIRGIKKTDEGDYTCEGRIMARGEIDLRVIKVIVNVLP------------------SIRTRYTELNATADINQAVTLACHADGYPEPTVKWARGNT--------ELESDEKYSLNEDGSELTIKDVNKLDEGDYKCIARNKAGERSEEVTLNV----FVQPKITFLE---NQTASEL-EEQITLTCEATGDPTPNIIWSFGRRVFTENEQASWTRPEKHKSLDGNVVVRSDARVS--SLTLKYVQFTDAGQYLCTARNSIGQD-----IQSMYLEVRYAPKIQGPQAVFTWEGNPANIT-CEALAHPGASVLWFRDGQQLPSA-NTTNVKIYNT--PTVSFLEVTPDSQND--FGSYNCTATNVIGTESKEFILVQADVPSAPSIERVEPYSSTAMIEFEEPASSGGVPVLKYKAEWRIAGQDWTDREYELEDGLNLITIVGLKPETTYEVKISAINGKGEGESSAPESFKTQPVREPNPPKLEAKPQSTGN--EMKVHFIKQDDGGSPIKHYLVRYRAKN---RQDWKPEIRMPDASDYIV-----------LRGLDWNTEYEVYVIAENQRGRSEPGTLSFRTLPEPTAIPE-------TSSGLGTGAIVGILIVVFILLLF 635          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Zebrafish
Match: ncam1b (neural cell adhesion molecule 1b [Source:ZFIN;Acc:ZDB-GENE-010822-2])

HSP 1 Score: 116.701 bits (291), Expect = 5.757e-26
Identity = 148/610 (24.26%), Postives = 251/610 (41.15%), Query Frame = 1
Query:  490 LIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGNPKVV-IDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNH-KFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNV-YSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNS-IFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQ--DAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNP-TWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFE----VNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVM-TKH-LGRPVIELVNSS-TADSKSFNLHWVVDTDGGAPIIRY 2277
            L I + K  N G Y+C     +    + +N+    K+   + P  Q   EG    I C     P   V+W ++G  +  D   +F  + N+  L+I  + +   G Y C+  +    + D       + VLP                ++ ++++ET    T     +  + CD  G P P +TW +++  +          S + YS N   S + +  V   D G YTC  + +  G S    + ++ +   QP+   + +    T+  D+ V L+C   G  +  +T SF    F       +T     K     +  + +  +S  TL      PQ  DAG Y C A    +          + V YAP+IL + + +Y        + C+  A+P+  +  W    + LPN  N   +K   +N  S S L + P  Q+D  FG Y C+  N +G   +      A  P AP++   +  +ST Q+       +GG+P+  Y   ++       V RV   Y      S++T++ LKP T Y++ +SA +  G G ++   V  T+H LG P   ++  +      S  + W+   DGG+PI  Y
Sbjct:   79 LTIYNAKVDNAGTYRCVASSGDQDAEATVNLKIYQKITFTNVPSPQEFTEGDNAIIVCDVISSPPPTVLWKYKGAKIQFDKDVRFKTLSNNH-LQIRGIRKTDEGVYTCEGRIKARGEVDFRSIKVVVNVLP----------------TIRIRQAET--NATADMGFSTLLACDPDGFPEPIVTWRRNNAPLE---------SGNKYSFNEDGSEMTVLDVTKLDEGDYTC-IAKNKAGESE---QELSLKVFVQPKITYLESQ--TTTEMDEQVTLTCEATGDPTPTITWSFGTRVFTEGEQASWTRPEQHKGPDGEVLVRSDARVSSLTLKY----PQYTDAGQYLCTAR---NAIGETVQPVSLEVRYAPKILGSVA-VYTWEGNPANISCEVLAHPSDVSITWLRDGFQLPNA-NTSNIKI--HNTPSASYLEVNPESQSD--FGNYNCTTSNEIGTESREFIMIPADVPSAPSIGEVQPYSSTAQVLFEEPESTGGVPVLKYRAEWRAVGRGKWVQRV---YEVKDGLSSVTVTGLKPETDYEVKMSAINGKGEGDSSPSMVFKTEHVLGEPSPPILEGTLQPKGNSLKVKWIKQDDGGSPITHY 638          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Xenopus
Match: ncam2 (neural cell adhesion molecule 2 [Source:NCBI gene;Acc:100151722])

HSP 1 Score: 131.724 bits (330), Expect = 1.121e-30
Identity = 162/662 (24.47%), Postives = 276/662 (41.69%), Query Frame = 1
Query:  523 GIYKCDTVQSNNKTPSKINI--IGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSP-DNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHY---TLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAP-NVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKD-----FEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEV-MTKHLGRPVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQS 2466
            GIY+C    S         +  I       D P  Q  + G+   + C     P   V W    E ++  D+ +F+ + N+  L+I  +++R  G Y C+  V          RG  I+   I VIV   PEI         Q+          ED  + + C + G P P ITW ++ K+        V+ +E Y  R   + L +  + + D G+Y C ++ +  GF+    +    +   QP  +++    N T++    V L+C   G            E      ++ ++  M  Y  +  QD       H+   +L I  +   DAG Y C+A+ R   +     +  +++ YAP+ + +  T+Y  W    + + C   + P  +  W+     LP + N   +KT    D     L I P   ND  FG Y C+A NS+G+  +    + A  P +P  + V +++ +  ++        GG+P+ HY+M FK+     ++V R  G        + I L +L  NT Y++ ++A +  G+G  +  E+  T  +  P    ++      KSF L      DGGAPI+ Y V  +  D +     K    +GN K+Y++           ++ L+ N  YE++  ATN  G S
Sbjct:   77 GIYRCQATDSKGHAQEATVVLEIYQKLTFEDVPSPQEFKRGENAEVLCLVSSSPAPMVRWLNNREDVTDIDDRRFAMLPNNN-LQIKNISKRDEGIYRCEGRVEV--------RGE-IDFRDISVIVNVPPEI-------LAQQRSFNATADRLED--ITLFCRATGSPKPYITWHRNGKL--------VEENEKYDLREDNTELTVKNIISTDSGLYVCRAT-NKAGFTE---KQSFLQVFVQPHIVQL---QNETTIEHGHVTLTCEAEG------------EPIPEITWKRSSDGMIFYDGDKSQDGRIESTGHHGKSSLHIKSVMLSDAGRYDCEAASRIGGH---QKSMYLNIEYAPKFI-SNQTIYYSWENNPINISCDVTSNPPSSIYWSRDKLLLPAR-NITNIKTY--RDGKRILLEITPLSDND--FGRYNCTAINSIGSRIQEYILTLADVPSSPYGLRVIELSQTYAKVFFNKPDSHGGVPIHHYQMDFKEVSSEIWKVVRSHG------TQTIIVLGNLDANTTYEVKVAAVNGKGKGEYSKTEIFQTLPVREPSPPSIHGQPGGGKSFKLSITKQDDGGAPILNYVVKYRSKDKEDQWLEKKF--LGN-KDYII-----------LDHLQWNVGYEVHIIATNRLGHS 663          

HSP 2 Score: 68.9366 bits (167), Expect = 3.957e-11
Identity = 122/579 (21.07%), Postives = 234/579 (40.41%), Query Frame = 1
Query:  487 HLIIKDFKPANNGIYKCD-TVQSNNKTPSK-INIIGN--PKVVIDSPRYQFIEEGKTGY-INCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSK-MI----NHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKA----SVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLP-NQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQ------PGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVM 2160
            +L IK+    + GIY+C+  V+   +   + I++I N  P+++     +    +      + C + G P+  + W   G+ L  +N K+   E++  L +  +     G Y+C+A     ++     + SF++V                 P +   ++ET I     E G++ + C++ G P P+ITW + S  MI    + + D R++ S  ++ +   S L I  V   D G Y C ++    G  +S+  NI     + P+F  I       S  +  +N+SC V    SN    S I+   +  +    N +    +++  +D          L I+ +   D G Y C A      R  +Y  L+   + S  Y   ++    T   +++ K          P+         Y +   + +    K + ++ T T  +I+L N   +    TYE       G  +   S ++ +Q      P  P+++       + +L +T   D GG P+ +Y ++++  +    +    +  N   I L HL+ N  Y++ + A +  G    T  E +
Sbjct:  158 NLQIKNISKRDEGIYRCEGRVEVRGEIDFRDISVIVNVPPEILAQQRSFNATADRLEDITLFCRATGSPKPYITWHRNGK-LVEENEKYDLREDNTELTVKNIISTDSGLYVCRA----TNKAGFTEKQSFLQVFV--------------QPHIVQLQNETTI-----EHGHVTLTCEAEGEPIPEITWKRSSDGMIFYDGDKSQDGRIE-STGHHGK---SSLHIKSVMLSDAGRYDCEAASRIGGHQKSMYLNIE----YAPKF--ISNQTIYYSWENNPINISCDV---TSN--PPSSIYWSRDKLLLPARNIT----NIKTYRDG-----KRILLEITPLSDNDFGRYNCTAINSIGSRIQEYI-LTLADVPSSPYGLRVIELSQTYAKVFFNK----------PDSHGGVPIHHYQMDFKEVSSEIWKVVRSHGTQT--IIVLGNLDANT---TYEVKVAAVNGKGKGEYSKTEIFQTLPVREPSPPSIHGQPGGGKSFKLSIT-KQDDGGAPILNYVVKYRSKDKEDQWLEKKFLGNKDYIILDHLQWNVGYEVHIIATNRLGHSEPTVFEFL 671          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Xenopus
Match: ncam2 (neural cell adhesion molecule 2 [Source:NCBI gene;Acc:100151722])

HSP 1 Score: 131.724 bits (330), Expect = 1.137e-30
Identity = 169/695 (24.32%), Postives = 289/695 (41.58%), Query Frame = 1
Query:  424 QTNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINI--IGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSP-DNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHY---TLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAP-NVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKD-----FEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVM-TKHLGRPVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQS 2466
            Q  KI     ++ + +GI+   L I      + GIY+C    S         +  I       D P  Q  + G+   + C     P   V W    E ++  D+ +F+ + N+  L+I  +++R  G Y C+  V          RG  I+   I VIV   PEI         Q+          ED  + + C + G P P ITW ++ K+        V+ +E Y  R   + L +  + + D G+Y C ++ +  GF+    +    +   QP  +++    N T++    V L+C   G            E      ++ ++  M  Y  +  QD       H+   +L I  +   DAG Y C+A+ R   +     +  +++ YAP+ + +  T+Y  W    + + C   + P  +  W+     LP + N   +KT    D     L I P   ND  FG Y C+A NS+G+  +    + A  P +P  + V +++ +  ++        GG+P+ HY+M FK+     ++V R  G        + I L +L  NT Y++ ++A +  G+G  +  E+  T  +  P    ++      KSF L      DGGAPI+ Y V  +  D +     K    +GN K+Y++           ++ L+ N  YE++  ATN  G S
Sbjct:   62 QGEKIISGQRVVVQREGIRS-WLTIYKANVDDAGIYRCQATDSKGHAQEATVVLEIYQKLTFEDVPSPQEFKRGENAEVLCLVSSSPAPMVRWLNNREDVTDIDDRRFAMLPNNN-LQIKNISKRDEGIYRCEGRVEV--------RGE-IDFRDISVIVNVPPEI-------LAQQRSFNATADRLED--ITLFCRATGSPKPYITWHRNGKL--------VEENEKYDLREDNTELTVKNIISTDSGLYVCRAT-NKAGFTE---KQSFLQVFVQPHIVQL---QNETTIEHGHVTLTCEAEG------------EPIPEITWKRSSDGMIFYDGDKSQDGRIESTGHHGKSSLHIKSVMLSDAGRYDCEAASRIGGH---QKSMYLNIEYAPKFI-SNQTIYYSWENNPINISCDVTSNPPSSIYWSRDKLLLPAR-NITNIKTY--RDGKRILLEITPLSDND--FGRYNCTAINSIGSRIQEYILTLADVPSSPYGLRVIELSQTYAKVFFNKPDSHGGVPIHHYQMDFKEVSSEIWKVVRSHG------TQTIIVLGNLDANTTYEVKVAAVNGKGKGEYSKTEIFQTLPVREPSPPSIHGQPGGGKSFKLSITKQDDGGAPILNYVVKYRSKDKEDQWLEKKF--LGN-KDYII-----------LDHLQWNVGYEVHIIATNRLGHS 680          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Xenopus
Match: ncam2 (neural cell adhesion molecule 2 [Source:NCBI gene;Acc:100151722])

HSP 1 Score: 131.339 bits (329), Expect = 1.696e-30
Identity = 161/662 (24.32%), Postives = 274/662 (41.39%), Query Frame = 1
Query:  523 GIYKCDTVQSNNKTPSKINI--IGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSP-DNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHY---TLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAP-NVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKD-----FEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVM-TKHLGRPVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQS 2466
            GIY+C    S         +  I       D P  Q  + G+   + C     P   V W    E ++  D+ +F+ + N+  L+I  +++R  G Y C+  V          RG  I+   I VIV   PEI     S               ED  + + C + G P P ITW ++ K++          +E Y  R   + L +  + + D G+Y C ++ +  GF+    +    +   QP  +++    N T++    V L+C   G            E      ++ ++  M  Y  +  QD       H+   +L I  +   DAG Y C+A+ R   +     +  +++ YAP+ + +  T+Y  W    + + C   + P  +  W+     LP + N   +KT    D     L I P   ND  FG Y C+A NS+G+  +    + A  P +P  + V +++ +  ++        GG+P+ HY+M FK+     ++V R  G        + I L +L  NT Y++ ++A +  G+G  +  E+  T  +  P    ++      KSF L      DGGAPI+ Y V  +  D +     K    +GN K+Y++           ++ L+ N  YE++  ATN  G S
Sbjct:  118 GIYRCQATDSKGHAQEATVVLEIYQKLTFEDVPSPQEFKRGENAEVLCLVSSSPAPMVRWLNNREDVTDIDDRRFAMLPNN-NLQIKNISKRDEGIYRCEGRVEV--------RGE-IDFRDISVIVNVPPEILAQQRSFNATADR-------LED--ITLFCRATGSPKPYITWHRNGKLVEE--------NEKYDLREDNTELTVKNIISTDSGLYVCRAT-NKAGFTE---KQSFLQVFVQPHIVQL---QNETTIEHGHVTLTCEAEG------------EPIPEITWKRSSDGMIFYDGDKSQDGRIESTGHHGKSSLHIKSVMLSDAGRYDCEAASRIGGH---QKSMYLNIEYAPKFI-SNQTIYYSWENNPINISCDVTSNPPSSIYWSRDKLLLPAR-NITNIKTY--RDGKRILLEITPLSDND--FGRYNCTAINSIGSRIQEYILTLADVPSSPYGLRVIELSQTYAKVFFNKPDSHGGVPIHHYQMDFKEVSSEIWKVVRSHG------TQTIIVLGNLDANTTYEVKVAAVNGKGKGEYSKTEIFQTLPVREPSPPSIHGQPGGGKSFKLSITKQDDGGAPILNYVVKYRSKDKEDQWLEKKF--LGN-KDYII-----------LDHLQWNVGYEVHIIATNRLGHS 704          

HSP 2 Score: 68.9366 bits (167), Expect = 3.457e-11
Identity = 123/582 (21.13%), Postives = 236/582 (40.55%), Query Frame = 1
Query:  487 HLIIKDFKPANNGIYKCD-TVQSNNKTPSK-INIIGN--PKVVIDSPRYQFIEEGKTGY-INCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSK-MI----NHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNAT---SLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKA----SVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLP-NQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQ------PGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVM 2160
            +L IK+    + GIY+C+  V+   +   + I++I N  P+++     +    +      + C + G P+  + W   G+ L  +N K+   E++  L +  +     G Y+C+A     ++     + SF++V                 P +   ++ET I     E G++ + C++ G P P+ITW + S  MI    + + D R++ S  ++ +   S L I  V   D G Y C ++    G  +S+  NI     + P+F+      N T   S  +  +N+SC V    SN    S I+   +  +    N +    +++  +D          L I+ +   D G Y C A      R  +Y  L+   + S  Y   ++    T   +++ K          P+         Y +   + +    K + ++ T T  +I+L N   +    TYE       G  +   S ++ +Q      P  P+++       + +L +T   D GG P+ +Y ++++  +    +    +  N   I L HL+ N  Y++ + A +  G    T  E +
Sbjct:  199 NLQIKNISKRDEGIYRCEGRVEVRGEIDFRDISVIVNVPPEILAQQRSFNATADRLEDITLFCRATGSPKPYITWHRNGK-LVEENEKYDLREDNTELTVKNIISTDSGLYVCRA----TNKAGFTEKQSFLQVFV--------------QPHIVQLQNETTI-----EHGHVTLTCEAEGEPIPEITWKRSSDGMIFYDGDKSQDGRIE-STGHHGK---SSLHIKSVMLSDAGRYDCEAASRIGGHQKSMYLNIE----YAPKFIS-----NQTIYYSWENNPINISCDV---TSN--PPSSIYWSRDKLLLPARNIT----NIKTYRDG-----KRILLEITPLSDNDFGRYNCTAINSIGSRIQEYI-LTLADVPSSPYGLRVIELSQTYAKVFFNK----------PDSHGGVPIHHYQMDFKEVSSEIWKVVRSHGTQT--IIVLGNLDANT---TYEVKVAAVNGKGKGEYSKTEIFQTLPVREPSPPSIHGQPGGGKSFKLSIT-KQDDGGAPILNYVVKYRSKDKEDQWLEKKFLGNKDYIILDHLQWNVGYEVHIIATNRLGHSEPTVFEFL 712          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Xenopus
Match: ncam2 (neural cell adhesion molecule 2 [Source:NCBI gene;Acc:100151722])

HSP 1 Score: 131.339 bits (329), Expect = 1.796e-30
Identity = 162/662 (24.47%), Postives = 276/662 (41.69%), Query Frame = 1
Query:  523 GIYKCDTVQSNNKTPSKINI--IGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSP-DNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHY---TLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAP-NVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKD-----FEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEV-MTKHLGRPVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQS 2466
            GIY+C    S         +  I       D P  Q  + G+   + C     P   V W    E ++  D+ +F+ + N+  L+I  +++R  G Y C+  V          RG  I+   I VIV   PEI         Q+          ED  + + C + G P P ITW ++ K+        V+ +E Y  R   + L +  + + D G+Y C ++ +  GF+    +    +   QP  +++    N T++    V L+C   G            E      ++ ++  M  Y  +  QD       H+   +L I  +   DAG Y C+A+ R   +     +  +++ YAP+ + +  T+Y  W    + + C   + P  +  W+     LP + N   +KT    D     L I P   ND  FG Y C+A NS+G+  +    + A  P +P  + V +++ +  ++        GG+P+ HY+M FK+     ++V R  G        + I L +L  NT Y++ ++A +  G+G  +  E+  T  +  P    ++      KSF L      DGGAPI+ Y V  +  D +     K    +GN K+Y++           ++ L+ N  YE++  ATN  G S
Sbjct:  118 GIYRCQATDSKGHAQEATVVLEIYQKLTFEDVPSPQEFKRGENAEVLCLVSSSPAPMVRWLNNREDVTDIDDRRFAMLPNNN-LQIKNISKRDEGIYRCEGRVEV--------RGE-IDFRDISVIVNVPPEI-------LAQQRSFNATADRLED--ITLFCRATGSPKPYITWHRNGKL--------VEENEKYDLREDNTELTVKNIISTDSGLYVCRAT-NKAGFTE---KQSFLQVFVQPHIVQL---QNETTIEHGHVTLTCEAEG------------EPIPEITWKRSSDGMIFYDGDKSQDGRIESTGHHGKSSLHIKSVMLSDAGRYDCEAASRIGGH---QKSMYLNIEYAPKFI-SNQTIYYSWENNPINISCDVTSNPPSSIYWSRDKLLLPAR-NITNIKTY--RDGKRILLEITPLSDND--FGRYNCTAINSIGSRIQEYILTLADVPSSPYGLRVIELSQTYAKVFFNKPDSHGGVPIHHYQMDFKEVSSEIWKVVRSHG------TQTIIVLGNLDANTTYEVKVAAVNGKGKGEYSKTEIFQTLPVREPSPPSIHGQPGGGKSFKLSITKQDDGGAPILNYVVKYRSKDKEDQWLEKKF--LGN-KDYII-----------LDHLQWNVGYEVHIIATNRLGHS 704          

HSP 2 Score: 68.5514 bits (166), Expect = 4.491e-11
Identity = 123/582 (21.13%), Postives = 236/582 (40.55%), Query Frame = 1
Query:  487 HLIIKDFKPANNGIYKCD-TVQSNNKTPSK-INIIGN--PKVVIDSPRYQFIEEGKTGY-INCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSK-MI----NHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNAT---SLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKA----SVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLP-NQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQ------PGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVM 2160
            +L IK+    + GIY+C+  V+   +   + I++I N  P+++     +    +      + C + G P+  + W   G+ L  +N K+   E++  L +  +     G Y+C+A     ++     + SF++V                 P +   ++ET I     E G++ + C++ G P P+ITW + S  MI    + + D R++ S  ++ +   S L I  V   D G Y C ++    G  +S+  NI     + P+F+      N T   S  +  +N+SC V    SN    S I+   +  +    N +    +++  +D          L I+ +   D G Y C A      R  +Y  L+   + S  Y   ++    T   +++ K          P+         Y +   + +    K + ++ T T  +I+L N   +    TYE       G  +   S ++ +Q      P  P+++       + +L +T   D GG P+ +Y ++++  +    +    +  N   I L HL+ N  Y++ + A +  G    T  E +
Sbjct:  199 NLQIKNISKRDEGIYRCEGRVEVRGEIDFRDISVIVNVPPEILAQQRSFNATADRLEDITLFCRATGSPKPYITWHRNGK-LVEENEKYDLREDNTELTVKNIISTDSGLYVCRA----TNKAGFTEKQSFLQVFV--------------QPHIVQLQNETTI-----EHGHVTLTCEAEGEPIPEITWKRSSDGMIFYDGDKSQDGRIE-STGHHGK---SSLHIKSVMLSDAGRYDCEAASRIGGHQKSMYLNIE----YAPKFIS-----NQTIYYSWENNPINISCDV---TSN--PPSSIYWSRDKLLLPARNIT----NIKTYRDG-----KRILLEITPLSDNDFGRYNCTAINSIGSRIQEYI-LTLADVPSSPYGLRVIELSQTYAKVFFNK----------PDSHGGVPIHHYQMDFKEVSSEIWKVVRSHGTQT--IIVLGNLDANT---TYEVKVAAVNGKGKGEYSKTEIFQTLPVREPSPPSIHGQPGGGKSFKLSIT-KQDDGGAPILNYVVKYRSKDKEDQWLEKKFLGNKDYIILDHLQWNVGYEVHIIATNRLGHSEPTVFEFL 712          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Xenopus
Match: ncam2 (neural cell adhesion molecule 2 [Source:NCBI gene;Acc:100151722])

HSP 1 Score: 129.798 bits (325), Expect = 4.555e-30
Identity = 162/661 (24.51%), Postives = 272/661 (41.15%), Query Frame = 1
Query:  523 GIYKCDTVQSNNKTPSKINI--IGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHY---TLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAP-NVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKD-----FEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVM-TKHLGRPVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQS 2466
            GIY+C    S         +  I       D P  Q  + G+   + C     P   V W         +N +F+ + N+  L+I  +++R  G Y C+  V          RG  I+   I VIV   PEI         Q+          ED  + + C + G P P ITW ++ K+        V+ +E Y  R   + L +  + + D G+Y C ++ +  GF+    +    +   QP  +++    N T++    V L+C   G            E      ++ ++  M  Y  +  QD       H+   +L I  +   DAG Y C+A+ R   +     +  +++ YAP+ + +  T+Y  W    + + C   + P  +  W+     LP + N   +KT    D     L I P   ND  FG Y C+A NS+G+  +    + A  P +P  + V +++ +  ++        GG+P+ HY+M FK+     ++V R  G        + I L +L  NT Y++ ++A +  G+G  +  E+  T  +  P    ++      KSF L      DGGAPI+ Y V  +  D +     K    +GN K+Y++ D            L+ N  YE++  ATN  G S
Sbjct:   69 GIYRCQATDSKGHAQEATVVLEIYQKLTFEDVPSPQEFKRGENAEVLCLVSSSPAPMVRWL--------NNRRFAMLPNN-NLQIKNISKRDEGIYRCEGRVEV--------RGE-IDFRDISVIVNVPPEI-------LAQQRSFNATADRLED--ITLFCRATGSPKPYITWHRNGKL--------VEENEKYDLREDNTELTVKNIISTDSGLYVCRAT-NKAGFTE---KQSFLQVFVQPHIVQLQ---NETTIEHGHVTLTCEAEG------------EPIPEITWKRSSDGMIFYDGDKSQDGRIESTGHHGKSSLHIKSVMLSDAGRYDCEAASRIGGH---QKSMYLNIEYAPKFI-SNQTIYYSWENNPINISCDVTSNPPSSIYWSRDKLLLPAR-NITNIKTYR--DGKRILLEITPLSDND--FGRYNCTAINSIGSRIQEYILTLADVPSSPYGLRVIELSQTYAKVFFNKPDSHGGVPIHHYQMDFKEVSSEIWKVVRSHG------TQTIIVLGNLDANTTYEVKVAAVNGKGKGEYSKTEIFQTLPVREPSPPSIHGQPGGGKSFKLSITKQDDGGAPILNYVVKYRSKDKEDQWLEKKF--LGN-KDYIILD-----------HLQWNVGYEVHIIATNRLGHS 646          

HSP 2 Score: 69.3218 bits (168), Expect = 2.520e-11
Identity = 120/578 (20.76%), Postives = 232/578 (40.14%), Query Frame = 1
Query:  490 LIIKDFKPANNGIYKCD-TVQSNNKTPSK-INIIGN--PKVVIDSPRYQFIEEGKTGY-INCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMI-----NHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKA----SVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLP-NQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQ------PGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVM 2160
            L IK+    + GIY+C+  V+   +   + I++I N  P+++     +    +      + C + G P+  + W   G+ L  +N K+   E++  L +  +     G Y+C+A     ++     + SF++V                 P +   ++ET I     E G++ + C++ G P P+ITW + S  +     + + D R++ S  ++ +   S L I  V   D G Y C ++    G  +S+  NI     + P+F  I       S  +  +N+SC V    SN    S I+   +  +    N +    +++  +D          L I+ +   D G Y C A      R  +Y  L+   + S  Y   ++    T   +++ K          P+         Y +   + +    K + ++ T T  +I+L N   +    TYE       G  +   S ++ +Q      P  P+++       + +L +T   D GG P+ +Y ++++  +    +    +  N   I L HL+ N  Y++ + A +  G    T  E +
Sbjct:  142 LQIKNISKRDEGIYRCEGRVEVRGEIDFRDISVIVNVPPEILAQQRSFNATADRLEDITLFCRATGSPKPYITWHRNGK-LVEENEKYDLREDNTELTVKNIISTDSGLYVCRA----TNKAGFTEKQSFLQVFV--------------QPHIVQLQNETTI-----EHGHVTLTCEAEGEPIPEITWKRSSDGMIFYDGDKSQDGRIE-STGHHGK---SSLHIKSVMLSDAGRYDCEAASRIGGHQKSMYLNIE----YAPKF--ISNQTIYYSWENNPINISCDV---TSN--PPSSIYWSRDKLLLPARNIT----NIKTYRDG-----KRILLEITPLSDNDFGRYNCTAINSIGSRIQEYI-LTLADVPSSPYGLRVIELSQTYAKVFFNK----------PDSHGGVPIHHYQMDFKEVSSEIWKVVRSHGTQT--IIVLGNLDANT---TYEVKVAAVNGKGKGEYSKTEIFQTLPVREPSPPSIHGQPGGGKSFKLSIT-KQDDGGAPILNYVVKYRSKDKEDQWLEKKFLGNKDYIILDHLQWNVGYEVHIIATNRLGHSEPTVFEFL 654          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Mouse
Match: Ncam2 (neural cell adhesion molecule 2 [Source:MGI Symbol;Acc:MGI:97282])

HSP 1 Score: 126.716 bits (317), Expect = 3.749e-29
Identity = 163/720 (22.64%), Postives = 295/720 (40.97%), Query Frame = 1
Query:  367 WYDPNMEPVVNYFTDPQKAQTNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGNPKVV----IDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLS--PDNHKFSFIENHQTL-----RISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSM-GKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPN-VNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKD-----FEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEV-MTKHLGRPVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQS 2466
            WY+P  E +++         T ++     ML K +G++   L I +    + GIY+C    +  +T     ++   + +    + SP  Q  ++G+   + C     P   V W +  E ++  PDN +F+ + N+        +  E   R  G+   + E+ F D               I VIV   P I      +  QKS      T      + + C + G P P I+WF++ K+I          +E Y  +   + L +  +  +D G Y C ++       +     +      QP  L++    N T+  +  V L C   G     +T        +  +F   +KS  G+  V+    +        +L I D+K  D+G Y C+A+ R   +    H   + + YAP+ + +  T+Y  W    + + C   A P  +  W  +   LP + N   +KT +       E  I P   ND  FG Y C+A N +G   +      A  P +P+ V + +++ +T ++        GG+P+ HY++  K+     +++ R  G        + + LS L+PNT Y++ ++A +  G+G  + IE+  T  +  P    ++   +  KSF +      DGGAPI+ Y V  +  D    ++  +  ++   K++++           +  L+    YE+  TA N  G S
Sbjct:   53 WYNPQGEKIIS---------TQRV-----MLQK-EGVRS-RLTIYNANIEDAGIYRCQATDAKGQTQEATVVLEIYQKLTFREVVSP--QEFKQGEDAEVVCRVSSSPAPAVSWLYHNEEVTTIPDN-RFAVLANNNLQILNINKSDEGIYRCEGRVEARGEIDFRD---------------IIVIVNVPPAI------MMPQKS---FNATAERGEEMTLTCKASGSPDPTISWFRNGKLIEE--------NEKYILKGSNTELTVRNIINKDGGSYVCKATNKAGEDQKQAFLQV----FVQPHILQLK---NETTSENGHVTLVCEAEGEPVPEIT---WKRAIDGVMFSEGDKSPDGRIEVKGQHGRS-------SLHIRDVKLSDSGRYDCEAASRIGGHQRSMH---LDIEYAPKFV-SNQTMYYSWEGNPINISCDVTANPPASIHWRREKLLLPAK-NTTHLKTHSVGRKMILE--IAPTSDND--FGRYNCTATNRIGTRFQEYILELADVPSSPHGVKIIELSQTTAKISFNKPESHGGVPIHHYQVDVKEVASETWKIVRSHGVQ------TMVVLSSLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKISITKQDDGGAPILEYIVKYRSKD---KEDQWLEKKVQGNKDHII-----------LEHLQWTMGYEVQITAANRLGYS 675          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Mouse
Match: Ncam2 (neural cell adhesion molecule 2 [Source:MGI Symbol;Acc:MGI:97282])

HSP 1 Score: 125.946 bits (315), Expect = 3.926e-29
Identity = 163/720 (22.64%), Postives = 296/720 (41.11%), Query Frame = 1
Query:  367 WYDPNMEPVVNYFTDPQKAQTNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGNPKVV----IDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLS--PDNHKFSFIENHQTL-----RISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSM-GKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPN-VNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKD-----FEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEV-MTKHLGRPVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQS 2466
            WY+P  E +++         T ++     ML K +G++   L I +    + GIY+C    +  +T     ++   + +    + SP  Q  ++G+   + C     P   V W +  E ++  PDN +F+ + N+        +  E   R  G+   + E+ F D               I VIV   P I      +  QKS      T      + + C + G P P I+WF++ K+I          +E Y  +   + L +  +  +D G Y C ++      +    +    +   QP  L++    N T+  +  V L C   G     +T        +  +F   +KS  G+  V+    +        +L I D+K  D+G Y C+A+ R   +    H   + + YAP+ + +  T+Y  W    + + C   A P  +  W  +   LP + N   +KT +       E  I P   ND  FG Y C+A N +G   +      A  P +P+ V + +++ +T ++        GG+P+ HY++  K+     +++ R  G        + + LS L+PNT Y++ ++A +  G+G  + IE+  T  +  P    ++   +  KSF +      DGGAPI+ Y V  +  D    ++  +  ++   K++++           +  L+    YE+  TA N  G S
Sbjct:   53 WYNPQGEKIIS---------TQRV-----MLQK-EGVRS-RLTIYNANIEDAGIYRCQATDAKGQTQEATVVLEIYQKLTFREVVSP--QEFKQGEDAEVVCRVSSSPAPAVSWLYHNEEVTTIPDN-RFAVLANNNLQILNINKSDEGIYRCEGRVEARGEIDFRD---------------IIVIVNVPPAI------MMPQKS---FNATAERGEEMTLTCKASGSPDPTISWFRNGKLIEE--------NEKYILKGSNTELTVRNIINKDGGSYVCKATNK----AGEDQKQAFLQVFVQPHILQLK---NETTSENGHVTLVCEAEGEPVPEITWK---RAIDGVMFSEGDKSPDGRIEVKGQHGRS-------SLHIRDVKLSDSGRYDCEAASRIGGHQRSMH---LDIEYAPKFV-SNQTMYYSWEGNPINISCDVTANPPASIHWRREKLLLPAK-NTTHLKTHSVGRKMILE--IAPTSDND--FGRYNCTATNRIGTRFQEYILELADVPSSPHGVKIIELSQTTAKISFNKPESHGGVPIHHYQVDVKEVASETWKIVRSHGVQ------TMVVLSSLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKISITKQDDGGAPILEYIVKYRSKD---KEDQWLEKKVQGNKDHII-----------LEHLQWTMGYEVQITAANRLGYS 675          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Mouse
Match: Ncam1 (neural cell adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:97281])

HSP 1 Score: 125.561 bits (314), Expect = 8.437e-29
Identity = 169/722 (23.41%), Postives = 289/722 (40.03%), Query Frame = 1
Query:  517 NNGIYKCD-TVQSNNKTPSKINIIGNPKVVI-DSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEH--LSPDNHKFSFIENHQTLR----ISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFG----AFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNP---STITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIE-----LVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRTLDEHALAKAEGLKQYYSEAAILMQSRLSLMMAVFLFLVLIHN 2619
            + GIYKC  T +   ++ + +N+    K++  ++P  Q  +EG+   I C         ++W  +G    L  D        N+  +R      E T R  G+ L + E++F D               I VIV   P         TVQ  ++ +  T     ++ + CD+ G P P ++W KD + I +      +  E +   +  S L I  V   D   Y C +         S+   +      +P+   +  N  A  L ++ V L+C   G    + + R +   I  +          +S  + S               +LT+  I+  DAG Y C A   S+     S +  + V YAP+ L     +Y  W    V + C+  AYP+ T  W F+D  L    N   +K  N    S S L + P+ +ND  FG Y C+A N +G         QA  P +P+++  +  +ST Q+       +GG+P+  Y+  +K          +Y          +T+  LKP TRY + L+A +  G G   +I   T+   +PV E     L      D  S  ++ +   DGG+PI  Y V  + +    +   K   R+ +  ++++           + SL  N  YE+   A N  G+S     +FRT  +     A G       A +   + + +++ +F+ L+++ +
Sbjct:   90 DAGIYKCVVTAEDGTQSEATVNVKIFQKLMFKNAPTPQEFKEGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKD---------------IQVIVNVPP---------TVQARQSIVNATANLGQSVTLVCDADGFPEPTMSWTKDGEPIEN----EEEDDEKHIFSDDSSELTIRNVDKNDEAEYVCIAENKAGEQDASIHLKV----FAKPKITYV-ENQTAMEL-EEQVTLTCEASGDPIPSITWRTSTRNISSEEKTLDGHMVVRSHARVS---------------SLTLKSIQYTDAGEYICTA---SNTIGQDSQSMYLEVQYAPK-LQGPVAVY-TWEGNQVNITCEVFAYPSATISW-FRDGQLLPSSNYSNIKIYNT--PSASYLEVTPDSEND--FGNYNCTAVNRIGQESLEFILVQADTPSSPSIDRVEPYSSTAQVQFDEPEATGGVPILKYKAEWKSLGEESWHFKWYDAKEANMEGIVTIMGLKPETRYSVRLAALNGKGLG---EISAATEFKTQPVREPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVKYRAL----ASEWKPEIRLPSGSDHVM-----------LKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANG----SPTAGLSTGAIVGILIVIFVLLLVVMD 730          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Mouse
Match: Ncam1 (neural cell adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:97281])

HSP 1 Score: 125.561 bits (314), Expect = 8.455e-29
Identity = 169/722 (23.41%), Postives = 288/722 (39.89%), Query Frame = 1
Query:  517 NNGIYKCD-TVQSNNKTPSKINIIGNPKVVI-DSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEH--LSPDNHKFSFIENHQTLR----ISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFG----AFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNP---STITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIE-----LVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRTLDEHALAKAEGLKQYYSEAAILMQSRLSLMMAVFLFLVLIHN 2619
            + GIYKC  T +   ++ + +N+    K++  ++P  Q  +EG+   I C         ++W  +G    L  D        N+  +R      E T R  G+ L + E++F D               I VIV   P         TVQ  ++ +  T     ++ + CD+ G P P ++W KD + I +      +  E +   +  S L I  V   D   Y C +         S+   +      +P+   +  N  A  L ++ V L+C   G    + + R +   I  +          +S  + S               +LT+  I+  DAG Y C A   S+     S +  + V YAP+ L     +Y  W    V + C+  AYP+ T  W F+D  L    N   +K  N    S S L + P+ +ND  FG Y C+A N +G         QA  P +P+++  +  +ST Q+       +GG+P+  Y+  +K          +Y          +T+  LKP TRY + L+A +  G G   +I   T+   +PV E     L      D  S  ++ +   DGG+PI  Y V  +      +   K   R+ +  ++++           + SL  N  YE+   A N  G+S     +FRT  +     A G       A +   + + +++ +F+ L+++ +
Sbjct:   90 DAGIYKCVVTAEDGTQSEATVNVKIFQKLMFKNAPTPQEFKEGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKD---------------IQVIVNVPP---------TVQARQSIVNATANLGQSVTLVCDADGFPEPTMSWTKDGEPIEN----EEEDDEKHIFSDDSSELTIRNVDKNDEAEYVCIAENKAGEQDASIHLKV----FAKPKITYV-ENQTAMEL-EEQVTLTCEASGDPIPSITWRTSTRNISSEEKTLDGHMVVRSHARVS---------------SLTLKSIQYTDAGEYICTA---SNTIGQDSQSMYLEVQYAPK-LQGPVAVY-TWEGNQVNITCEVFAYPSATISW-FRDGQLLPSSNYSNIKIYNT--PSASYLEVTPDSEND--FGNYNCTAVNRIGQESLEFILVQADTPSSPSIDRVEPYSSTAQVQFDEPEATGGVPILKYKAEWKSLGEESWHFKWYDAKEANMEGIVTIMGLKPETRYSVRLAALNGKGLG---EISAATEFKTQPVREPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVKYRAKL---ASEWKPEIRLPSGSDHVM-----------LKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANG----SPTAGLSTGAIVGILIVIFVLLLVVMD 731          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Mouse
Match: Ncam1 (neural cell adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:97281])

HSP 1 Score: 119.783 bits (299), Expect = 3.625e-27
Identity = 164/680 (24.12%), Postives = 271/680 (39.85%), Query Frame = 1
Query:  517 NNGIYKCD-TVQSNNKTPSKINIIGNPKVVI-DSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEH--LSPDNHKFSFIENHQTLR----ISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFG----AFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNP---STITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIE-----LVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRT 2493
            + GIYKC  T +   ++ + +N+    K++  ++P  Q  +EG+   I C         ++W  +G    L  D        N+  +R      E T R  G+ L + E++F D               I VIV   P         TVQ  ++ +  T     ++ + CD+ G P P ++W KD + I +      +  E +   +  S L I  V   D   Y C +         S+   +      +P+   +  N  A  L ++ V L+C   G    + + R +   I  +          +S  + S               +LT+  I+  DAG Y C A   S+     S +  + V YAP+ L     +Y  W    V + C+  AYP+ T  W F+D  L    N   +K  N    S S L + P+ +ND  FG Y C+A N +G         QA  P +P+++  +  +ST Q+       +GG+P+  Y+  +K          +Y          +T+  LKP TRY + L+A +  G G   +I   T+   +PV E     L      D  S  ++ +   DGG+PI  Y V  + +    +   K   R+ +  ++++           + SL  N  YE+   A N  G+S     +FRT
Sbjct:   90 DAGIYKCVVTAEDGTQSEATVNVKIFQKLMFKNAPTPQEFKEGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKD---------------IQVIVNVPP---------TVQARQSIVNATANLGQSVTLVCDADGFPEPTMSWTKDGEPIEN----EEEDDEKHIFSDDSSELTIRNVDKNDEAEYVCIAENKAGEQDASIHLKV----FAKPKITYV-ENQTAMEL-EEQVTLTCEASGDPIPSITWRTSTRNISSEEKTLDGHMVVRSHARVS---------------SLTLKSIQYTDAGEYICTA---SNTIGQDSQSMYLEVQYAPK-LQGPVAVY-TWEGNQVNITCEVFAYPSATISW-FRDGQLLPSSNYSNIKIYNT--PSASYLEVTPDSEND--FGNYNCTAVNRIGQESLEFILVQADTPSSPSIDRVEPYSSTAQVQFDEPEATGGVPILKYKAEWKSLGEESWHFKWYDAKEANMEGIVTIMGLKPETRYSVRLAALNGKGLG---EISAATEFKTQPVREPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVKYRAL----ASEWKPEIRLPSGSDHVM-----------LKSLDWNAEYEVYVVAENQQGKSKAAHFVFRT 692          
BLAST of Neural cell adhesion molecule 1 vs. UniProt/SwissProt
Match: sp|P22648|FAS2_SCHAM (Fasciclin-2 OS=Schistocerca americana OX=7009 GN=FAS2 PE=1 SV=2)

HSP 1 Score: 131.339 bits (329), Expect = 8.783e-30
Identity = 172/707 (24.33%), Postives = 284/707 (40.17%), Query Frame = 1
Query:  472 GIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGN--PKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPL-----PNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAP-NVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFK------DFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEV-MTKHLGRP----VIELVNSSTADSKS----------FNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRTLDE 2502
            G +V+ L+I + + A+ G Y C  + SN K  SK   +    P    D+P  Q+    +T  I C    +P   V W  +G  +   +    ++     L I  VTE   G Y C+A V    +         + + PI V V+  P++S   P     K E  ++GT F       +C + G P P+ TW +     + T D      +   +  +   L+I  V+ +D   Y+C +  +    + +    +    + +PR  +   N++  S  D    L C   G  S    V+F      N        +  + +V+ + D P+       L IS++   D G Y C A+   +K   +  NG + V + P    T       W +  V L C A + PN T  W F    L       +  Q       +   ST ++I      N  ++G Y+C+A N  G     I   +A  P A   V +  +TA+T+        + GGLP  +Y +++K      +  +NR      +PV+ S   L +LKP TRY    +A +E G G  +  +   T  +  P    ++ L  S+T+ +++          + L W V  D G PI  Y      V   P +      R+           GQ    F + SL+ +T Y++   ATN+ G S   ++I RT+ +
Sbjct:   92 GEKVLTLMIPELREADTGTYTCSALYSNTKQLSKSVHVRTIMPITWDDAPEEQYPTVNETFKIRCRVSANPPAIVNWMRDGHIVETGDR---YVVEQDGLTILNVTEMDDGTYTCRAIVIATGE---------MALRPIRVEVHTPPQMSGALPP----KLE-AVEGTDFT-----AKCAASGKPVPRYTWIRVDTARDLTKD-----GDRVSADVLLGELRIREVRPEDAANYSCTAKNA----AGTATATVEVTVVVRPRIGRF-DNISVASGKDSEAVLECHATG--SPLPAVTFRKLSNPNRYINGIQPTEDRITVDGV-DSPDGRTRIGKLIISNVLRSDDGLYECIAT---NKGGEVKKNGHLMVEFKPSFADTPQKEVWGWEQHAVNLTCLAHSIPNATISWHFNGADLFRGREGQELQQTGYTLFGSGPRSTLQVIPF----NRKMYGNYKCTATNKHGTAVHEIMLREARVPSAVLQVKMDVMTATTVTFKFFGPGNDGGLPTKNYAVQYKQDSQGWEDALNRT-----WPVD-SPYILENLKPQTRYNFRFAAQNEVGFGPWSSQQTHTTPRISAPEEPRLLGLPLSATSGTENEVVVSPYPNRYELRWQVPADNGEPITHY-----SVKSCPVEKYDTEWRLLPYPCQEHKLEGQ-ATTFQLESLQPDTHYKVEVRATNAIGNSVPGQIIVRTVKD 744          
BLAST of Neural cell adhesion molecule 1 vs. UniProt/SwissProt
Match: sp|P13596|NCAM1_RAT (Neural cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Ncam1 PE=1 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 1.779e-28
Identity = 170/724 (23.48%), Postives = 295/724 (40.75%), Query Frame = 1
Query:  517 NNGIYKCD-TVQSNNKTPSKINIIGNPKVVI-DSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEH--LSPDNHKFSFIENHQTLR----ISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYI---SHY---TLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNP---STITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIE-----LVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRTLDEHALAKAEGLKQYYSEAAILMQSRLSLMMAVFLFLVLIHN 2619
            + GIYKC  T +   ++ + +N+    K++  ++P  Q  +EG+   I C         ++W  +G    L  D        N+  +R      E T R  G+ L + E++F D               I VIV   P         TVQ  ++ +  T     ++ + CD+ G P P ++W KD + I +      +  E +   +  S L I  V   D   Y C +         S+   +      +P+   +  N  A  L ++ V L+C   G     +T       +  S    +++    ++    Q+  + ++   SH    +LT+  I+  DAG Y C AS   +     S +  + V YAP+ L     +Y  W    V + C+  AYP+ T  W F+D  L    N   +K  N    S S L + P+ +ND  FG Y C+A N +G         QA  P +P+++  +  +ST Q+       +GG+P+  Y+  +K          +Y          +T+  LKP TRY + L+A +  G G   +I   T+   +PV E     L      D  S  ++ +   DGG+PI  Y V  + +    +   K   R+ +  ++++           + SL  N  YE+   A N  G+S     +FRT  +     A G       A +   + + +++ +F+ L+++ +
Sbjct:   90 DAGIYKCVVTAEDGTQSEATVNVKIFQKLMFKNAPTPQEFKEGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKD---------------IQVIVNVPP---------TVQARQSIVNATANLGQSVTLVCDADGFPEPTMSWTKDGEPIEN----EEEDDEKHIFSDDSSELTIRNVDKNDEAEYVCIAENKAGEQDASIHLKV----FAKPKITYV-ENQTAMEL-EEQVTLTCEASGDPIPSIT-------WRTSTRNISSEEKASWTRPEKQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTAS---NTIGQDSQSMYLEVQYAPK-LQGPVAVY-TWEGNQVNITCEVFAYPSATISW-FRDGQLLPSSNYSNIKIYNT--PSASYLEVTPDSEND--FGNYNCTAVNRIGQESLEFILVQADTPSSPSIDRVEPYSSTAQVQFDEPEATGGVPILKYKAEWKSLGEEAWHSKWYDAKEANMEGIVTIMGLKPETRYAVRLAALNGKGLG---EISAATEFKTQPVREPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVKYRAL----ASEWKPEIRLPSGSDHVM-----------LKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANG----SPTAGLSTGAIVGILIVIFVLLLVVMD 740          
BLAST of Neural cell adhesion molecule 1 vs. UniProt/SwissProt
Match: sp|O35136|NCAM2_MOUSE (Neural cell adhesion molecule 2 OS=Mus musculus OX=10090 GN=Ncam2 PE=1 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 2.622e-28
Identity = 163/720 (22.64%), Postives = 295/720 (40.97%), Query Frame = 1
Query:  367 WYDPNMEPVVNYFTDPQKAQTNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGNPKVV----IDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLS--PDNHKFSFIENHQTL-----RISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSM-GKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPN-VNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKD-----FEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEV-MTKHLGRPVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQS 2466
            WY+P  E +++         T ++     ML K +G++   L I +    + GIY+C    +  +T     ++   + +    + SP  Q  ++G+   + C     P   V W +  E ++  PDN +F+ + N+        +  E   R  G+   + E+ F D               I VIV   P I      +  QKS      T      + + C + G P P I+WF++ K+I          +E Y  +   + L +  +  +D G Y C ++       +     +      QP  L++    N T+  +  V L C   G     +T        +  +F   +KS  G+  V+    +        +L I D+K  D+G Y C+A+ R   +    H   + + YAP+ + +  T+Y  W    + + C   A P  +  W  +   LP + N   +KT +       E  I P   ND  FG Y C+A N +G   +      A  P +P+ V + +++ +T ++        GG+P+ HY++  K+     +++ R  G        + + LS L+PNT Y++ ++A +  G+G  + IE+  T  +  P    ++   +  KSF +      DGGAPI+ Y V  +  D    ++  +  ++   K++++           +  L+    YE+  TA N  G S
Sbjct:   53 WYNPQGEKIIS---------TQRV-----MLQK-EGVRS-RLTIYNANIEDAGIYRCQATDAKGQTQEATVVLEIYQKLTFREVVSP--QEFKQGEDAEVVCRVSSSPAPAVSWLYHNEEVTTIPDN-RFAVLANNNLQILNINKSDEGIYRCEGRVEARGEIDFRD---------------IIVIVNVPPAI------MMPQKS---FNATAERGEEMTLTCKASGSPDPTISWFRNGKLIEE--------NEKYILKGSNTELTVRNIINKDGGSYVCKATNKAGEDQKQAFLQV----FVQPHILQLK---NETTSENGHVTLVCEAEGEPVPEIT---WKRAIDGVMFSEGDKSPDGRIEVKGQHGRS-------SLHIRDVKLSDSGRYDCEAASRIGGHQRSMH---LDIEYAPKFV-SNQTMYYSWEGNPINISCDVTANPPASIHWRREKLLLPAK-NTTHLKTHSVGRKMILE--IAPTSDND--FGRYNCTATNRIGTRFQEYILELADVPSSPHGVKIIELSQTTAKISFNKPESHGGVPIHHYQVDVKEVASETWKIVRSHGVQ------TMVVLSSLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKISITKQDDGGAPILEYIVKYRSKD---KEDQWLEKKVQGNKDHII-----------LEHLQWTMGYEVQITAANRLGYS 675          
BLAST of Neural cell adhesion molecule 1 vs. UniProt/SwissProt
Match: sp|P31836|NCAM1_BOVIN (Neural cell adhesion molecule 1 OS=Bos taurus OX=9913 GN=NCAM1 PE=1 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 2.035e-27
Identity = 167/694 (24.06%), Postives = 281/694 (40.49%), Query Frame = 1
Query:  517 NNGIYKCD-TVQSNNKTPSKINIIGNPKVVI-DSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEH--LSPDNHKFSFIENHQTLR----ISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYI---SHY---TLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPST----ITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIE-----LVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRTLDEHALAKAEG 2526
            + GIYKC  T +   ++ + +N+    K++  ++P  Q   EG+   I C         ++W  +G    L  D        N+  +R      E T R  G+ L + E++F D               I VIV   P         TVQ  ++ +  T     ++ + C++ G P P ++W KD + I +  D      E Y   +  S L I  V   D   Y C +         S+   +      +P+   +  N  A  L ++ V L+C   G     +T       +  S    +++    ++    Q+  + ++   SH    +LT+  I+  DAG Y C AS   +     S +  + V YAP+ L     +Y  W    V + C+  AYP+ T  W F+D  L    N   +K  N    S S L + P+ +ND  FG Y C+A N +G         QA  P +P+++  +  +ST Q+       +GG+P+  Y+  ++      V+   +Y    ++    +T+  LKP T Y + L+A +  G G   +I   ++   +PV E     L      D  S  +  +   DGG+PI  Y V  + +    S   K   R+ +  ++++           + SL  N  YE+   A N  G+S     +FRT  +     A G
Sbjct:   90 DAGIYKCVVTAEDGTESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLTNNYLQIRGIKKTDEGTYRCEGRILARGEINFKD---------------IQVIVNVPP---------TVQARQSIVNATANLGQSVTLVCNAEGFPEPTVSWTKDGEQIENEED------EKYLFSDDSSELTIRKVDKNDEAEYVCIAENKAGEQDASIHLKV----FAKPKITYV-ENQTAMEL-EEQVTLTCEASGDPIPSIT-------WRTSTRNISSEEKASWTRPEKQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYVCTAS---NTIGQDSQSMYLEVQYAPK-LQGPVAVY-TWEGNQVNITCEVFAYPSATISW-FRDGQLLPSSNYSNIKIYNT--PSASYLEVTPDSEND--FGNYNCTAVNRIGQESLEFVLVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAMG-EEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLG---EISAASEFKTQPVREPSAPKLEGQMGEDGNSIKVKLIKQDDGGSPIRHYLVKYRAL----SSEWKPEIRLPSGSDHVM-----------LKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANG 711          
BLAST of Neural cell adhesion molecule 1 vs. UniProt/SwissProt
Match: sp|O15394|NCAM2_HUMAN (Neural cell adhesion molecule 2 OS=Homo sapiens OX=9606 GN=NCAM2 PE=1 SV=2)

HSP 1 Score: 122.865 bits (307), Expect = 3.868e-27
Identity = 156/718 (21.73%), Postives = 290/718 (40.39%), Query Frame = 1
Query:  367 WYDPNMEPVVNYFTDPQKAQTNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGNPKVV----IDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSP-DNHKFSFIENHQTL-----RISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPS--VTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSM-GKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAP-NVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDF--EVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEV-MTKHLGRPVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQS 2466
            WY+P               Q  KI     ++ + +G++   L I +    + GIY+C    +  +T     ++   + +    + SP  Q  ++G+   + C     P   V W +  E ++   +++F+ + N+        +  E   R  G+   + E+ F D               I VIV   P IS    S   T ++ E            +   C + G P P I+WF++ K+I          +E Y  +   + L +  +   D G Y C ++       +     +      QP  +++    N T+  +  V L C   G     +T     + F    F   +KS+ G+  V+             +L I D+K  D+G Y C+A+ R   +     +  + + YAP+ + +  T+Y  W    + + C  K+ P  +  W      LP + N   +KT +       E  I P   ND  FG Y C+A N +G   +    + A  P +P  V + +++ +T ++        GG+P+ HY++  K+   E+ ++   +      + + L++L+PNT Y++ ++A +  G+G  + IE+  T  +  P    ++   +  KSF L      DGGAPI+ Y V  +  D    ++  +  ++   K++++           +  L+    YE+  TA N  G S
Sbjct:   53 WYNP---------------QGEKIISTQRVVVQKEGVRS-RLTIYNANIEDAGIYRCQATDAKGQTQEATVVLEIYQKLTFREVVSP--QEFKQGEDAEVVCRVSSSPAPAVSWLYHNEEVTTISDNRFAMLANNNLQILNINKSDEGIYRCEGRVEARGEIDFRD---------------IIVIVNVPPAISMPQKSFNATAERGE-----------EMTFSCRASGSPEPAISWFRNGKLIEE--------NEKYILKGSNTELTVRNIINSDGGPYVCRATNKAGEDEKQAFLQV----FVQPHIIQLK---NETTYENGQVTLVCDAEGEPIPEITWKRAVDGFT---FTEGDKSLDGRIEVKGQH-------GSSSLHIKDVKLSDSGRYDCEAASRIGGH---QKSMYLDIEYAPKFI-SNQTIYYSWEGNPINISCDVKSNPPASIHWRRDKLVLPAK-NTTNLKTYSTGRKMILE--IAPTSDND--FGRYNCTATNHIGTRFQEYILALADVPSSPYGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASEIWKIVRSHGVQ---TMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPILEYIVKYRSKD---KEDQWLEKKVQGNKDHII-----------LEHLQWTMGYEVQITAANRLGYS 675          
BLAST of Neural cell adhesion molecule 1 vs. TrEMBL
Match: Q1JUB6 (Cell adhesion molecule OS=Dugesia japonica OX=6161 GN=DjCAM PE=2 SV=1)

HSP 1 Score: 1171.38 bits (3029), Expect = 0.000e+0
Identity = 570/845 (67.46%), Postives = 684/845 (80.95%), Query Frame = 1
Query:   97 MIIHRNQIFILLNILVFN--FMNVESNKYSECENLPANSIKILDHKNEMKVWFGSEVSLTCCMKENLKFNDNSD-FYEDDFEIANSKNSPPLIWYDPNMEPVVNYFTDPQKAQTNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKS-MGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIELVNSSTA-DSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRTLDEHALAKAEGLKQYYSEAAILMQSRLSLMMAVFLFLVLIH 2616
            MI    Q+FI   IL FN   +NV+ +K+SECENL  NSIKIL+   E++VWFGSEVSLTCCMKEN K N+N++ ++EDDFE+ N K++ PL WYDP M P+VNYF+DP KAQ+  +F IPD+L K K IQVVHL+IK+F  ANNG+YKCDT++ N+ +P  IN++G+PK++ID+ +YQF+EEGKTGYI+C  RGHPRIDVVWF+EGEHLSPDNHKFSF++NHQ LRIS VTE FRGKYLCKAEVSF+++E+ PPRGSFIEV PI+VIVY++P IS DSPS+ VQK+E      ++ED  LEIECDSRGLPPP ITW++D  +IN  VD RV+I+ESYY RN YSVLKI+PVQ QDIGVYTCNSSYS HGFS+SVA+NITPEF+FQPRFLK GTNLNA +L  K+V L+CSVFGA S R +V+F+HED+N + +EY+  S    +  +M QD  N YISHY L I  I+P DAG YYCKA+V+++  F+ SH GIVSVLY  +I+PTKST+YGLWYKKN+LKCK+K YPNP WEW FQD+PLP QF QYR+KTIN NDTS SEL ILPN+ NDAIFGTY+C A+N  G+   TISFSQAWQPGAP V VCKVTASTIQLCVTPN+DSGGLPLTHYEMR KDF +N+ FGPYYYPVNPSTI LSHLK  TRYK++LSAASEAGRG NTDIEV TK +GRP+IELVN+S+A DSKSFNL WVVD+DGG PI RYDV VQQVDVDP D+ KII RIGN+K Y VDDL QFKQMFHVNSLKSNTWYEL F+A N  G S MQEV+FRTL+E ALA+AE L+Q    ++ L +  LS+++   L  + +H
Sbjct:    1 MINSYYQLFIF--ILTFNSKLLNVQPSKFSECENLQPNSIKILEQTKELRVWFGSEVSLTCCMKENPKLNNNNNNYFEDDFEVVNGKSTEPLAWYDPQMNPIVNYFSDPHKAQSTGMFYIPDLLQKPKDIQVVHLVIKNFSIANNGLYKCDTMR-NSHSPEMINLLGSPKIIIDADKYQFLEEGKTGYIDCRPRGHPRIDVVWFYEGEHLSPDNHKFSFLQNHQKLRISPVTEEFRGKYLCKAEVSFNERENAPPRGSFIEVQPIEVIVYQEPTISEDSPSIRVQKNENINDKAVYEDSVLEIECDSRGLPPPIITWYRDKLLINSKVDSRVKITESYYRRNAYSVLKIHPVQIQDIGVYTCNSSYSNHGFSKSVAKNITPEFVFQPRFLKTGTNLNANTLVGKNVILNCSVFGALSKRFSVAFVHEDYNYTTYEYSETSNKNTFKFQMTQDPSNSYISHYKLQILGIQPYDAGYYYCKATVKTETIFTFSHVGIVSVLYGAKIIPTKSTVYGLWYKKNILKCKSKGYPNPVWEWKFQDFPLPEQFKQYRIKTINKNDTSISELTILPNYLNDAIFGTYKCQAQNQFGSDSFTISFSQAWQPGAPYVTVCKVTASTIQLCVTPNTDSGGLPLTHYEMRIKDFNINKFFGPYYYPVNPSTIILSHLKSETRYKIALSAASEAGRGPNTDIEVTTKPIGRPIIELVNTSSAPDSKSFNLQWVVDSDGGLPIFRYDVQVQQVDVDP-DSKKIIERIGNIKTYKVDDLSQFKQMFHVNSLKSNTWYELKFSARNIMGPSIMQEVVFRTLEESALARAERLRQNIGSSSCLNKPTLSVIVVPLLLFIFLH 841          
BLAST of Neural cell adhesion molecule 1 vs. TrEMBL
Match: A0A068WLW9 (Cell adhesion molecule OS=Echinococcus granulosus OX=6210 GN=EgrG_000644850 PE=4 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 3.118e-51
Identity = 187/758 (24.67%), Postives = 317/758 (41.82%), Query Frame = 1
Query:  631 EEGKTGYINCTSRGHPRIDVVWF--FEGEHLSPD---------NHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSY-----HGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFS--NRLTVSFIHEDFNNSIFEYTNKSMG----------------------------------------KYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHN-----GIVSVLYAP-------------EILPTKS-----TLYGLWYKKNVLKCKAKAYPNPTWEWTFQDY-----PLPN----QFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIELVNS-STADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGN--VKNYMVDDLGQ-----FKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRT---LDEHALAKAEGLKQYYSEAAILMQSRLSLMMAVFLF 2601
             EG+   + C +RG+P   ++WF    G +L P          N      E    L ++E T     KYL   +V+ DDQ                  ++     +P + +++  K  T I+G      NL           P+ + F  +++   +V+  ++  ++       S L +  +   D   YTC +         HG    V  ++ P  I  P+F+  GT L AT    ++  L+C   G  S    L ++ +       + E    + G                                        +Y +    D  NPY +   LTI++++P+D   Y CKA    D + + + +     G +SV +AP              + P  S      +YGL +K + L+C++   P P W WT         P+      + + Y ++     + S SELI+   + +  IFG+Y C+A N LG     +    A  P  PNV  C V A+ ++LCV P  ++GGLPLTHYE+R +     R  GP+ Y      + L  L PN  YK +LSA + AGRG NT I+V T+ +G P ++L+ + S   S  + + W++++DGG+P+I Y + ++ V+       K +  +G+  V + +  D  +      + M+ + SL+  T YE+N    NS GQS    V+ +T   +        E + QY+   ++   +   +++A  L 
Sbjct:  385 REGEKMVLECAARGNPPPKLIWFKGGGGSNLPPPEGLAFLNDVNFDVGIREALNYLPLTEAT-----KYL-GTKVAEDDQ------------------LFPAIMEAPATNNLSDVKPLTDIEGA-----NLT----------PRESDFTGTRLDRFSVEAGLRKDDTGVPVIAVSRLIVDDLGVSDATRYTCLAQLDMEPLGGHGNWTDVG-SLLPSIILLPQFVAAGTKLYATGNPGENATLTCEALGGLSIPGGLQLTLLRGSGLKELAEQAISAKGSLPPSTLISDSPVESSTFAEEREKLPFSERIETILPDMDPRYHLIAGPDPKNPYAAMVRLTITNLRPEDNNYYVCKAQ-SGDNWIAYAPSPENALGRLSVWFAPPKAGPPPREGVTTTMAPGDSEGGWEVMYGLAHKPSRLECRSLGQPPPQWTWTGPAIRKVIDPVSAGEVIEADGYTVRAYQEGEESVSELILPAAYWSFGIFGSYSCTAENRLGKATGYVRLKLATHPQCPNVTACTVEATLVELCVIPPKETGGLPLTHYELRIQPSPNERFHGPFAYLPGRRVVRLPDLTPNHFYKFALSAVTSAGRGPNTYIQVETRKIGVPKLKLIATNSDVTSSDYLVRWILESDGGSPVIMYKIKIRPVEASWGPVQKHLTPLGSWTVFDVLSQDADRRTRHGVEGMYRIKSLQPGTSYEVNLVGQNSVGQSNPYVVVLQTSELIGTSGRLLGEPISQYFHGDSVRRVAYNLVLLAALLI 1101          
BLAST of Neural cell adhesion molecule 1 vs. TrEMBL
Match: A0A068Y9P3 (Cell adhesion molecule OS=Echinococcus multilocularis OX=6211 PE=4 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 1.262e-50
Identity = 159/616 (25.81%), Postives = 272/616 (44.16%), Query Frame = 1
Query: 1024 PKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSY-----HGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFS--NRLTVSFIHEDFNNSIFEYTNKSMGKYSVE-MIQDKP---------------------------------------NPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHN-----GIVSVLYAP--------EILPTKST----------LYGLWYKKNVLKCKAKAYPNPTWEWTFQDY-----PLPN----QFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIELVNS-STADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGN--VKNYMVDDLGQ-----FKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRT---LDEHALAKAEGLKQYYSEAAILMQSRLSLMMAVFLF 2601
            P+ + F ++++   +V+  ++  ++       S L +  +   D   YTC +         HG    V  ++ P  I  P+F+  GT L AT    ++  L+C   G  S    L ++ +       + E    + G +    +I D P                                       NPY +   LTI++++P+D   Y CKA    D + + + +     G +SV +AP        E + T +           +YGL +K + L+C++   P P W WT         P+      + + Y ++     + S SELI+   + +  IFG+Y C+A N LG     +    A  P  PNV  C V A+ ++LCV P  ++GGLPLTHYE+R +     R  GP+ Y      + L  L PN  YK +LSA + AGRG NT I+VMT+ +G P ++L+ + S   S  + + W++++DGG+P+I Y + ++ V+       K +  +G+  V + +  D  +      + M+ + SL+  T YE+N    NS GQS    V+ +T   +        E + QY+   ++   +   +++A  L 
Sbjct:  488 PRESDFTETRLDRFSVEAGLRKDDTGVPVIAVSRLIVDDLGVSDATRYTCLAQLDMEPLGGHGNWTDVG-SLLPSIILLPQFVAAGTKLYATGNPGENATLTCEALGGLSIPGGLQLTLLRGSGLKELAEQAISAKGSFPPSTLISDSPVESSTFAEERERLPFSERIETILPDMDPRYHLIAGPDPRNPYAAMVRLTITNLRPEDNNYYVCKAQ-SGDNWIAYAPSPENALGRLSVWFAPPKAGPPPREGVTTTTAPGDGEGGWEVMYGLAHKPSRLECRSLGQPPPQWTWTGPAIRKVIDPVSAGEVIEADGYTVRAHQEGEESVSELILPAAYWSFGIFGSYSCTAENRLGKATGYVRLKLATHPQCPNVTACTVEATLVELCVIPPKETGGLPLTHYELRIQPSPNERFHGPFAYLPGRRVVRLPDLTPNHFYKFALSAVTSAGRGPNTYIQVMTRKIGVPKLKLIATNSDVTSSDYLVRWILESDGGSPVIMYKIKIRPVEASWGPVQKHLTPLGSWTVFDVLSRDADRRTRHGVEGMYRIKSLQPGTSYEVNLVGQNSVGQSNPYVVVLQTSELIGTSGRLLGEPISQYFHGDSVRRVAYNLVLLAALLI 1101          
BLAST of Neural cell adhesion molecule 1 vs. TrEMBL
Match: A0A0X3NW22 (Fasciclin-2 (Fragment) OS=Schistocephalus solidus OX=70667 GN=FAS2 PE=4 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 2.077e-49
Identity = 134/441 (30.39%), Postives = 215/441 (48.75%), Query Frame = 1
Query: 1414 KYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHN-----GIVSVLYAPEI-------------LPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWT---FQDYPLPNQFNQ------YRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIELVNSSTADSKS-FNLHWVVDTDGGAPIIRYXXX---------XXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRTLDEHALAK---AEGLKQYYSEAAILMQS--RLSLMMAVFLFLVL 2610
            +Y +    D  NPY +   LTISD++P+D   Y C+A   S+ + +L+       G ++V +AP               L +   +YGL ++ + L+C+A   P P W WT    +    P    Q      Y ++     + S SEL +   + N  IFG+Y C+A N LG+    +    A  P  PNV  C V A+ ++LCV P  ++GGLPLTHYE+R +    +R  GP+ Y      + L  L PN  Y+ +LSA + AGRG NT ++V T  +G+P + LV S    S S + + W ++TDGG+P+I Y +            Q +  P       ++I + +   V   G  + +F +  L+  T YE++    NS GQS    V+FRT +    +     E + Q+   +A ++ S  R S+++A  L +++
Sbjct:  799 RYHLTAGPDPKNPYAAQIRLTISDLRPEDNNYYACEAESGSN-WVALAPPPDEALGRLTVWFAPPSAGPPMQRNPDTGDLISGDIMYGLAHRPSRLECRALGQPQPQWTWTGPAIRKTLPPASAGQTIESDGYLVRVHQEGEESVSELTLPAAYWNYGIFGSYACTATNRLGSSTGYVRLKLATHPHRPNVTACTVEATLVELCVIPPQETGGLPLTHYELRIQPHPKDRFHGPFAYLPGRRVVRLPDLTPNHFYRFALSAVTPAGRGPNTYLQVTTLKIGKPRLRLVASDRDVSTSDYTVRWELETDGGSPVILYTIKIRPIMTYWGAGQTESTPLAAWTEFDKIPSARTDTVTPRG-VEGIFKITGLQPGTAYEVSIVGQNSVGQSDPYVVLFRTSEIRGASGRLLGEPVSQHLHGSATVLCSLERPSILLASLLVILI 1237          

HSP 2 Score: 70.8626 bits (172), Expect = 1.908e-8
Identity = 51/246 (20.73%), Postives = 100/246 (40.65%), Query Frame = 1
Query:   76 YNNLLLQMIIHRNQIFILLNILVFNFMN----------VESNKYSECENLPANSIKILDHKNEMKVWFGSEVSLTCCMKENLKFNDNSDFYEDDFEIANSKNSPPLIWYDPNMEPVVNYFTDPQKAQTNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGNPKVVIDSPRYQFIEEGKTGYINCTS------------------RGHPR----IDVVWFFEGEHL 717
            Y+N ++Q+I     + +L  +L F  ++           +S+ Y  C N     + I     +  V  G  + LTCC+  N+  +D+                  L+W +P    ++NYF +  +A  +K + +PD   K +   +  L+++ F  A+ G YKC     +      + ++  P+++ D P  + ++E  +G  +  +                  R +P+    I V WF+ G  L
Sbjct:   28 YDNAMVQLIQCLVHVLLLAGLL-FGHIDFAQCWDSWDATQSDGY--CHN--PGKVSIAGGSQKRMVSEGGRIVLTCCLPGNVSGHDHEQ----------------LVWTNPKGHLIINYFANAGQASHSKAYAVPDFTEKNR--LMTRLVVRRFAEADTGNYKCSKGSESGVLSDAVYLMMRPRLLADFPALEHVQEDDSGASSVVTGHRVSVPLEEDTEGRLVCRTNPKFSGPIRVTWFYHGRQL 250          
BLAST of Neural cell adhesion molecule 1 vs. TrEMBL
Match: A0A267FRC5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019367g1 PE=4 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 7.613e-47
Identity = 188/806 (23.33%), Postives = 345/806 (42.80%), Query Frame = 1
Query:  238 KVWFGSEVSLTCCMKENLKFNDNSDFYEDDFEIANSKNSPPLIWYDPNMEPVVNYFTDPQKAQTNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGNPKVVIDSPRYQFIEEGKTGYINCTSR------GHPRIDVVWFFEGEHLSPD----NHKFSFIENHQTLRISEVTERFRGKYLCKAEV-----SFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRN---------VYSVLKIY---------PVQAQD------IGVYTCNSSYSYH--GFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEIL-PTKSTLYGLW-YKKNVLKCKAKAYPNPTWEWTFQDYPLP----NQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRK-TISFSQAWQPGAPNVNVCK--VTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPV-IELVNS-STADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPS-DNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEV-IFRT 2493
            +V+ G  + L+CC++ +            D  +        L+W  P+  PV ++      +  +  F++ D  +  +    + +  +     + GI+ C   ++      ++++    ++ + +P  Q++ +G  G   CTS           I + W+ E   + PD      +     N  TL ++   E   G Y C+  +       D Q         I+V  + + VY+ P I    P V        +QG   E   L    DSR  PP +I W    + I+ + DP      ++ SR            SVLK++         P +++D      +  + C ++ +    G   +  + +TP+ I++PR  +  + ++A++    S  LSC   GA +  + + F  E  +  +      +M   S  +++++ N   +   + I D++P D G Y C AS  S    + ++ G++ VLY P++L P++      W + + +L+C A+  P P   W     PLP       +         +D STS L + P      +FG Y C A N  G++    +   +A +PG P+V + K   T +++   + P  D+GG+ L  YE+ ++  +   + GP  + ++   IT+ +L+PNT YK+ ++A + AG G    I   T  L  P    LV    + D ++F L W V  +GG P+ RY + ++QV  +   DN  ++ R+    + +   L   +  + +  L     YE+     NS G S   EV +FRT
Sbjct:   53 RVFAGDRLLLSCCLRRS-----------RDSSVGG------LLWLAPDGSPVDHFSG--SSSSDDADFVLSDSADNGRLATALLVAPRASPERHAGIFVCKDEETGAAASLRVDVAR--RLRLTAPPVQWLRQGSDGKAVCTSAEPLPAANEASIQISWYRERRKI-PDVKAGGGRERVRSNGSTLLVTRALESDEGAYACQGRLPAIGADLDAQ---------IDVRVVQLRVYRKPRIL-RGPWVASAGGGKAVQGLTNEFACL---VDSR--PPAQIDWLIQGRPIDFS-DPASLSEIAFASRRDEKSDQRSPTKSVLKVFNFMGNGAGGPDESEDSAFLRPVPTFACRATLTIQEAGVLVTDTKELTPQVIYKPRITE-KSLMHASAAVGGSAALSCRAQGADAADIGLKFQRES-DGGVEADALTAMS--SRVLLKEEKNSSYAKLKMEIKDLQPSDGGRYTCIASTLSG---TATYTGLLEVLYPPQVLEPSQPAQRYTWQHHETLLRCSARGNPPPDITWQLNGVPLPLLDTPGVSATSEDVAKPSDASTSTLRVSPLAPGAPVFGRYVCLATNQFGSVESPAVLLLEARRPGTPDVIINKEESTPTSLAFAIVPPEDTGGVRLVGYELNYRVNDGPEI-GPAAFNLDDGRITIRYLQPNTNYKVYIAARNLAGVGGRASINYTTGELTPPTSFRLVEDFFSEDPRAFLLRWRVLNNGGLPVDRYRIRIRQVLAEAGPDNRPVVRRVLTGWHSLNPRLPPGQTAYRIERLLPGAHYEIQVRVGNSLGLSERSEVLVFRT 812          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Cavefish
Match: ncam2 (neural cell adhesion molecule 2 [Source:ZFIN;Acc:ZDB-GENE-010822-1])

HSP 1 Score: 126.716 bits (317), Expect = 2.777e-29
Identity = 160/708 (22.60%), Postives = 272/708 (38.42%), Query Frame = 1
Query:  361 LIWYDPNMEPVVNYFTDPQKAQTNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINI--IGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSM-GKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAP-NVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIE-VMTKHLGRPVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQS 2466
            L WY+P  E +V     P+ A  N+            G++   L + +    + GIY+C    +  +T     +  I       D P  Q   +G    + C     P   + W++    +  D  KF  + N+  L++  VT+   G Y C+A V          RG  I+   I ++V   P +S    S            T     ++   C + G P P +TW        H     +Q SE Y  R   + L I  ++  D G YTC +S      +  V + I  +   QP   K+    N T++   +  +SC   G     ++     + ++   F   +KS  G+  V   +           LTI  +   D G + C+A  R   +     +  + + YAP+   T  T++  W    V + C   + P  T  W      +P +     M+  N    S  E+  +    +D  FG Y C+ARN++G   +    +QA  P  P +V +  +   T  +        GG+P+ HY +R+KD   +       +  + + + L++L+PNT Y++ ++A +  G+G  +  E   T  +  P    V       K++ L  V   DGG PI+ Y                +  +    + +M   +        +  L+ NT YE+  TA N  G S
Sbjct:  166 LDWYNPQGERMV---PSPRVALHNE------------GVRS-RLTLYNANVEDAGIYRCQATDAQGQTQEATVVLEIYQKLTFRDVPSPQEFRQGDVAEVVCDVTSSPVPVIAWYYNNMEIFEDTEKFQLLSNN-NLQVQRVTKADEGVYRCEARVE--------ARGE-IDFRDIILVVNVPPVLSVPQQS---------FNATADYGESVTFTCRAYGSPEPDVTW--------HRKGVELQESEQYVMRARGTTLTIRNIKQDDGGSYTCKASNK----AGEVQQEIVLKVFVQPHITKL---RNVTAVEGSAAMISCKAEGEPLPDISWRRASDGYS---FSDGDKSPDGRVEVRGRR-------GESMLTIVGVGLSDWGRFDCEALSRIGGH---QKSMFLDIEYAPK-FQTNHTIFFSWEGNPVNISCDVMSNPPATMLWRRDKLTIPTE-GTANMRVHNAPGRSLLEVTPM----SDRDFGRYNCTARNNIGMRFQEFILAQADVPSNPYSVRLSSIAQRTATVTFMKPDSHGGVPIDHYLVRYKDISSHDWRDVQSHGTH-TIVLLTNLEPNTTYEVRVAAVNGKGQGEFSRTESFQTLPIREPSPPSVQGQRGVGKAYRLGLVKQDDGGMPILEYI---------------VKYKTDKEEQWMTKLVPGLNDFVVLQPLQWNTQYEVEITARNVKGLS 788          

HSP 2 Score: 59.6918 bits (143), Expect = 1.375e-8
Identity = 128/617 (20.75%), Postives = 236/617 (38.25%), Query Frame = 1
Query:  355 PPLIWYDPNMEPVVNYFTDPQKAQTNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDT-VQSNNKTPSK-INIIGNPKVVIDSPRYQF---IEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMI-----NHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNAT---SLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNND------TSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQ------PGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAG 2130
            P + WY  NME     F D +K Q         +L+        +L ++    A+ G+Y+C+  V++  +   + I ++ N   V+  P+  F    + G++    C + G P  DV W  +G  L  ++ ++       TL I  + +   G Y CKA             G   + + + V V          P +T  ++ T ++G+        I C + G P P I+W + S        + + D RV++      R   S+L I  V   D G + C +     G  +S+  +I     + P+F       N T   S     VN+SC V    SN         D      + T  + G  ++  + + P   +    L ++ +  +D G Y C A       F          + A   +P  S  Y +       +     +  P    +    P+ +   +Y  K I+++D        T  +++L N + +    TYE       G  +   S ++++Q      P  P+V   +      +L +    D GG+P+  Y +++K  +  +        +N   + L  L+ NT+Y++ ++A +  G
Sbjct:  259 PVIAWYYNNME----IFEDTEKFQ---------LLSNN------NLQVQRVTKADEGVYRCEARVEARGEIDFRDIILVVNVPPVLSVPQQSFNATADYGESVTFTCRAYGSPEPDVTWHRKGVELQ-ESEQYVMRARGTTLTIRNIKQDDGGSYTCKASNK---------AGEVQQEIVLKVFV---------QPHITKLRNVTAVEGSA-----AMISCKAEGEPLPDISWRRASDGYSFSDGDKSPDGRVEVR----GRRGESMLTIVGVGLSDWGRFDCEALSRIGGHQKSMFLDIE----YAPKF-----QTNHTIFFSWEGNPVNISCDV---MSNPPATMLWRRD------KLTIPTEGTANMR-VHNAPGRSL----LEVTPMSDRDFGRYNCTARNNIGMRFQ-------EFILAQADVP--SNPYSVRLSSIAQRTATVTFMKPD---SHGGVPIDHYLVRY--KDISSHDWRDVQSHGTHTIVLLTNLEPNT---TYEVRVAAVNGKGQGEFSRTESFQTLPIREPSPPSVQGQRGVGKAYRLGLV-KQDDGGMPILEYIVKYKTDKEEQWMTKLVPGLN-DFVVLQPLQWNTQYEVEITARNVKG 786          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Cavefish
Match: ncam2 (neural cell adhesion molecule 2 [Source:ZFIN;Acc:ZDB-GENE-010822-1])

HSP 1 Score: 126.331 bits (316), Expect = 3.461e-29
Identity = 161/708 (22.74%), Postives = 274/708 (38.70%), Query Frame = 1
Query:  361 LIWYDPNMEPVVNYFTDPQKAQTNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINI--IGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSM-GKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAP-NVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIE-VMTKHLGRPVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQS 2466
            L WY+P  E +V     P+ A  N+            G++   L + +    + GIY+C    +  +T     +  I       D P  Q   +G    + C     P   + W++    +  D  KF  + N+  L++  VT+   G Y C+A V          RG  I+   I ++V   P +S    S            T     ++   C + G P P +TW        H     +Q SE Y  R   + L I  ++  D G YTC +S      +  V + I  +   QP   K+    N T++   +  +SC   G     ++     + ++   F   +KS  G+  V   + +         LTI  +   D G + C+A  R   +     +  + + YAP+   T  T++  W    V + C   + P  T  W      +P +     M+   +N    S L + P   +D  FG Y C+ARN++G   +    +QA  P  P +V +  +   T  +        GG+P+ HY +R+KD   +       +  + + + L++L+PNT Y++ ++A +  G+G  +  E   T  +  P    V       K++ L  V   DGG PI+ Y                +  +    + +M   +        +  L+ NT YE+  TA N  G S
Sbjct:   69 LDWYNPQGERMV---PSPRVALHNE------------GVRS-RLTLYNANVEDAGIYRCQATDAQGQTQEATVVLEIYQKLTFRDVPSPQEFRQGDVAEVVCDVTSSPVPVIAWYYNNMEIFEDTEKFQLLSNN-NLQVQRVTKADEGVYRCEARVE--------ARGE-IDFRDIILVVNVPPVLSVPQQS---------FNATADYGESVTFTCRAYGSPEPDVTW--------HRKGVELQESEQYVMRARGTTLTIRNIKQDDGGSYTCKASNK----AGEVQQEIVLKVFVQPHITKL---RNVTAVEGSAAMISCKAEGEPLPDISWRRASDGYS---FSDGDKSPDGRVEVRGRRGES-------MLTIVGVGLSDWGRFDCEALSRIGGH---QKSMFLDIEYAPK-FQTNHTIFFSWEGNPVNISCDVMSNPPATMLWRRDKLTIPTE-GTANMRV--HNAPGRSLLEVTP--MSDRDFGRYNCTARNNIGMRFQEFILAQADVPSNPYSVRLSSIAQRTATVTFMKPDSHGGVPIDHYLVRYKDISSHDWRDVQSHGTH-TIVLLTNLEPNTTYEVRVAAVNGKGQGEFSRTESFQTLPIREPSPPSVQGQRGVGKAYRLGLVKQDDGGMPILEYI---------------VKYKTDKEEQWMTKLVPGLNDFVVLQPLQWNTQYEVEITARNVKGLS 691          

HSP 2 Score: 59.3066 bits (142), Expect = 1.828e-8
Identity = 128/617 (20.75%), Postives = 236/617 (38.25%), Query Frame = 1
Query:  355 PPLIWYDPNMEPVVNYFTDPQKAQTNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDT-VQSNNKTPSK-INIIGNPKVVIDSPRYQF---IEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMI-----NHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNAT---SLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNND------TSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQ------PGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAG 2130
            P + WY  NME     F D +K Q         +L+        +L ++    A+ G+Y+C+  V++  +   + I ++ N   V+  P+  F    + G++    C + G P  DV W  +G  L  ++ ++       TL I  + +   G Y CKA             G   + + + V V          P +T  ++ T ++G+        I C + G P P I+W + S        + + D RV++      R   S+L I  V   D G + C +     G  +S+  +I     + P+F       N T   S     VN+SC V    SN         D      + T  + G  ++  + + P   +    L ++ +  +D G Y C A       F          + A   +P  S  Y +       +     +  P    +    P+ +   +Y  K I+++D        T  +++L N + +    TYE       G  +   S ++++Q      P  P+V   +      +L +    D GG+P+  Y +++K  +  +        +N   + L  L+ NT+Y++ ++A +  G
Sbjct:  162 PVIAWYYNNME----IFEDTEKFQ---------LLSNN------NLQVQRVTKADEGVYRCEARVEARGEIDFRDIILVVNVPPVLSVPQQSFNATADYGESVTFTCRAYGSPEPDVTWHRKGVELQ-ESEQYVMRARGTTLTIRNIKQDDGGSYTCKAS---------NKAGEVQQEIVLKVFV---------QPHITKLRNVTAVEGSA-----AMISCKAEGEPLPDISWRRASDGYSFSDGDKSPDGRVEVR----GRRGESMLTIVGVGLSDWGRFDCEALSRIGGHQKSMFLDIE----YAPKF-----QTNHTIFFSWEGNPVNISCDV---MSNPPATMLWRRD------KLTIPTEGTANMR-VHNAPGRSL----LEVTPMSDRDFGRYNCTARNNIGMRFQ-------EFILAQADVP--SNPYSVRLSSIAQRTATVTFMKPD---SHGGVPIDHYLVRY--KDISSHDWRDVQSHGTHTIVLLTNLEPNT---TYEVRVAAVNGKGQGEFSRTESFQTLPIREPSPPSVQGQRGVGKAYRLGLV-KQDDGGMPILEYIVKYKTDKEEQWMTKLVPGLN-DFVVLQPLQWNTQYEVEITARNVKG 689          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Cavefish
Match: ncam2 (neural cell adhesion molecule 2 [Source:ZFIN;Acc:ZDB-GENE-010822-1])

HSP 1 Score: 126.331 bits (316), Expect = 3.663e-29
Identity = 160/708 (22.60%), Postives = 272/708 (38.42%), Query Frame = 1
Query:  361 LIWYDPNMEPVVNYFTDPQKAQTNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINI--IGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSM-GKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAP-NVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIE-VMTKHLGRPVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQS 2466
            L WY+P  E +V     P+ A  N+            G++   L + +    + GIY+C    +  +T     +  I       D P  Q   +G    + C     P   + W++    +  D  KF  + N+  L++  VT+   G Y C+A V          RG  I+   I ++V   P +S    S            T     ++   C + G P P +TW        H     +Q SE Y  R   + L I  ++  D G YTC +S      +  V + I  +   QP   K+    N T++   +  +SC   G     ++     + ++   F   +KS  G+  V   +           LTI  +   D G + C+A  R   +     +  + + YAP+   T  T++  W    V + C   + P  T  W      +P +     M+  N    S  E+  +    +D  FG Y C+ARN++G   +    +QA  P  P +V +  +   T  +        GG+P+ HY +R+KD   +       +  + + + L++L+PNT Y++ ++A +  G+G  +  E   T  +  P    V       K++ L  V   DGG PI+ Y                +  +    + +M   +        +  L+ NT YE+  TA N  G S
Sbjct:  166 LDWYNPQGERMV---PSPRVALHNE------------GVRS-RLTLYNANVEDAGIYRCQATDAQGQTQEATVVLEIYQKLTFRDVPSPQEFRQGDVAEVVCDVTSSPVPVIAWYYNNMEIFEDTEKFQLLSNN-NLQVQRVTKADEGVYRCEARVE--------ARGE-IDFRDIILVVNVPPVLSVPQQS---------FNATADYGESVTFTCRAYGSPEPDVTW--------HRKGVELQESEQYVMRARGTTLTIRNIKQDDGGSYTCKASNK----AGEVQQEIVLKVFVQPHITKL---RNVTAVEGSAAMISCKAEGEPLPDISWRRASDGYS---FSDGDKSPDGRVEVRGRR-------GESMLTIVGVGLSDWGRFDCEALSRIGGH---QKSMFLDIEYAPK-FQTNHTIFFSWEGNPVNISCDVMSNPPATMLWRRDKLTIPTE-GTANMRVHNAPGRSLLEVTPM----SDRDFGRYNCTARNNIGMRFQEFILAQADVPSNPYSVRLSSIAQRTATVTFMKPDSHGGVPIDHYLVRYKDISSHDWRDVQSHGTH-TIVLLTNLEPNTTYEVRVAAVNGKGQGEFSRTESFQTLPIREPSPPSVQGQRGVGKAYRLGLVKQDDGGMPILEYI---------------VKYKTDKEEQWMTKLVPGLNDFVVLQPLQWNTQYEVEITARNVKGLS 788          

HSP 2 Score: 59.6918 bits (143), Expect = 1.488e-8
Identity = 128/617 (20.75%), Postives = 236/617 (38.25%), Query Frame = 1
Query:  355 PPLIWYDPNMEPVVNYFTDPQKAQTNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDT-VQSNNKTPSK-INIIGNPKVVIDSPRYQF---IEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMI-----NHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNAT---SLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNND------TSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQ------PGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAG 2130
            P + WY  NME     F D +K Q         +L+        +L ++    A+ G+Y+C+  V++  +   + I ++ N   V+  P+  F    + G++    C + G P  DV W  +G  L  ++ ++       TL I  + +   G Y CKA             G   + + + V V          P +T  ++ T ++G+        I C + G P P I+W + S        + + D RV++      R   S+L I  V   D G + C +     G  +S+  +I     + P+F       N T   S     VN+SC V    SN         D      + T  + G  ++  + + P   +    L ++ +  +D G Y C A       F          + A   +P  S  Y +       +     +  P    +    P+ +   +Y  K I+++D        T  +++L N + +    TYE       G  +   S ++++Q      P  P+V   +      +L +    D GG+P+  Y +++K  +  +        +N   + L  L+ NT+Y++ ++A +  G
Sbjct:  259 PVIAWYYNNME----IFEDTEKFQ---------LLSNN------NLQVQRVTKADEGVYRCEARVEARGEIDFRDIILVVNVPPVLSVPQQSFNATADYGESVTFTCRAYGSPEPDVTWHRKGVELQ-ESEQYVMRARGTTLTIRNIKQDDGGSYTCKASNK---------AGEVQQEIVLKVFV---------QPHITKLRNVTAVEGSA-----AMISCKAEGEPLPDISWRRASDGYSFSDGDKSPDGRVEVR----GRRGESMLTIVGVGLSDWGRFDCEALSRIGGHQKSMFLDIE----YAPKF-----QTNHTIFFSWEGNPVNISCDV---MSNPPATMLWRRD------KLTIPTEGTANMR-VHNAPGRSL----LEVTPMSDRDFGRYNCTARNNIGMRFQ-------EFILAQADVP--SNPYSVRLSSIAQRTATVTFMKPD---SHGGVPIDHYLVRY--KDISSHDWRDVQSHGTHTIVLLTNLEPNT---TYEVRVAAVNGKGQGEFSRTESFQTLPIREPSPPSVQGQRGVGKAYRLGLV-KQDDGGMPILEYIVKYKTDKEEQWMTKLVPGLN-DFVVLQPLQWNTQYEVEITARNVKG 786          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Cavefish
Match: ncam1b (neural cell adhesion molecule 1b [Source:ZFIN;Acc:ZDB-GENE-010822-2])

HSP 1 Score: 124.405 bits (311), Expect = 1.613e-28
Identity = 162/649 (24.96%), Postives = 267/649 (41.14%), Query Frame = 1
Query:  607 DSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPR--FLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFE---------YTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNP-TWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFE----VNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRG-ANTDIEVMTKHLGRPV---IELVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRT 2493
            ++P  Q   EG    I C     P   V+W  +   +  +      I N+  L+I  + +   G Y C+  V    + D  P    + VLP                +V V+++E      +     L   CD  G P P + W +  +      D  ++  + Y      S + I  V+  D G YTC +S         V+  +      +PR  FL+   N  AT + ++ + L+C   G  +  +T S+    F     E         +T     K +  M+  + +  +S  TL  +     DAG Y C A    +     S +  + V YAP+IL + + +Y        + C+  A+P+  +  W    + LPN  N   +K  N    S S L + P+ QND  FG+Y C+A N +G   K     QA  P  P +   +  +ST QL       SGG+P+  Y   +K       V RV+      +N   IT++ LKP T+Y+  +SA +  G G +++ +   T+ +  P    +E +     +  +  ++WV   DGG+PI  Y ++  +   DP    +I  R+ +V  Y++           ++SL  NT YE+   A N  G+S    + FRT
Sbjct:   24 NAPSPQEFTEGDNAIIVCDVVSSPPPTVIWKHKRVKVQSEKDVRFKILNNNHLQIRGIKKTDEGVYNCEGRVMTRGEIDFRPIRVVVNVLP----------------TVRVRQAEVNATADLGLSAMLA--CDGDGFPEPTVMWKRSLRN-----DVLLESGDKYSFNEDGSEMTIMDVKKLDEGDYTCIASNKAGKAEEEVSLRV----FVKPRITFLE---NQTATEM-EEQMTLTCEATGDPTPTITWSYGTRTFTEGEQEHLKRIYQASWTRPEQHKSADGMVVVRSDARVSSLTLKYAQYT--DAGEYLCTAR---NAVGETSQHMYLEVHYAPKILGSVA-VYTWEGNPANISCETLAHPSEVSIVWLRDGFTLPNA-NTSNIKIYNT--PSASFLEVNPDSQND--FGSYNCTASNVIGTESKEFILIQAEVPSVPVITQVQPYSSTAQLLFDEPESSGGVPVLKYRAEWKAMNRNNWVQRVYEVREGGLN--AITITGLKPETQYEAKMSAINGKGEGESSSTVSFKTEPVREPTPPKLEAILQPKGN--ALRVNWVKQDDGGSPITHY-LIRYKAKEDPIWKPEI--RLPSVSEYVL-----------LSSLDWNTEYEVFVVAENQQGKSKPGILTFRT 612          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Cavefish
Match: ncam1b (neural cell adhesion molecule 1b [Source:ZFIN;Acc:ZDB-GENE-010822-2])

HSP 1 Score: 123.635 bits (309), Expect = 1.827e-28
Identity = 166/676 (24.56%), Postives = 275/676 (40.68%), Query Frame = 1
Query:  523 GIYKCDTVQSNNKTPSKINIIGNPKVVI-DSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPR--FLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVE-MIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNP-TWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKD----------FEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRG-ANTDIEVMTKHLGRPV---IELVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRT 2493
            G YKC     + +  + +N+    K+   ++P  Q   EG    I C     P   V+W  +   +  +      I N+  L+I  + +   G Y C+  V    + D  P    + VLP                +V V+++E      +     L   CD  G P P + W ++ +            +E        S + I  V+  D G YTC +S         V+  +      +PR  FL+   N  AT + ++ + L+C   G  +  +T S+    F            G+ S + M+  + +  +S  TL  +     DAG Y C A    +     S +  + V YAP+IL + + +Y        + C+  A+P+  +  W    + LPN  N   +K  N    S S L + P+ QND  FG+Y C+A N +G   K     QA  P  P +   +  +ST QL       SGG+P+  Y   +K           +EV       Y  +N   IT++ LKP T+Y+  +SA +  G G +++ +   T+ +  P    +E +     +  +  ++WV   DGG+PI  Y   + +   DP    +I  R+ +V  Y++           ++SL  NT YE+   A N  G+S    + FRT
Sbjct:   85 GTYKCVATSGDQQAEATVNVKIYQKIAFKNAPSPQEFTEGDNAIIVCDVVSSPPPTVIWKHKRVKVQSEKDVRFKILNNNHLQIRGIKKTDEGVYNCEGRVMTRGEIDFRPIRVVVNVLP----------------TVRVRQAEVNATADLGLSAMLA--CDGDGFPEPTVMWKREEEEEEEE-----GFNEDG------SEMTIMDVKKLDEGDYTCIASNKAGKAEEEVSLRV----FVKPRITFLE---NQTATEM-EEQMTLTCEATGDPTPTITWSYGTRTFTE----------GEQSADGMVVVRSDARVSSLTLKYAQYT--DAGEYLCTAR---NAVGETSQHMYLEVHYAPKILGSVA-VYTWEGNPANISCETLAHPSEVSIVWLRDGFTLPNA-NTSNIKIYNT--PSASFLEVNPDSQND--FGSYNCTASNVIGTESKEFILIQAEVPSVPVITQVQPYSSTAQLLFDEPESSGGVPVLKYRAEWKAMNRNNWVQRVYEVREGTSASYGGLN--AITITGLKPETQYEAKMSAINGKGEGESSSTVSFKTEPVREPTPPKLEAILQPKGN--ALRVNWVKQDDGGSPITHY---LIRYKADPIWKPEI--RLPSVSEYVL-----------LSSLDWNTEYEVFVVAENQQGKSKPGILTFRT 682          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008186.1 (pep scaffold:Pmarinus_7.0:GL476501:83598:168579:1 gene:ENSPMAG00000007342.1 transcript:ENSPMAT00000008186.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.679 bits (252), Expect = 5.554e-22
Identity = 155/647 (23.96%), Postives = 271/647 (41.89%), Query Frame = 1
Query:  355 PPLIWYDPNMEPVVNYFTDPQKAQTNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTP--SKINIIGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERF-RGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISP-DSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTC---NSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKAS--VRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPL-PNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKD----FEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRG-ANTDIEVMTKHLG--RPVIELVNSSTADSKSFNLHWVV 2244
            PP I +  + EP ++   D    + N I    D+          +L +   +  + G+Y+C    +  +    ++IN+ G+P   I   R      G+  Y++C   G+P   + W  EG  L P NH+ +   N  TLR+++V +    G Y+C   V    Q    P  S I      V V + P I P + P+VT        QG       + +  DS    P +ITW KD + +   +  +V+ +E   S  + +V +++       G YTC   N + +    S+ + R + P F+ QP+        +   +  K V L+CS  G    ++   +  +   N  F+      G++       +P   + + +L +  ++ +D G Y C+ S  V +D   S+  N  +  L   +   T +T      + + L+C A+        W  ++  + P +  +Y + T +  D   S L ILP  + D+ F  + C A NS G  R  I  +    P  P V V +V A TI L  T   D G  P+T +++ +K+    +E  +        +N +TI    L P T Y   + A +  G    + D+ + T+      P +E++    + S+S  + W V
Sbjct:  268 PPTIAWTLDGEPALSR--DAPHRRGNHIVTPGDVTG--------YLNVTGARVTDGGVYRCQAGNAAGQAEYQARINVRGSPS--IRPMRNVTAIAGREAYLHCRVIGYPYYSIRWLREGTPL-PYNHRQTVFANG-TLRLADVQKGMDEGAYICSVLV----QPGASPSRSLI------VTVKEPPLIQPFEMPAVT--------QGQRVYVPCVIVSGDS----PIRITWHKDGQPLPPRLGAQVETTEFISSLLIPNVTQLH------NGNYTCLARNEAATVSHGSQLIVR-VPPRFVVQPK--------DQDGIFGKPVVLNCSADGYPIPKIIWKY-SKGNGNPQFQPVLSGGGRF-------QP---LGNGSLLLRQVQEEDGGFYLCQVSNGVGTDISKSMLLNVKIPALVTSQANVTLATR----GQHSNLQCSARGERPIIIRWEKEETLIDPERMFRYVVYTQDTGDELLSTLQILPTVRGDSGF--FTCHAINSYGEDRGLIQLTVQEPPDPPEVEVREVNARTITLRWTSGFD-GNSPITAFDIEYKNRSDTWEQKQRTKDISSTINQATII--DLHPATHYVFRVYAKNRIGASEPSKDLPITTQEAAPDGPPLEVILEPQS-SQSIRVTWKV 842          

HSP 2 Score: 50.8322 bits (120), Expect = 1.753e-6
Identity = 68/294 (23.13%), Postives = 111/294 (37.76%), Query Frame = 1
Query: 1627 WYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNR-------VFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVI----ELVNSSTADSKSFNLH-WVVDTDGGAPI----IRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFG 2460
            W +   L C++   P P   WT +     +  +Q  +    +     +  ++L + + +   G Y C+A N+ G+    I+      P  P ++V K +AS+I L   P  ++GG PL  Y +++    V+R       V  P+          L  L+  T YK +L+A +  G G  ++I     H   P      ELV    A     NL  W    DGG PI    + Y           +  S ++            ++        +  L   TWY L   A N+ G
Sbjct: 1136 WMRDVELPCRSVGEPTPVVRWTKE-----SDTSQVAVPADEHGSFLPNGSLLLRSVRAED-SGDYSCTASNAWGSDALLITLLVQVPPDQPRLSVSKTSASSITLSWIPG-NNGGSPLRGYLLQYS---VDRSEQWEEMVISPHQ-----KRFALERLRCGTWYKFTLAARNVVGTGRISEIIEAKTHGREPHFVKDAELVLPMNASVVRVNLRGW---DDGGCPISSLALEYQPSGXAAGASSATWSPVL------------EMSDAAAPIMLAGLLEATWYRLRMRACNAAG 1399          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Sea Lamprey
Match: ncam1b (neural cell adhesion molecule 1b [Source:ZFIN;Acc:ZDB-GENE-010822-2])

HSP 1 Score: 90.8929 bits (224), Expect = 8.434e-19
Identity = 123/546 (22.53%), Postives = 218/546 (39.93%), Query Frame = 1
Query:  934 TVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFS-RSVARNITPEFIFQPRFLKIGTNLNA---------------TSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSM-GKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAP-NVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNP-----STITLSHLKPNTRYKLSLSAASEAGRGANTDIEVM-TKHLGRPVIELVNSSTADS-KSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRT 2493
            TV+  +  +  T     N  + C + G P P ITW                      +R+++ V+K  P +   +      S +  H  S R V + I  +   +     + TN ++               TS  ++ + L+C   G     +T   + +     +F    +++ G+  V         Y    +LT+ D++  DAG Y C A+    +  +  H   + V Y P+    K T Y  W    V + C+  A P     W+    P+P+         I ++    S L I P  Q+D  FG+Y C A N++ +  K     +A  P AP +V    V +++ ++ +     +GG+P+  Y +R +       +  YY+  +      +T+ +++L+PNT+Y   +SA +  G G  T   +  T+ +  P    V+ S   +  S+ + WV   DGG+PI  Y                + +R+     ++        +   ++SLK NT YE++  A N  G S   E  F T
Sbjct:  100 TVRVRQNAVNATADRGENARLVCTADGFPEPIITW----------------------TRSIHPVMKSSPERDGHL------SQHPGHSVSHRDVPKKIKGDMGDK-EATNVQTNFHSLYFLKPEITYLENKTTSELEEQIVLTCESEGEPLPTITWRRVSDQH---VFRQGQQTLEGRIEVRS-------YAKVSSLTLRDVQYTDAGEYMCIANNNVGQASAAMH---LDVAYGPKFAGEKVT-YHSWPNNAVNVTCEVLANPKAAVSWSRDGQPIPSA---NLTNVIVHSFPGFSVLEITPESQSD--FGSYNCVAVNNIASESKEFVLVEAALPSAPQSVKATAVYSTSAEITLEEPDYTGGVPILTYTVRVRPANGLSEWTSYYFGGSEIWNYENTVKVTNLEPNTQYMAEVSARNGVGDGPFTKPTLFYTEPIREPSPPKVHGSVGSTGNSYVISWVSQDDGGSPIQHYL---------------VKHRVDGSAEWLEQRAPSTSKHAMLSSLKWNTEYEVHVRAINKEGDSDPAEHRFTT 582          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Sea Lamprey
Match: igdcc3 (immunoglobulin superfamily, DCC subclass, member 3 [Source:ZFIN;Acc:ZDB-GENE-080303-24])

HSP 1 Score: 68.5514 bits (166), Expect = 4.515e-12
Identity = 129/569 (22.67%), Postives = 210/569 (36.91%), Query Frame = 1
Query:  604 IDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKF---------SFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSV--ARNITPEFIFQ----PRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAP----NVNVCKVTASTIQLCVTP--NSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPSTI--TLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGR-PVIELVNSSTADSKSFNLHW 2238
            ++ P+      G+   ++C + G   I V W  +G  L P  H           SF  +      S+      G+Y C A+  F            +      V+    P  S     V V+           E G    +C     P P +TW K+   +    D         Y+     VL+I  V+ +D G + C +S +  G  RS+     +TP    +    P  L    NL  T    ++  L C   G  + R  VS+   D          + +G   VE IQ      +    L ISD+  Q AG Y C A+ R       +  G + V   PE +    ++        VL C A+  P+P   W     PL +Q  + R++  N N T T + +   +       G Y+C+A NS G  + +   +     G P    ++ V   +A+ ++L       +  G +    +  R +D E       Y   V+ +T+  T+  L+P+T Y   + A S  G    +D  V  + LG  P +  + +   +S +  L W
Sbjct:    6 LEEPQDTVGVRGQPLALSCRAEGVRPIAVSWRRDGVALDPATHALLPNGSLYIPSFRRSAGGREGSD-----EGEYDCTAQNRF----------GLLLSRRARVLASTLPRFSQHPQPVVVE-----------EGGVARFQCLINARPDPLVTWEKNRTALTEDDD--------RYTFLPSGVLQITGVRPEDSGYFRCIAS-NVAGRRRSMDALLTVTPAVPAKSSKDPVILSGPQNLTLT--VHQTAILECIATG--NPRPIVSWSRLD---------GRPIG---VEGIQ-----VVGTGNLMISDVAVQHAGVYVCAAN-RPGTRVRRTAQGRLIVQAPPEFMQPPQSVTRSLGASAVLTCSAQGTPSPRIIWLHNGLPL-HQSERVRLQ--NGNSTLTIQRVCSED------EGIYQCTAENSAGYTQASARLAVLGSDGLPGPPWDLRVRATSATAVELAWREPLQNPHGVIGYVLHIRRAQDSEDQE----YQEAVSQTTVQHTVLELEPSTHYTFYVKAYSSGGASQPSDY-VTAETLGEVPAVPALFTRILNSSAVQLSW 503          

HSP 2 Score: 50.8322 bits (120), Expect = 1.268e-6
Identity = 55/254 (21.65%), Postives = 97/254 (38.19%), Query Frame = 1
Query:  490 LIIKDFKPANNGIYKCDTVQSNNK----------TPSKINIIGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVW-FFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVAR 1218
            L I   +P ++G ++C       +          TP+         V++  P+   +   +T  + C + G+PR  V W   +G  +  +  +     N   L IS+V  +  G Y+C A           P           +IV   PE      SVT     + +           + C ++G P P+I W  +   ++ +   R+Q        N  S L I  V ++D G+Y C +  S  G++++ AR
Sbjct:  155 LQITGVRPEDSGYFRCIASNVAGRRRSMDALLTVTPAVPAKSSKDPVILSGPQNLTLTVHQTAILECIATGNPRPIVSWSRLDGRPIGVEGIQVVGTGN---LMISDVAVQHAGVYVCAANR---------PGTRVRRTAQGRLIVQAPPEFMQPPQSVTRSLGASAV-----------LTCSAQGTPSPRIIWLHNGLPLHQSERVRLQ--------NGNSTLTIQRVCSEDEGIYQCTAENSA-GYTQASAR 376          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002502.1 (pep scaffold:Pmarinus_7.0:GL476400:249000:366561:-1 gene:ENSPMAG00000002253.1 transcript:ENSPMAT00000002502.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 3.435e-11
Identity = 115/530 (21.70%), Postives = 201/530 (37.92%), Query Frame = 1
Query:  481 VVHLIIKDFKPANNGIYKCD--------------TVQSNNKTPSKINIIGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEG-EHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQP-RFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVN-VCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVN 2019
            +  L I      ++GIY C               TV+     PS +  +     ++ S          T  ++C   G   I V W   G E +  D ++  F EN  +L I +V +   G Y C A        ++  R S    L I         I P S  + ++  E      +        +C   G  P  + W+K ++ +      R  IS S   R+  ++L +  V+    G Y+C  S S    S S +      F+ +P +F    ++L+  +    S +  CS  G  + ++ V++  ED  N I      +  K+ V  ++          TL I   +  D+G+Y CK    S +    +   ++ VL  P  + +   + G +      +C+    P     W    Y    + +  + KT+  ++T+  E+    NF+  A  GTY C A NSLG+ + + S +   +   P+ + + K     I  C   ++   G P  H      D E++
Sbjct: 6303 IARLTILKVGKLDSGIYTCAASNDVGSDVTSTEITVKDQAVPPSFVRKLKKTDAILHS----------TAQMDCRVAGTVPILVAWSKNGVEIVDGDKYRCLFEENTASLEILKVDKSDDGSYTCTAT-------NVAGRDSCSTTLSI---------IEPPSFLMKMEPQE------VLSGSRATFQCAVSGTEPLLVKWYKGNQEL------RTDISHSISFRDSVALLIVEKVKLAFAGEYSCQVSNSAGKTSCSASL-----FVKEPAKFFSKPSDLDVKA--GDSASFICSFVG--TPKIAVNWYKED--NQIV-----AGHKFQVTTVE-------GQSTLDILATEISDSGNYTCKIQNDSGQD---NCTALLKVLDPPYFVKSLEPMEGTFGTSVYFECQVAGAPEIRVTW----YKGSQKLSGAKYKTMFQHNTAVLEV---KNFEK-ADVGTYSCEAENSLGSAKTSASLAGKERKHPPSFSRMLKNMQQVIGDCAKFDARVTGTPPFHVSWFLGDSELS 6760          

HSP 2 Score: 63.1586 bits (152), Expect = 3.264e-10
Identity = 69/300 (23.00%), Postives = 121/300 (40.33%), Query Frame = 1
Query:  628 IEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPD-NHKFSFIENHQTLRISEVTERFRGKYLCKA--EVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFI---FQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGS 1509
            +  G+   + C   G P   + W  + + + P  N+KFSF++N   L I +  +R  G Y+C+A  E  +D               P+ +   K+  ++P     T  +    +  T  E    E+EC   G  P K+TW KD++ I    + R+   E+     +  V K+      D G+YTC +S        S    +  + +   F  +  K    L++T+  D  V  +  +  A+S    V  +  D    +FE    S+    V+   D        YT T +++  +D+ S
Sbjct: 6164 VTAGEPADLGCHVTGSPPFKISWLKDNKEIRPGTNYKFSFVDNTPLLTILKTDKRDSGVYVCRAANEAGYD-----------TSCAPVTI---KERRVAP-----TFDQKLESLNVTTGE--RAELECHVTGSVPIKVTWAKDNREIRAAGNYRMIFMENIARLTILKVGKL------DSGIYTCAASNDVGSDVTSTEITVKDQAVPPSFVRKLKKTDAILHSTAQMDCRVAGTVPILVAWSKN-GVEIVDGDKYRCLFEENTASLEILKVDKSDD------GSYTCTATNVAGRDSCS 6429          

HSP 3 Score: 60.4622 bits (145), Expect = 2.194e-9
Identity = 81/352 (23.01%), Postives = 137/352 (38.92%), Query Frame = 1
Query:  481 VVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINI-IGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSF--IENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKAS 1527
            V  LI++  K A  G Y C    S  KT    ++ +  P      P    ++ G +    C+  G P+I V W+ E   +    HKF    +E   TL I        G Y CK  +  D  +D     + ++VL              D P     KS   ++GT     ++  EC   G P  ++TW+K S+ ++          ++ +  N  +VL++   +  D+G Y+C +  S  G +++ A     E    P F ++  N+       + V   C+ F A         +     +S   Y++K +  +   +            +L+I  +K  DAG Y CK S
Sbjct: 6492 VALLIVEKVKLAFAGEYSCQVSNSAGKTSCSASLFVKEPAKFFSKPSDLDVKAGDSASFICSFVGTPKIAVNWYKEDNQIVA-GHKFQVTTVEGQSTLDILATEISDSGNYTCK--IQNDSGQDNCT--ALLKVL--------------DPPYFV--KSLEPMEGTF--GTSVYFECQVAGAPEIRVTWYKGSQKLSGAK------YKTMFQHNT-AVLEVKNFEKADVGTYSCEAENSL-GSAKTSASLAGKERKHPPSFSRMLKNM-------QQVIGDCAKFDARVTGTPPFHVSWFLGDSELSYSDKHVISFEDNVA-----------SLSIFSLKVSDAGEYTCKVS 6794          

HSP 4 Score: 60.4622 bits (145), Expect = 2.448e-9
Identity = 83/346 (23.99%), Postives = 134/346 (38.73%), Query Frame = 1
Query:  514 ANNGIYKCDTVQSNNKTPSKINIIGN--PKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHL-SPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQ-KSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCN-----SSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKA 1524
            ++ GIY C  +Q+     S +  +    P   I       I  G T ++ C   G P+I V W+   + L S D  K +F  N  TL +  +T+   G Y CKAE  F         GS   +  + V   K+P      P  T + K    ++GT         +C   G PP    W+K    ++   D  +   E+       + L I+ V+    G YTC       S S      +  + + P F  +P  +++           +S  L C + G  S  + +S++    N  I     +S+G Y +         Y +   LT+     +D+G+Y CKA
Sbjct: 5470 SDEGIYTCK-IQNEAGEDSCLATLATLEPPNFIKGLEPTEIVVGSTVHLECQVAGTPQIRVSWYKGSQKLKSGDKCKMAFKNNLATLELRSLTKADTGDYSCKAENDF---------GSATSLASLSVSERKNP------PYFTRKLKDWQAVEGTA-----ATFDCRVTGTPPFSFIWYKHGVELSSGEDYVISAEEN------VATLDIHNVKLTHAGEYTCRVFNDVDSASCSAKLEAKDKKVPPSFEKKPDPVEVTAG--------ESFELECLIAG--SRPIRISWLKN--NREI-----RSVGNYKLFF-------YDNAARLTVLKAGKEDSGTYVCKA 5764          

HSP 5 Score: 52.373 bits (124), Expect = 6.065e-7
Identity = 98/423 (23.17%), Postives = 156/423 (36.88%), Query Frame = 1
Query:  637 GKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFI--ENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNL-----------EIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTC---NSSYSYHGFSR--SVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGN 1851
            G T   NCT  G P I V WF + E L  D+ KF  +      +L +  +T      Y C+  +S +  ED       ++    + +     E    S +  +   E  +  T   D  L           E EC   G  P KITW K++K I    + R+   ++         L +      + GVYTC   N + S H  ++     R I P+F  +   L++   L+A        +  C V G+   R+T +  + D          +S G Y    + +      +H T+  +D    D G+Y CKA+  +      +   +     AP  +    T          L+CK       +  W F+      Q  +Y+M  + N  T    L I     +DA   +Y C A N  G+
Sbjct: 4918 GDTASFNCTFTGTPEITVRWFRKDEELQ-DSDKFKIVTTATSSSLEVLNITSDDVKPYSCR--ISNEAGEDSCINSLSVQADAGEYVCTAANEAGTSSCNANLIVKERKVAPTF--DQKLQPVEVTAGDPSEFECHVTGSLPIKITWSKNNKEIRSGGNYRITFLDNTPR------LIVMKTDRSEGGVYTCKATNETGSDHCSTQLEVKERTIPPDFDEKLESLEVTAGLSA--------DFECHVTGSAPFRVTWTKDNRDI---------RSGGNYKFTFLDN-----TAHLTILKAD--KGDIGTYTCKAANAAGSAACTADLSVKDRPVAPSFVRKLKTTDAALSSTAHLECKLSGSVPISVVW-FKGSEEIAQGERYKMTFVENVAT----LEIQKVVASDAF--SYTCKATNVSGS 5298          

HSP 6 Score: 50.0618 bits (118), Expect = 3.189e-6
Identity = 96/425 (22.59%), Postives = 152/425 (35.76%), Query Frame = 1
Query:  643 TGYINCTSRGHPRIDVVWFFEGEHLSP-DNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFG-AFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEIL----PTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAP 1899
            T ++ C   G   I VVWF   E ++  + +K +F+EN  TL I +V       Y CKA              S  E    D+ V     I P S + TV+         +    ++E +    G  P  + WF+D   +      ++         N  + LK+  V A   GVY+C  S +    S + + N+T   +   R      N        +  N   +VF  +FS    +       NN I E       KY V + +          TL + ++   D G Y CK    + +   L+    ++ L  P  +    PT+  +    +    L+C+    P     W      L +     + K    N+ +T EL  L      A  G Y C A N  G+     S S + +   P
Sbjct: 5234 TAHLECKLSGSVPISVVWFKGSEEIAQGERYKMTFVENVATLEIQKVVASDAFSYTCKA-----------TNVSGSEASTADLKV-----IEPPSFTKTVESQH------VVPGASVEFKSSVSGTEPLTVKWFRDDNELMSGRRCKITF------LNGVATLKLDDVDAASAGVYSCQVSNA--AASETCSANLT---VKAER-----ANFRRRVKDSQVSNGETAVFSTSFSGTPEIVVFWYKQNNLIEES-----DKYRVAISE-------GESTLEVLNVDKSDEGIYTCKIQNEAGEDSCLA---TLATLEPPNFIKGLEPTEIVVGSTVH----LECQVAGTPQIRVSWYKGSQKLKSG---DKCKMAFKNNLATLELRSL----TKADTGDYSCKAENDFGSATSLASLSVSERKNPP 5594          

HSP 7 Score: 49.6766 bits (117), Expect = 4.247e-6
Identity = 85/363 (23.42%), Postives = 133/363 (36.64%), Query Frame = 1
Query:  490 LIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGNPKVVIDSPRYQFIEE------GKTGYINCTSRGHPRIDVVWFFEGEHLS-PDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYK-----DPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTC------NSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKA 1524
            L +K+F+ A+ G Y C+   S     +  ++ G  +     P +  + +      G     +    G P   V WF     LS  D H  SF +N  +L I  +     G+Y CK  VS +D       GS      +DV   K     D ++ P             ++  + +    E+EC   G  P KI W KD K I     P      +++    +  L IY +   D G YTC       S  S    +    R + P F  +P  L+I           K V L   V G  S  + +++  +D          K +  +    +  K N  +    +++   K  D+G Y CKA
Sbjct: 6680 LEVKNFEKADVGTYSCEAENSLGSAKTSASLAGKERK--HPPSFSRMLKNMQQVIGDCAKFDARVTGTPPFHVSWFLGDSELSYSDKHVISFEDNVASLSIFSLKVSDAGEYTCK--VSNED-------GSISCSAKLDVTERKTKPTFDQKLEP-------------VEAVVGDPA--ELECHLTGSLPIKIFWMKDKKDIR----PGPNCKMTFFDNTPH--LTIYKLDKSDSGEYTCKAVNDIGSDNSCTCETAIAERKVAPMFTKKP--LEILDEEEG-----KGVKLDSRVSG--SQPIAITWTKDD----------KDLHAHPGRELSFKNNIAL----MSLKSTKVSDSGLYVCKA 6987          

HSP 8 Score: 49.6766 bits (117), Expect = 4.779e-6
Identity = 95/402 (23.63%), Postives = 147/402 (36.57%), Query Frame = 1
Query:  652 INCTSRGHPRIDVVWFFEGEHLSPD-NHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLT-DKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGN 1851
            + C   G P I   WF +   ++   N K     N   L +  V     G+Y+CKAE            GS   V  + V   K+P +          +    +QG   E G    +C + G PP  + WFK  K I     P  +   S+    V+  L+I  +   D   Y+C  S      S + +  +  E    P F      L   S+T  +  +L C V G  S    +S++ +  N  I   TN     Y    + + P        LTI     +D+G Y C+A+  +    S +   I     AP       +L     ++  L+C           W   +  +    N YRM  + N     + L IL   + D+  G Y C+A N +G+
Sbjct: 5980 LECEVAGTPVIKTSWFKDDVLITSGLNRKPVQKLNLAILELRNVQYSESGEYVCKAENDI---------GSATSVAMLTVTERKNPPV--------FTRKLKDVQG--VEGGAAMFDCRATGTPPFAVAWFKHGKEIT----PGEKYRMSFEENVVF--LEILNLATNDEEEYSCTVSNDVGKISCAASLEVK-ERKNPPSF---DQQLAPASVTAGEPADLGCHVTG--SPPFKISWLKD--NKEIRPGTN-----YKFSFVDNTP-------LLTILKTDKRDSGVYVCRAANEAGYDTSCAPVTIKERRVAPTFDQKLESLNVTTGERAELECHVTGSVPIKVTWAKDNREIRAAGN-YRMIFMEN----IARLTILKVGKLDS--GIYTCAASNDVGS 6329          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001736.1 (pep scaffold:Pmarinus_7.0:GL477265:10898:44695:-1 gene:ENSPMAG00000001554.1 transcript:ENSPMAT00000001736.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.0846 bits (157), Expect = 5.013e-11
Identity = 71/333 (21.32%), Postives = 125/333 (37.54%), Query Frame = 1
Query:  991 EIECDSRGLPPPKITWFKDSKMI-------NHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSS-YSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAW--------QPGAPNVNVCKVTASTIQL 1941
             +EC   G P P I W +D   +        HT+ P               VL+I  ++++D G Y C ++  +   +SR V  ++ P    +             ++T +  N++    G       +  + +     I  ++        V   Q      +    L ++D++P  AG Y C+ASV   + F+ +  G ++VL AP  +    ++           C A+  P P   W     P+    +  R+K ++N       L+I      D  +  Y+C A N+LG+       + AW        +PGAP        +ST  L
Sbjct:   25 RLECRVSGRPEPLIAWERDGTALPADSPRYRHTLLPS-------------GVLQISAIRSEDAGRYRCQATNMAATRYSREVEVSVLPPGELE--------GYEKPNITQRPRNVTVEAGGTA----VLECVAQGRPRPIVSWSRLEHLPLDVYHSQ-----VLGSGNLLLADVQPHHAGVYVCRASVPGTRNFTTA-TGQLTVLAAPWFVEQPESVSRPRAGTARFMCHAEGVPPPAVAWLKNGEPI---HSNGRVKVLDNR------LVITQLIAEDEAY--YQCVAENALGS-----GTAAAWLGVVVSEERPGAPRAVAAHTVSSTAIL 310          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Nematostella
Match: EDO43516 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYG4])

HSP 1 Score: 94.7449 bits (234), Expect = 7.429e-20
Identity = 141/626 (22.52%), Postives = 241/626 (38.50%), Query Frame = 1
Query:  622 QFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLT-------ISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEW-----------TFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNV-CKVTASTIQLCVTPNSDSGGLPLTHYEMRF--KDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANT--DIEVMTKHL---GRPVIELVNSSTADSKSFNLHW-VVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSN 2418
            Q++       I+    G+P+   VW   G+  +P+  +FS  ++  +++ S V    +G Y C   V                V  I+VI ++ P +  + P+   +    G         N    C + G P PK  W           +PR  +++ Y+         I  +Q  D+G YTC  +Y+   +S S +  I+  ++ + R  +           + +      VF   S +     + E    +  +   +      V  I+D         TL        I D++ +D G Y C+A  R++      H     ++   EI        GL Y K++ +   K  P   + +            F  YP PN    +  K I N  T  +   I+ N   D  FG Y C + N  G+   T+  + A +P  P VNV   VT S + L   P  D GG+ +  Y + +  K F     +  YY         +++LK +T Y + + A ++ G+G N    + ++T+      RP+I        D  +F L W   +++GG P +RY VVV +          I      ++ Y VD+L +F Q + +     N
Sbjct:  118 QYLRISNADMIDIDVYGYPKPTFVWTKNGQPWNPNEGRFS-TQDGGSVKFSRVEISDQGNYTCTIAVD---------TLGLSSVKKIEVITFEPPRLI-ERPAPFNRLLTVGY--------NTTFHCKAEGYPKPKYRWLNQIMREVDLSNPRFTVADEYF--------HITNIQLSDVGNYTC-VAYNIRDYSDSASAEISKVYVLEQRSPRSSVRFAIYPANNSASAEISKVFVRPSIKPMYDEVVEIDEQAYLDCVGEGNPLPEVRWIRDGRYERRQQITLGGRRSRIYIQDVRLEDEGRYTCEA--RNNARDQEGH----PIVATEEI--------GL-YIKSLPRLNKKGTPLTVYSYLGNPKPVFIRCRFDGYPFPNVTIWFDNKQIANG-TEFAMFDIITNELED--FGDYLCWSWNIHGSKNVTVKLTHAREPSRP-VNVKANVTCSRVTLTWDPPIDDGGMEIMQYVIEYDGKIFNTEDTYPKYY---------ITNLKRDTMYDIKIWARNKMGKGKNNYETVSIITQKYCPPSRPIIWFPYEKVIDDTAFFLKWHEPESNGGDPDVRYKVVVSEDLD--EGPFAIKTEFTALREYYVDEL-KFGQRYQLEVFSYN 684          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Nematostella
Match: EDO31942 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWF5])

HSP 1 Score: 81.2629 bits (199), Expect = 9.590e-16
Identity = 99/462 (21.43%), Postives = 175/462 (37.88%), Query Frame = 1
Query:  970 IFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFG--------------------------------------------------AFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDK-PNPYI---------SHYTLTISD-IKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKH 2169
            + ED +  I C + G P P +TW      +N T    V            ++L +  +Q    GVY C ++        ++ ++ T    + P    I    N T    +++ L+C+V G                                                    S  + V +      NS ++  N++ G   +  I D  P P +         S  ++  SD +   +AG+Y C A+   ++  S ++   V+V Y PE + + +T    W +K + L+CKA+  P P   W    Y    Q     +  I+         + +   Q+   +G Y+C A N LG++ + I  +Q + PG P + V  + AS+I++   P S  GG P+  Y++     +      P    V    + +S L  NT Y + ++A +  G G    I + T+ 
Sbjct:   14 VAEDKDFSITCSASGRPAPNVTW------VNKTSGSPVAHGTGS------AILSLLKIQRHQAGVYQCQATNDVK--RGAITQDFTINVQYPPEITPI---QNTTVRAGETITLTCAVAGNPTPSVSWSKAGSGQSTGGNVFNEAGATKAETGQYVCTAVNIVSGNTQTKTVSTYVIVKYKPSIIANSPYQTVNETTGSLKLSCISDGYPAPMVTWSRDGVVVSPTSVYYSDSVTRSEAGTYTCTAT---NEMGSDTNTVQVTVNYKPE-MASSTTNTSSWNRKVLSLQCKARGVPLPQITW----YKPGGQPITAGVSPISGGQ------LQVTTTQDSGDYGQYKCRASNLLGSVGRLIYVTQWFSPGPPIIIVSNIEASSIKVNWAPPSSDGGSPVIDYKVEVDPAK------PPREGVAGGPVVISGLTKNTEYTVKVTARNVVGYGEAGTIIIQTRK 438          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Nematostella
Match: EDO26116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCU5])

HSP 1 Score: 74.3294 bits (181), Expect = 2.097e-14
Identity = 58/209 (27.75%), Postives = 95/209 (45.45%), Query Frame = 1
Query: 1645 LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIELV--NSSTADSKSFNLHWVV-DTDGGA 2262
            L C++  YP PT+ W+ +D  + +Q + Y     N++  + SE             GTY C+A N +G+   T+  +  + PG P V V  + AS+I++   P S  GG P+  Y++     +      P    V    + +S L  NT Y + ++A +  G G      + TK  G P + ++    +T  SK   L W   D +GGA
Sbjct:   31 LTCESDGYPAPTYTWS-RDGVVVSQTSVY-----NSDSVTRSEA------------GTYTCTATNEMGSDTTTVQVTVNFAPGPPIVTVSNIEASSIKVNWAPPSSDGGSPVIDYKVEVDPAK------PPREGVAGDQVVISDLTKNTEYTVKVTARNVVGYGEAGTKTIRTKKQGPPSLPVLKPGDNTTTSKEITLEWSEPDENGGA 215          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Nematostella
Match: EDO32151 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVV8])

HSP 1 Score: 72.4034 bits (176), Expect = 3.348e-13
Identity = 80/335 (23.88%), Postives = 136/335 (40.60%), Query Frame = 1
Query: 1627 WYKKNV-LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNR---VFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIELVN--SSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRTLDEHALAKAEGLKQYYSEAAILMQSRLSLMMAVFLFLVLI 2613
            W +K + L+CKA+  P+    W    Y    Q     +K I+      S+L +    Q+   +G Y+C A N LG++ + I  +Q + PG P + V  + AS+I++   P S +GG P+  Y++     +  R     GP         + +S L  NT Y + ++A +  G G      + T+  G P    +    +T  S+   L W    + G  I  Y  +V  +   P           N+      DL      F    +K    Y    TA N +G+S       R +  + +A      +  SE+ + + +  S ++AV L   L+
Sbjct:   11 WNRKVLSLQCKARGVPSAHITW----YKPGGQPITAEVKLISGG----SQLQVT-TTQDAGDYGQYKCRASNLLGSVERLIYVTQWFAPGPPIITVSNIEASSIKVNWAPPSSNGGSPVIDYKVEVDPAKTPREGDAGGP---------VVISDLTKNTEYTVKVTARNVVGYGETGTRTIRTRKQGPPSPPFLKPVDNTTTSEEITLEWSKPDENGGAIQAY--IVYFLVTFPDGQKTDWTETANIT-----DLSVLSYTF--TGMKPGRTYSFLVTAYNQYGESARDYTKARVVQVNKMATKCAFVR-SSESCVSVTAACSTVIAVLLVSNLM 317          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Nematostella
Match: EDO31742 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX16])

HSP 1 Score: 69.707 bits (169), Expect = 2.205e-12
Identity = 61/220 (27.73%), Postives = 101/220 (45.91%), Query Frame = 1
Query: 1627 WYKKNV-LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNR---VFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRG-ANTDIEVMTKHLGRPVIELVN--SSTADSKSFNLHWV-VDTDGGA 2262
            W +K + L+CKA+  P P   W +     P       +   + N  +T+        ++   +G Y+C A N LG++ + I  +Q + PG P + V  + AS+I++   P S  GG P+  Y++     +  R   V GP         + +S L  NT Y + ++A +  G G A T+I + TK  G P +  +    +T  S+   L W   D +GGA
Sbjct:   11 WDRKVLSLQCKARGVPLPQITW-YNPGGQPITAGVSPISGGSQNQVATT--------RDAGDYGPYKCRAFNLLGSVERLIYVTQWFAPGPPIIKVSNIEASSIKVNWAPPSSDGGSPVIDYKVEVDPAKPPREGVVGGP---------VVISDLTKNTEYTVKVTARNVVGYGEAGTEI-IRTKKQGPPSLPFLKPVDNTTTSEEITLEWSKPDENGGA 211          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Medaka
Match: ncam1a (neural cell adhesion molecule 1 [Source:NCBI gene;Acc:101173164])

HSP 1 Score: 126.331 bits (316), Expect = 3.970e-29
Identity = 174/772 (22.54%), Postives = 301/772 (38.99%), Query Frame = 1
Query:  367 WYDPNMEPVVNYFTDPQKAQTNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGNPKVVIDS-PRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLT-DKSVNLSCSVFGAFSNRLTVSFIHEDFNNS---------IFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV--LKCKAKAYPNPTWEWTFQD---YPLPNQFNQ--YRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHY--EMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVM-TKHLGRPVIELVNSSTAD-SKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVD-DLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRTLDEHALAKAEGLKQYYSEAAILMQSRLSLMMAVFLFLVLI 2613
            WY P+ E +++   D   ++++++            + + H  +      + GIYKC       +  + + +    K+   S P  Q   EG T  I C     P   ++W  +G  +         I  +  L+I  + +   G Y C+A V    + D       + VLP                  T++  +  +  T     +  + CD+ G P P +TW  ++ ++           + Y      S L I  V   D G YTC +       S+ V+ N+      QP+   +    N T++  D+ V L+C   G  +  ++ S   + F             +E  ++++  YS   +           +LT+ +++   AG Y C   + S+     S +  + V Y+P+I   +  +    ++KN   L C+  A+P  +  W F+D    P PN  N   Y M T+       S L I P  Q D  FG Y C+A N LG+  K     QA  P AP +   +  +ST  +       +GG+P+  Y  E RF   E  R    Y      + I ++ LKP T Y++ +SA +  G G ++      TK +  P    + ++ AD   S  + W+   DGG PII Y                ++    +V  +  +  +    +   +N L  NT YE++  A N  G+S    V  +T      A+   +       + L    +  ++ V  FL+L+
Sbjct:   69 WYTPSGEKILHSMQDLSVSRSDEV---------TSTLTIYHANVD-----SAGIYKCVARDGEKEAQATVQVKIFQKITFQSAPSPQEFTEGDTADIVCNVVSSPPPTIIWKHKGSKIQASKDVRYKIMANGHLQIRGIKKTDEGMYTCEARVMARGEIDFKTMKVVVNVLP------------------TIRARQFEVNATADIGNSALLACDADGFPDPIVTWTHNNVVLEE--------GDKYSLNEDGSELIIKDVMKVDEGDYTCIAKNKAGEKSQEVSLNV----FVQPKITYLN---NKTAIEFDEEVILTCEASGDPTPTISWSSESKIFTEGEQASWTRPDKYESLDRNIVVYSHARVS----------SLTLKNVQFTYAGQYLC---IASNSIGQDSQSVYLEVRYSPKI---QGVVASYTWEKNPANLSCEVDAHPEASVVW-FKDGSHLPSPNTTNVKIYNMPTV-------SYLEITPESQID--FGNYNCTATNDLGSESKEFILIQADVPSAPEIQQVEPFSSTAMVEFEEPDSTGGVPVLKYKVEWRFPGEEWAR--KEYSKEDGKTKILVTGLKPETTYEVKMSAINGKGEGESSAASFFKTKPVREPSAPKLEANVADEGNSLRVTWIKQDDGGLPIIHY----------------LVKYKAHVPEWKPEIRVPSLSEHTTLNGLAWNTEYEVHVVAENQQGRSEPGIVSIKT-----AAQPTAIPGSAHGGSGLGTGAIVGILIVVFFLLLV 744          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Medaka
Match: ncam1a (neural cell adhesion molecule 1 [Source:NCBI gene;Acc:101173164])

HSP 1 Score: 125.176 bits (313), Expect = 6.585e-29
Identity = 171/719 (23.78%), Postives = 284/719 (39.50%), Query Frame = 1
Query:  523 GIYKCDTVQSNNKTPSKINIIGNPKVVIDS-PRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLT-DKSVNLSCSVFGAFSNRLTVSFIHEDFNNS---------IFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV--LKCKAKAYPNPTWEWTFQD---YPLPNQFNQ--YRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHY--EMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVM-TKHLGRPVIELVNSSTAD-SKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRTLDEHALAKAEGLKQYYSEAAILMQSRLSLMMAVFLFLVLI 2613
            GIYKC       +  + + +    K+   S P  Q   EG T  I C     P   ++W  +G  +         I  +  L+I  + +   G Y C+A V    + D       + VLP                  T++  +  +  T     +  + CD+ G P P +TW  ++ ++           + Y      S L I  V   D G YTC +       S+ V+ N+      QP+   +    N T++  D+ V L+C   G  +  ++ S   + F             +E  ++++  YS   +           +LT+ +++   AG Y C   + S+     S +  + V Y+P+I   +  +    ++KN   L C+  A+P  +  W F+D    P PN  N   Y M T+       S L I P  Q D  FG Y C+A N LG+  K     QA  P AP +   +  +ST  +       +GG+P+  Y  E RF   E  R    Y      + I ++ LKP T Y++ +SA +  G G ++      TK +  P    + ++ AD   S  + W+   DGG PII Y +V  +    P    +I  R+ ++  +             +N L  NT YE++  A N  G+S    V  +T      A+   +       + L    +  ++ V  FL+L+
Sbjct:   27 GIYKCVARDGEKEAQATVQVKIFQKITFQSAPSPQEFTEGDTADIVCNVVSSPPPTIIWKHKGSKIQASKDVRYKIMANGHLQIRGIKKTDEGMYTCEARVMARGEIDFKTMKVVVNVLP------------------TIRARQFEVNATADIGNSALLACDADGFPDPIVTWTHNNVVLEE--------GDKYSLNEDGSELIIKDVMKVDEGDYTCIAKNKAGEKSQEVSLNV----FVQPKITYLN---NKTAIEFDEEVILTCEASGDPTPTISWSSESKIFTEGEQASWTRPDKYESLDRNIVVYSHARVS----------SLTLKNVQFTYAGQYLC---IASNSIGQDSQSVYLEVRYSPKI---QGVVASYTWEKNPANLSCEVDAHPEASVVW-FKDGSHLPSPNTTNVKIYNMPTV-------SYLEITPESQID--FGNYNCTATNDLGSESKEFILIQADVPSAPEIQQVEPFSSTAMVEFEEPDSTGGVPVLKYKVEWRFPGEEWAR--KEYSKEDGKTKILVTGLKPETTYEVKMSAINGKGEGESSAASFFKTKPVREPSAPKLEANVADEGNSLRVTWIKQDDGGLPIIHY-LVKYKAKHVPEWKPEI--RVPSLSEHTT-----------LNGLAWNTEYEVHVVAENQQGRSEPGIVSIKT-----AAQPTAIPGSAHGGSGLGTGAIVGILIVVFFLLLV 665          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Medaka
Match: ncam1a (neural cell adhesion molecule 1 [Source:NCBI gene;Acc:101173164])

HSP 1 Score: 119.013 bits (297), Expect = 7.006e-27
Identity = 175/734 (23.84%), Postives = 284/734 (38.69%), Query Frame = 1
Query:  523 GIYKCDTVQSNNKTPSKINIIGNPKVVIDS-PRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLT-DKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHY---TLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV--LKCKAKAYPNPTWEWTFQD---YPLPNQFNQ--YRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHY--EMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANT----------------------DIEVMTKHLGRPVIELVNSSTAD-SKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRTLDEHALAKAEGLKQYYSEAAILMQSRLSLMMAVFLFLVLI 2613
            GIYKC       +  + + +    K+   S P  Q   EG T  I C     P   ++W  +G  +         I  +  L+I  + +   G Y C+A V    + D       + VLP                  T++  +  +  T     +  + CD+ G P P +TW  ++ ++           + Y      S L I  V   D G YTC +       S+ V+ N+      QP+   +    N T++  D+ V L+C   G  +   T+S+  E   + IF    +S+ +  V           SH    +LT+ +++   AG Y C   + S+     S +  + V Y+P+I   +  +    ++KN   L C+  A+P  +  W F+D    P PN  N   Y M T+       S L I P  Q D  FG Y C+A N LG+  K     QA  P AP +   +  +ST  +       +GG+P+  Y  E RF   E  R    Y      + I ++ LKP T Y++ +SA +  G G ++                       I      L  P    + ++ AD   S  + W+   DGG PII Y +V  +    P    +I  R+ ++  +             +N L  NT YE++  A N  G+S    V  +T      A+   +       + L    +  ++ V  FL+L+
Sbjct:   27 GIYKCVARDGEKEAQATVQVKIFQKITFQSAPSPQEFTEGDTADIVCNVVSSPPPTIIWKHKGSKIQASKDVRYKIMANGHLQIRGIKKTDEGMYTCEARVMARGEIDFKTMKVVVNVLP------------------TIRARQFEVNATADIGNSALLACDADGFPDPIVTWTHNNVVLEE--------GDKYSLNEDGSELIIKDVMKVDEGDYTCIAKNKAGEKSQEVSLNV----FVQPKITYLN---NKTAIEFDEEVILTCEASGDPTP--TISWSSE---SKIFTEGEQSLDRNIV---------VYSHARVSSLTLKNVQFTYAGQYLC---IASNSIGQDSQSVYLEVRYSPKI---QGVVASYTWEKNPANLSCEVDAHPEASVVW-FKDGSHLPSPNTTNVKIYNMPTV-------SYLEITPESQID--FGNYNCTATNDLGSESKEFILIQADVPSAPEIQQVEPFSSTAMVEFEEPDSTGGVPVLKYKVEWRFPGEEWAR--KEYSKEDGKTKILVTGLKPETTYEVKMSAINGKGEGESSAASFFKTKPVQYSFTISSETLPSIAATILPLREPSAPKLEANVADEGNSLRVTWIKQDDGGLPIIHY-LVKYKAKHVPEWKPEI--RVPSLSEHTT-----------LNGLAWNTEYEVHVVAENQQGRSEPGIVSIKT-----AAQPTAIPGSAHGGSGLGTGAIVGILIVVFFLLLV 676          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Medaka
Match: zgc:152904 (neural cell adhesion molecule 2 [Source:NCBI gene;Acc:101169522])

HSP 1 Score: 117.472 bits (293), Expect = 1.788e-26
Identity = 165/733 (22.51%), Postives = 294/733 (40.11%), Query Frame = 1
Query:  319 EDDFEIANSKNSP-PLIWYDPNMEPVVNYFTDPQKAQTNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGNPKVV----IDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNH-KFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYY---SRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPL----PN-QFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAP-NVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIE-VMTKHLGRPVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQS 2466
            E  F I  +   P  L W++P  E +V           +K  M+    +++K + + + II+D      GIY+C   +++  T     ++   + +    ++SP  Q    G T  + C     P   VVW+ +   ++   H +F  + N+  L+I +VT+   G Y C+A V          RG  I+ + I V+V   P +S        Q+S      T     ++   C + G P P +TW        H    +++ SE Y         S L I  ++  D G Y C ++      + S  R +  +   QP   ++    N T++   +  +SC   G       +S+       S  +      G++ V     K         LTIS ++  D G + C+A  R   +     +  + + Y P+ L  +S  Y  W    V + C   + P  T  W  + + +    PN Q ++   +++         L + P   +D  FG Y C+ARN++G   +    +QA  P  P +V +  V+     +        GG+P+++Y +++K+           + V  +T+ L+ L+PNT Y++ ++A +  G+G  +  E   T  +  P    V+      K++ L  V   DGG PI+ Y                +  +    + +M   +        + SL+ NT YE+  TA N  G S
Sbjct:   35 ESKFFICTAIGEPVRLEWFNPQGERIV----------ASKRMMLHTEPSRSK-LVIYNAIIED-----AGIYRCQATEASGLTAEASVVLEIYQRLTFRDVESP--QEFRHGDTAEVVCDVISSPVPVVVWYRQDREITDQYHSRFQVLPNN-NLQIHQVTKADEGVYRCEASVE--------ARGE-IDFVDIAVVVNVPPVLS------VFQQS---FNATADYQESVTFTCITSGSPEPAVTW--------HRKGQQLEPSEQYTFDKKEGGRSTLTIRNIRQTDGGAYACKATNK----AGSQERELFLKVFVQPHITQLK---NVTAVEGSAAMISCVAEG--EPLPDISWRRASDGQSFMDGVKNRDGRFEVRGRHGKS-------VLTISGVRLTDLGRFDCEAQSRIGGH---QKSMFLDIEYVPKFLTNQSIFYS-WEGNPVNISCDVMSNPPATMLWRRERFTISEVTPNMQIHRAEGRSV---------LEVTP--MSDRDFGRYNCTARNNIGVRYQEFILAQADVPSNPYSVRLSAVSQRLATVTFLKPDSHGGVPISYYLVQYKEVGSQDWRDVKSHSVQ-TTVVLTGLEPNTTYEVRVAAVNGKGQGEFSHTESFQTLAIREPSPPAVHGQKGIGKTYRLGLVKQDDGGMPILEYI---------------VKYKTDKEEQWMTKLVPGANDFAMLQSLQWNTRYEVEITARNVKGLS 675          
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Medaka
Match: zgc:152904 (neural cell adhesion molecule 2 [Source:NCBI gene;Acc:101169522])

HSP 1 Score: 117.087 bits (292), Expect = 2.348e-26
Identity = 165/733 (22.51%), Postives = 294/733 (40.11%), Query Frame = 1
Query:  319 EDDFEIANSKNSP-PLIWYDPNMEPVVNYFTDPQKAQTNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGNPKVV----IDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNH-KFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYY---SRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-LKCKAKAYPNPTWEWTFQDYPL----PN-QFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAP-NVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIE-VMTKHLGRPVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQS 2466
            E  F I  +   P  L W++P  E +V           +K  M+    +++K + + + II+D      GIY+C   +++  T     ++   + +    ++SP  Q    G T  + C     P   VVW+ +   ++   H +F  + N+  L+I +VT+   G Y C+A V          RG  I+ + I V+V   P +S        Q+S      T     ++   C + G P P +TW        H    +++ SE Y         S L I  ++  D G Y C ++      + S  R +  +   QP   ++    N T++   +  +SC   G       +S+       S  +      G++ V     K         LTIS ++  D G + C+A  R   +     +  + + Y P+ L  +S  Y  W    V + C   + P  T  W  + + +    PN Q ++   +++         L + P   +D  FG Y C+ARN++G   +    +QA  P  P +V +  V+     +        GG+P+++Y +++K+           + V  +T+ L+ L+PNT Y++ ++A +  G+G  +  E   T  +  P    V+      K++ L  V   DGG PI+ Y                +  +    + +M   +        + SL+ NT YE+  TA N  G S
Sbjct:   35 ESKFFICTAIGEPVRLEWFNPQGERIV----------ASKRMMLHTEPSRSK-LVIYNAIIED-----AGIYRCQATEASGLTAEASVVLEIYQRLTFRDVESP--QEFRHGDTAEVVCDVISSPVPVVVWYRQDREITDQYHSRFQVLPNN-NLQIHQVTKADEGVYRCEASVE--------ARGE-IDFVDIAVVVNVPPVLS------VFQQS---FNATADYQESVTFTCITSGSPEPAVTW--------HRKGQQLEPSEQYTFDKKEGGRSTLTIRNIRQTDGGAYACKATNK----AGSQERELFLKVFVQPHITQLK---NVTAVEGSAAMISCVAEG--EPLPDISWRRASDGQSFMDGVKNRDGRFEVRGRHGKS-------VLTISGVRLTDLGRFDCEAQSRIGGH---QKSMFLDIEYVPKFLTNQSIFYS-WEGNPVNISCDVMSNPPATMLWRRERFTISEVTPNMQIHRAEGRSV---------LEVTP--MSDRDFGRYNCTARNNIGVRYQEFILAQADVPSNPYSVRLSAVSQRLATVTFLKPDSHGGVPISYYLVQYKEVGSQDWRDVKSHSVQ-TTVVLTGLEPNTTYEVRVAAVNGKGQGEFSHTESFQTLAIREPSPPAVHGQKGIGKTYRLGLVKQDDGGMPILEYI---------------VKYKTDKEEQWMTKLVPGANDFAMLQSLQWNTRYEVEITARNVKGLS 675          
BLAST of Neural cell adhesion molecule 1 vs. Planmine SMEST
Match: SMESG000060956.1 (SMESG000060956.1)

HSP 1 Score: 1717.98 bits (4448), Expect = 0.000e+0
Identity = 836/841 (99.41%), Postives = 839/841 (99.76%), Query Frame = 1
Query:   97 MIIHRNQIFILLNILVFNFMNVESNKYSECENLPANSIKILDHKNEMKVWFGSEVSLTCCMKENLKFNDNSDFYEDDFEIANSKNSPPLIWYDPNMEPVVNYFTDPQKAQTNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRTLDEHALAKAEGLKQYYSEAAILMQSRLSLMMAVFLFLVLIHN 2619
            MIIHRNQIFILLNILVFNFMNVESNKYSECENLPANSIKILDHKNEMKVWFGSEVSLTCCMKENLKFNDNSDFYEDDFEIANSKNSPPLIWYDPNMEPVVNYFTDPQKAQ NKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNG+VSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFK FEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYDVVVQQVDVDPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRTLDEHALA+AEGLKQYYSEAAILMQSRLSLMMAVFLF+VLIHN
Sbjct:    1 MIIHRNQIFILLNILVFNFMNVESNKYSECENLPANSIKILDHKNEMKVWFGSEVSLTCCMKENLKFNDNSDFYEDDFEIANSKNSPPLIWYDPNMEPVVNYFTDPQKAQNNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGVVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKGFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYDVVVQQVDVDPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRTLDEHALARAEGLKQYYSEAAILMQSRLSLMMAVFLFIVLIHN 841          
BLAST of Neural cell adhesion molecule 1 vs. Planmine SMEST
Match: SMESG000060956.1 (SMESG000060956.1)

HSP 1 Score: 1679.46 bits (4348), Expect = 0.000e+0
Identity = 817/822 (99.39%), Postives = 820/822 (99.76%), Query Frame = 1
Query:  154 MNVESNKYSECENLPANSIKILDHKNEMKVWFGSEVSLTCCMKENLKFNDNSDFYEDDFEIANSKNSPPLIWYDPNMEPVVNYFTDPQKAQTNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRTLDEHALAKAEGLKQYYSEAAILMQSRLSLMMAVFLFLVLIHN 2619
            MNVESNKYSECENLPANSIKILDHKNEMKVWFGSEVSLTCCMKENLKFNDNSDFYEDDFEIANSKNSPPLIWYDPNMEPVVNYFTDPQKAQ NKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNG+VSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFK FEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYDVVVQQVDVDPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRTLDEHALA+AEGLKQYYSEAAILMQSRLSLMMAVFLF+VLIHN
Sbjct:    1 MNVESNKYSECENLPANSIKILDHKNEMKVWFGSEVSLTCCMKENLKFNDNSDFYEDDFEIANSKNSPPLIWYDPNMEPVVNYFTDPQKAQNNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGVVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKGFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYDVVVQQVDVDPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRTLDEHALARAEGLKQYYSEAAILMQSRLSLMMAVFLFIVLIHN 822          
BLAST of Neural cell adhesion molecule 1 vs. Planmine SMEST
Match: SMESG000060956.1 (SMESG000060956.1)

HSP 1 Score: 1625.14 bits (4207), Expect = 0.000e+0
Identity = 790/795 (99.37%), Postives = 793/795 (99.75%), Query Frame = 1
Query:  235 MKVWFGSEVSLTCCMKENLKFNDNSDFYEDDFEIANSKNSPPLIWYDPNMEPVVNYFTDPQKAQTNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRTLDEHALAKAEGLKQYYSEAAILMQSRLSLMMAVFLFLVLIHN 2619
            MKVWFGSEVSLTCCMKENLKFNDNSDFYEDDFEIANSKNSPPLIWYDPNMEPVVNYFTDPQKAQ NKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNG+VSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFK FEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYDVVVQQVDVDPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRTLDEHALA+AEGLKQYYSEAAILMQSRLSLMMAVFLF+VLIHN
Sbjct:    1 MKVWFGSEVSLTCCMKENLKFNDNSDFYEDDFEIANSKNSPPLIWYDPNMEPVVNYFTDPQKAQNNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGVVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKGFEVNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYDVVVQQVDVDPSDNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRTLDEHALARAEGLKQYYSEAAILMQSRLSLMMAVFLFIVLIHN 795          
BLAST of Neural cell adhesion molecule 1 vs. Planmine SMEST
Match: SMESG000034067.1 (SMESG000034067.1)

HSP 1 Score: 152.14 bits (383), Expect = 1.921e-37
Identity = 181/745 (24.30%), Postives = 319/745 (42.82%), Query Frame = 1
Query:  484 VHLIIKDFKPANNGIYKCDTVQSNN------KTPSKINIIGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIV--YKDPEISPDSPSVTVQKSETGIQGTIFEDGNLE-----IECDSRGLPPPKITWFKDSKMINHTVDPRVQIS--ESYY--SRNVYSVLKI-YPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFS---------NRLTVSFIHEDFNNS---IFEYTNKSMGKYSVEMIQDKP----------NPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTL---YGLWYKKNVLKCKAKAYPNPT-WEWTFQDYPLPNQFNQ-YRMKTINNNDTSTSELIILPNFQNDA-IFGTYECSARNSLGNIRKTISFSQAWQPGAPNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFE-VNRVFGPYYYPVNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDI--EVMTKHLGRPVIELVNSSTADSKSFNLHWVVDTDGGAPIIRYXXXXXXXXXXPS-----------DNSKIINRIGNVKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRTLDEHALAKAEGLKQY 2538
            + L ++D    N+G Y C + Q          T S +  +  P         Q+I    TG + C     P   V W F+G  L+  + K+    N   L I+ VT    G+Y+ KA+     Q D     SFI     D+IV  ++ P+I           S   I G I  DG +E     I+C + G PPP + WF+       + +  +QI+  + ++  +      L+I YP+   D   YTC +              +  +FI   +F K         L  KS+N+S SV   F+         N  T ++I      +   + ++       Y + + ++ P          +P      L IS+++  D+ +Y C A+     Y   S+NG + V   P I  + +TL   +G  Y    L C +   P+PT W W    + + N  N  +R+ + +    S S L I+P+      IF  Y+C A+N +G  R+ + F +A  PG P       + S++   + P+S  GG+ L HYEM ++  +     +GP  Y  + +TI++  L  +T Y++S  + +  GR  +T +  + ++  +  PV  + + ++     +NL W+V  +GG P++ Y ++++ V V+              N  ++N  G ++ +       ++ +F ++ L++ T Y+++  A NS G S      F T    AL K   ++ +
Sbjct:   88 IVLTVRDVDTGNSGTYYCKSYQYEGNAQILLATTSVLVAVYKPVTPTFCNNEQWIMLNSTGKVRCELYSDPAAIVTWEFKGIQLT-QSEKYKI--NDWGLEINYVTSNDAGQYVLKAK-----QIDY--GSSFIR----DIIVTTFEIPKII----------SGPTIIGPIL-DGVVEWWYSDIQCLATGNPPPTVHWFR-----KKSGNQELQIANPQKFFVNTNPKKGTLRITYPMFPDDNDEYTCQAM-------------LATDFIDNVQFPK--------ELVSKSINISVSVRPYFTQVEQMITVVNPGTTAYIRCRVRTTDPVLLQWQKYKGQAYKMGIQENDPRIRVTIEKEVDPIYQVLRLDISNVQFSDSWNYTCIATSPGSNY---SYNGTIIVRQKPII--SNNTLTEEFGWLYNATNLTCISHGLPHPTRWYWYRYRFSVLNDINSTFRVISYDYETHSQSWLQIIPDLSTQYWIFDLYQCQAQNEIGEDRRNVRFYRAQVPGPPTAISVSASPSSLVFKIGPSSRDGGMKLLHYEMIYRALQGPTLTYGPVIYQPDETTISMDGLVHDTSYQVSFYSCNAVGRSVDTTVTGKTLSATVPFPVQIISSKASVYPYGYNLEWIVPLNGGFPLLGYRILIRPVSVNADYTGNRSREFLVGNPDMLNNPGLIRIFEPMLTNPYESVFRLDDLEAETVYKVSIEAKNSLGYSNKTIFYFFTPIGDALGKPPRIRGF 776          
BLAST of Neural cell adhesion molecule 1 vs. Planmine SMEST
Match: SMESG000021248.1 (SMESG000021248.1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.284e-11
Identity = 107/473 (22.62%), Postives = 171/473 (36.15%), Query Frame = 1
Query:  490 LIIKDFKPANNGIYKCDTV--QSNNKTPSKINIIGNPKVVIDSPRY--QFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLC-------KAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEY-TNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKAS---VRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKN---VLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNI 1854
            L+IK  + +++ +Y+C        +K    +N+   P +   S R   +F++ G T  + C   G P   + W +     SP       + N+  L    V +    +Y C        A   FD     PP+           IV  DP+                 +  I +DG L + C+S   P   I WFKD ++I + +  RV I+      N  + L +   Q  DIG+Y C  S         + +      I  P  +K  +   A  +             A    L +  + E       E+  + S   +   ++ D        Y LT++     DAG Y C A     ++D  F       V V Y P + P     Y +        VL+C     P P   W     P+ N+   YR + I N    + +L I+    +DA  G Y C A+N+ G +
Sbjct: 1537 LLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLK-GSTTNLWCNVSGFPTPQIRWTYMETINSP-----LLLSNNSQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPK-----------IVSLDPDK----------------KRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNL--RVNIT------NRGTQLHLLNAQESDIGIYKCLVSNKL-----GLDKQAWTVDIMIPPSIKFNSKAGAHQV-------------ALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRRVLLSD------DGYHLTVNSTMETDAGRYQCIAENTHGQTDISFD------VQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPI-NRLPSYRYRIIGN----SKQLEIIAMQASDA--GRYSCVAKNTFGQM 1931          

HSP 2 Score: 63.929 bits (154), Expect = 8.048e-10
Identity = 112/481 (23.28%), Postives = 191/481 (39.71%), Query Frame = 1
Query:  469 KGIQVVHLIIKDFKPANNGIYKCDTVQSN----NKTPSKINIIGNPKVVIDSPRYQF-IEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYH----------GFSRSVARN-ITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWY--KKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNF-QNDAIFGTYECSARNSLGNI 1854
            +G Q+ HL+  + + ++ GIYKC  + SN    +K    ++I+  P +  +S      +  G   Y+ C S G P+  + W  +G  +  D  +    ++   L ++   E   G+Y C AE +    +           +  DV V   P + P        K E  + GT+       +EC   G+P P ITW KD   IN     R +I  +         L+I  +QA D G Y+C +  ++           G   S+ RN I  E+I     +K+G  L           L C   G  S    ++F  +  +  +F+ +      Y   ++  +         LT+   K  D+G Y C AS  +  Y  + ++  V V   PE   +       W+  +   L+C      +P  + T++ + +P   +      I+ + T     I + N  Q DA  G Y+C A+N +  I
Sbjct: 1715 RGTQL-HLL--NAQESDIGIYKC--LVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRI--DFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTD-----------ISFDVQVTYGPTLDPGGKRY--YKVERTVGGTVV------LECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQ------LEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYI-----IKVGDEL----------RLPCPANG--SPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQ-----ERQMLTLYSAKRTDSGLYQCNAS-NAIGYDVMEYS--VRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVP--LSSGGSIRISPDGTR----ITVENVKQYDA--GEYKCHAQNEVSKI 2130          

HSP 3 Score: 63.1586 bits (152), Expect = 1.405e-9
Identity = 112/487 (23.00%), Postives = 184/487 (37.78%), Query Frame = 1
Query:  490 LIIKDFKPANNGIYKCD--TVQSNNKTPSKINIIGNPKVV-IDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFI-ENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITWFKDSKMINHTV-DPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYI----------SHYTLTISDIKPQDAGSYYCKAS--VRSDK-------YFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQ------NDAIFGTYECSARNSLGNIRK 1860
            L+I   +    GIY CD   V  + K    + I+ +PK++  +     FI+   T  + C + G+P   + W F+ + + P+   +  + EN +TL +        G+Y C AE    ++     + S + V          P I   +P+  +  +       I   GN+   C     PP +I WFK+   I  ++   R +IS         S L ++ V+  D G+Y C +                         + IG +LN T +    V +S ++ G  S++  ++ I+E+ +  I   T  S G  +   +  K N  +             TL I  ++  D   Y C  +     DK       +   S NGI S+   PE L  K +   LW       C    +P P   WT+             M+TIN      S L++  N Q      + +    Y C A N  G+ RK
Sbjct: 1254 LLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTIT--LTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAE----NEGGKDQKNSIVTVFA--------PYIDMKTPNKNITYNP------IIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLD------GSTLTLFEVKHLDSGIYKCLA-------------------------INIGESLNFTLV----VLISPTILGKHSSKSVIN-INEETDLYI---TCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGI-SMRETPEFL--KGSTTNLW-------CNVSGFPTPQIRWTY-------------METIN------SPLLLSNNSQLHFMNVDKSHITRYTCIATNEAGSARK 1652          

HSP 4 Score: 60.4622 bits (145), Expect = 7.404e-9
Identity = 106/474 (22.36%), Postives = 179/474 (37.76%), Query Frame = 1
Query:  490 LIIKDFKPANNGIYKCDTVQSNNKTPSKINI----------IGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPD-NHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQG-TIFEDGNLEIECD-SRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKP----NPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRK 1860
            L+IK  K  +  IY C  +  N    +K +I          IG+ K  ID+      ++G    + C ++G P+  + W   G  L+ +   +     +   L +  +TE   G + C A    +D                   V K+ ++S  +P    Q S+ GI    I    N+E+ C  + G P PKI W+K+ +       P V+I          ++LK+Y     + G Y C +               T E     RF +I T L A   +D  +     ++     +LT++   + F     +++ KS    S+  +Q  P    N  I    L I+ ++ +  G Y C  +        +S++  V +L +P+I+               L C A   P P  +W F+   +P     Y+M   N       E +I+    +    G Y C A N  G  +K
Sbjct:  970 LVIKTVKAEDEAIYTC--IAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDA------KDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTAT---NDH----------------AAVVKEFKVSVKAPP---QISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQ-------PLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKA---------------TNEVSSDSRFFQI-TILVAPKASDSKM---IKIYTKEGEKLTLNCKIDGFPTPTKKWSWKS----SILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGT-NVGGSAKMSYD--VIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQ------ETLIVERAAS-MHGGEYSCLAENEGGKDQK 1373          

HSP 5 Score: 56.9954 bits (136), Expect = 9.304e-8
Identity = 100/432 (23.15%), Postives = 164/432 (37.96%), Query Frame = 1
Query:  628 IEEGKTGYINCTSRGHPRIDVVWFFEGEHLSP-DNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQ-GTIFEDGNLEIECDSRGLPPPKITWFKDSKMI---NHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSV-ARNITPEFIFQPR---FLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEIL-PTKSTLYGLWYKKNVLKCK-AKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQP 1890
            ++ G +    C + G P   ++WF++   +SP D   F    N + L I  V +   G + C A             GS ++V  ++VI+   P +      V + K E   + GT F      + C + G P P I W +D K I       D R  I            L+I   + +D G YTC  +      S+SV    I+P  I  P+    +++G          + V L C V G    R+     +   NN I   ++  +G+Y           ++S   L I  ++   +G Y C A+     Y  +     + VL  P+I  PT++   G+      ++CK  +  P P   W         + N   +  + N  T+T   + + N       G+  C A+N  G  R T   +    P
Sbjct: 2352 VQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKE-GGIFKCIARNEV---------GSIMKVYKLEVIM---PAL------VRLDKIEVRERSGTSFS-----VLCTAEGYPKPVIKWTRDGKGIFRYGTKTDSRTGI------------LEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVG----------EQVLLPCIVEGTRPFRI---HWYTPGNNQI---SSTILGEYQ----------FLSEQGLIIDRVRKDHSGVYRCVAN-NDAGYQEIRIT--LEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITW---------ERNGITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLP 2709          

HSP 6 Score: 54.299 bits (129), Expect = 5.951e-7
Identity = 103/469 (21.96%), Postives = 184/469 (39.23%), Query Frame = 1
Query:  490 LIIKDFKPANNGIYKCDTVQ--SNNKTPSKINIIGNPKVVIDSPRYQ-FIEEGKTGYINCTSRGHPRIDVVWFFEGEHL--SPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEIECD-SRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPE--FIFQ---PRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEIL---PTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNI 1854
            L I D K  + G Y C      S +     + II  PK  I+SP+    +  G+   + C   G     + W+  G +   S    ++ F+ + Q L I  V +   G Y C A      QE           + I + V   P+I   + + T     TG+  T+     L+++C    G+P P ITW ++   ++          ++YY+     +     ++ +D G  TC            +A+N+  E    FQ       K+   ++ T     SV + C V G    + TV++              K  G+ S++ +      + S   + I D+KP+D G+Y C    RS    S +    +S+   P+ +     K+ +    +K    +C+A ++P P  +W F    + ++ N       N   + T + +   N       G Y+C A+N +G++
Sbjct: 2487 LEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPK--IESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFL-SEQGLIIDRVRKDHSGVYRCVANNDAGYQE-----------IRITLEVLVQPKIFRPTETET-----TGVLNTV-----LQMQCKILEGIPQPVITWERNGITLSKV--------KNYYTTTDSGLFIFNSLKIEDEGSLTC------------IAKNVAGEDRLTFQITVELLPKVSLPISVTGDEGSSVTIICKVEG--KPKPTVTW--------------KKDGQ-SLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGE-RSGAEASTAST-YLSIFTRPKFVYKPKLKNVVQETRWKS--FRCEATSHPKPDIKWMFNGRAIESKLNS------NGRGSITLQSVRSEN------AGEYKCIAKNRVGSV 2878          

HSP 7 Score: 51.9878 bits (123), Expect = 2.785e-6
Identity = 63/307 (20.52%), Postives = 132/307 (43.00%), Query Frame = 1
Query:  976 EDGNLEIECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVY---SVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLK--IGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKSTLYGLWYKKNV-----LKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMK--TINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRK 1860
            ++  +++ C+  G PPP + W++  + I       +   E Y   ++    SV++I  +Q  D   Y C ++        ++ +      I  P+ +K  +G   N     +  +   CSV+     +  + +  E  N+ I       +G     +       + +  +LTI + K  ++G Y C+A   + +    SH  +++V   P+  PT  +++       +      +C A+  P P+  W ++D P+    + Y M    I+NN    ++++ +P+   +   G ++C ARN +G+I K
Sbjct: 2157 QNTTVQMSCECTGYPPPTLLWYRQEQEI-------LADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNG----GGTIEKKFEISVIIPPKIMKRSLGPE-NHRVKENMQITFHCSVYNYNMTKPVILWTKE--NSPIL------IGDTDYYLT------FNNGQSLTILNPKSDESGRYTCEAKNLAGQD---SHTFVLTVTSPPK-FPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPI----SPYDMMNFVISNN----AKVLTIPSVNKEG--GIFKCIARNEVGSIMK 2423          

HSP 8 Score: 51.9878 bits (123), Expect = 2.905e-6
Identity = 99/476 (20.80%), Postives = 180/476 (37.82%), Query Frame = 1
Query:  490 LIIKDFKPANNGIYKCDTVQSNNKTPSKINIIGN---PKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVWFFEGEHLSPDNHKFSFIENHQ--TLRISEVTERFRGKYLCKAEVSFDDQEDMPPRGSFIEVLPIDVIVYKDPEIS-PDSPSVTVQKSETGIQGTIFEDGNLEIECDSRGLPPPKITW-FKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQAQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTDKSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKPNPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEILPTKS--TLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTINNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQP 1890
            LII     ++NG Y C   +        +  I     P   +D     FI+       +C +   P     WF  G  L P + + S + + Q   ++IS V  +  G+ +CKA+ S                  ID +  K   IS P   S+ + K          E     + C + G+P PKITW F  S +   T+D  + I+E+  + ++  + K   ++ Q + V T N+  S   F+  +         F PR     TN++ +    +++ + C V G    R+              ++     G Y++ +            +L I  +  +D  +Y C A  +  K    S    +S + AP+I  T+S   +     KK ++    ++ P     W      +     +Y  + +  ++T   + +     +++AI   Y C A+N +G  +  I      +P
Sbjct:  596 LIILSASESDNGEYVC-VAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSI-TASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAG----------------IDEVRIKLSYISLPKILSLDLAKE------IPLEGDQQTVRCSANGVPQPKITWEFNGSPV---TIDGNIIINETIGTLDINRIEK--NMKGQWVCVATNNAGSSRKSFNLDIG--------FGPRIKDFVTNIDGS--YGENITIRCQVEGHPPPRV--------------KWLRGIAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGK-VQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEI-----EYSNRIMAKDNTLVIKTV---KAEDEAI---YTCIAKNQVGTAKFDIELDVQTKP 1006          
The following BLAST results are available for this feature:
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NCAM28.055e-2821.73neural cell adhesion molecule 2 [Source:HGNC Symbo... [more]
NCAM28.982e-2821.73neural cell adhesion molecule 2 [Source:HGNC Symbo... [more]
NCAM12.061e-2423.90neural cell adhesion molecule 1 [Source:HGNC Symbo... [more]
NCAM18.707e-2423.60neural cell adhesion molecule 1 [Source:HGNC Symbo... [more]
NCAM11.070e-2323.60neural cell adhesion molecule 1 [Source:HGNC Symbo... [more]
back to top
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncam-14.005e-1321.62NCAM (Neural cell adhesion molecule) homolog [Sou... [more]
ncam-14.217e-1321.62NCAM (Neural cell adhesion molecule) homolog [Sou... [more]
ncam-17.562e-1321.62NCAM (Neural cell adhesion molecule) homolog [Sou... [more]
him-41.133e-1223.83High Incidence of Males (Increased X chromosome lo... [more]
him-41.133e-1223.83High Incidence of Males (Increased X chromosome lo... [more]
back to top
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fas25.344e-2521.61gene:FBgn0000635 transcript:FBtr0336884[more]
Fas25.581e-2521.61gene:FBgn0000635 transcript:FBtr0343524[more]
Fas27.891e-2521.61gene:FBgn0000635 transcript:FBtr0343523[more]
Fas29.961e-2521.61gene:FBgn0000635 transcript:FBtr0336882[more]
Fas21.022e-2421.61gene:FBgn0000635 transcript:FBtr0070665[more]
back to top
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncam25.311e-2822.32neural cell adhesion molecule 2 [Source:ZFIN;Acc:Z... [more]
ncam25.643e-2822.32neural cell adhesion molecule 2 [Source:ZFIN;Acc:Z... [more]
ncam1a5.964e-2722.55neural cell adhesion molecule 1a [Source:ZFIN;Acc:... [more]
ncam1a5.442e-2622.78neural cell adhesion molecule 1a [Source:ZFIN;Acc:... [more]
ncam1b5.757e-2624.26neural cell adhesion molecule 1b [Source:ZFIN;Acc:... [more]
back to top
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncam21.121e-3024.47neural cell adhesion molecule 2 [Source:NCBI gene;... [more]
ncam21.137e-3024.32neural cell adhesion molecule 2 [Source:NCBI gene;... [more]
ncam21.696e-3024.32neural cell adhesion molecule 2 [Source:NCBI gene;... [more]
ncam21.796e-3024.47neural cell adhesion molecule 2 [Source:NCBI gene;... [more]
ncam24.555e-3024.51neural cell adhesion molecule 2 [Source:NCBI gene;... [more]
back to top
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ncam23.749e-2922.64neural cell adhesion molecule 2 [Source:MGI Symbol... [more]
Ncam23.926e-2922.64neural cell adhesion molecule 2 [Source:MGI Symbol... [more]
Ncam18.437e-2923.41neural cell adhesion molecule 1 [Source:MGI Symbol... [more]
Ncam18.455e-2923.41neural cell adhesion molecule 1 [Source:MGI Symbol... [more]
Ncam13.625e-2724.12neural cell adhesion molecule 1 [Source:MGI Symbol... [more]
back to top
BLAST of Neural cell adhesion molecule 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P22648|FAS2_SCHAM8.783e-3024.33Fasciclin-2 OS=Schistocerca americana OX=7009 GN=F... [more]
sp|P13596|NCAM1_RAT1.779e-2823.48Neural cell adhesion molecule 1 OS=Rattus norvegic... [more]
sp|O35136|NCAM2_MOUSE2.622e-2822.64Neural cell adhesion molecule 2 OS=Mus musculus OX... [more]
sp|P31836|NCAM1_BOVIN2.035e-2724.06Neural cell adhesion molecule 1 OS=Bos taurus OX=9... [more]
sp|O15394|NCAM2_HUMAN3.868e-2721.73Neural cell adhesion molecule 2 OS=Homo sapiens OX... [more]
back to top
BLAST of Neural cell adhesion molecule 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q1JUB60.000e+067.46Cell adhesion molecule OS=Dugesia japonica OX=6161... [more]
A0A068WLW93.118e-5124.67Cell adhesion molecule OS=Echinococcus granulosus ... [more]
A0A068Y9P31.262e-5025.81Cell adhesion molecule OS=Echinococcus multilocula... [more]
A0A0X3NW222.077e-4930.39Fasciclin-2 (Fragment) OS=Schistocephalus solidus ... [more]
A0A267FRC57.613e-4723.33Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncam22.777e-2922.60neural cell adhesion molecule 2 [Source:ZFIN;Acc:Z... [more]
ncam23.461e-2922.74neural cell adhesion molecule 2 [Source:ZFIN;Acc:Z... [more]
ncam23.663e-2922.60neural cell adhesion molecule 2 [Source:ZFIN;Acc:Z... [more]
ncam1b1.613e-2824.96neural cell adhesion molecule 1b [Source:ZFIN;Acc:... [more]
ncam1b1.827e-2824.56neural cell adhesion molecule 1b [Source:ZFIN;Acc:... [more]
back to top
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008186.15.554e-2223.96pep scaffold:Pmarinus_7.0:GL476501:83598:168579:1 ... [more]
ncam1b8.434e-1922.53neural cell adhesion molecule 1b [Source:ZFIN;Acc:... [more]
igdcc34.515e-1222.67immunoglobulin superfamily, DCC subclass, member 3... [more]
ENSPMAT00000002502.13.435e-1121.70pep scaffold:Pmarinus_7.0:GL476400:249000:366561:-... [more]
ENSPMAT00000001736.15.013e-1121.32pep scaffold:Pmarinus_7.0:GL477265:10898:44695:-1 ... [more]
back to top
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO435167.429e-2022.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319429.590e-1621.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO261162.097e-1427.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO321513.348e-1323.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317422.205e-1227.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neural cell adhesion molecule 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncam1a3.970e-2922.54neural cell adhesion molecule 1 [Source:NCBI gene;... [more]
ncam1a6.585e-2923.78neural cell adhesion molecule 1 [Source:NCBI gene;... [more]
ncam1a7.006e-2723.84neural cell adhesion molecule 1 [Source:NCBI gene;... [more]
zgc:1529041.788e-2622.51neural cell adhesion molecule 2 [Source:NCBI gene;... [more]
zgc:1529042.348e-2622.51neural cell adhesion molecule 2 [Source:NCBI gene;... [more]
back to top
BLAST of Neural cell adhesion molecule 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060956.10.000e+099.41SMESG000060956.1[more]
SMESG000060956.10.000e+099.39SMESG000060956.1[more]
SMESG000060956.10.000e+099.37SMESG000060956.1[more]
SMESG000034067.11.921e-3724.30SMESG000034067.1[more]
SMESG000021248.13.284e-1122.62SMESG000021248.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020684 ID=SMED30020684|Name=Neural cell adhesion molecule 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3004bp
GAAATCTTGCAGGATTCAATATTCAATAATTTAATTGGAGAAATTGAAGT
CATATAATTGCGATTTATTTATTCGTACAACAATTTACTGTTACAAATGA
TTATCCATCGAAATCAAATATTTATATTATTGAATATCTTGGTATTCAAT
TTTATGAACGTAGAATCAAATAAATATAGTGAGTGTGAAAACCTACCAGC
TAATTCAATCAAAATATTGGACCATAAAAATGAGATGAAAGTTTGGTTTG
GATCGGAGGTTTCACTGACATGTTGTATGAAAGAAAATCTGAAGTTCAAT
GACAATAGCGATTTTTATGAAGATGACTTTGAAATAGCGAATTCGAAAAA
TTCCCCACCATTAATCTGGTATGATCCGAACATGGAACCGGTTGTCAACT
ATTTCACCGATCCACAAAAGGCTCAAACTAATAAAATATTTATGATTCCC
GATATGCTTAACAAAGCGAAAGGCATTCAAGTCGTGCATTTGATCATCAA
GGATTTCAAGCCAGCTAACAATGGAATCTACAAATGTGACACAGTCCAAA
GCAACAATAAAACTCCCAGCAAAATAAACATTATCGGAAACCCAAAAGTC
GTTATTGATTCGCCAAGATATCAATTTATAGAAGAAGGAAAAACCGGCTA
CATAAACTGCACCTCCCGAGGTCACCCGAGAATCGATGTCGTTTGGTTCT
TTGAAGGTGAACACTTGTCTCCGGACAATCACAAATTCTCCTTTATCGAA
AACCATCAAACTCTTCGAATATCAGAAGTGACTGAGCGGTTTCGTGGCAA
ATATTTGTGTAAAGCCGAAGTTTCTTTCGATGATCAAGAAGACATGCCAC
CGAGAGGGAGTTTTATTGAGGTTTTACCGATCGATGTTATCGTCTACAAG
GATCCAGAAATCAGTCCCGATTCTCCATCTGTCACGGTGCAGAAATCAGA
AACCGGAATCCAGGGAACGATTTTTGAAGACGGGAATCTGGAAATCGAAT
GCGACAGTAGAGGCCTTCCACCGCCGAAAATTACTTGGTTTAAAGATAGC
AAAATGATAAATCACACAGTCGATCCAAGAGTTCAAATAAGTGAATCGTA
TTACAGTAGGAATGTGTATTCGGTTCTCAAGATCTACCCGGTGCAAGCTC
AGGATATCGGAGTTTACACTTGCAATTCCAGTTATTCATATCACGGCTTC
TCGAGATCAGTCGCTAGAAATATCACACCGGAATTTATTTTTCAACCCCG
ATTTCTCAAAATTGGTACTAACCTCAACGCAACTTCTCTCACTGATAAGA
GCGTCAATCTGAGTTGCTCAGTTTTTGGAGCATTTTCTAATCGTTTAACG
GTATCTTTTATCCATGAAGATTTCAACAATTCCATTTTTGAGTACACAAA
TAAATCAATGGGCAAATATTCAGTTGAAATGATCCAAGATAAACCAAATC
CATACATTTCCCATTATACACTTACAATATCCGATATTAAACCACAAGAC
GCAGGATCTTACTATTGTAAGGCAAGTGTTCGTTCGGATAAATATTTTAG
TTTATCTCACAATGGCATCGTCTCAGTATTGTATGCTCCTGAAATCCTTC
CGACCAAATCGACCCTTTATGGGTTATGGTACAAAAAGAATGTATTAAAG
TGTAAAGCAAAAGCCTATCCTAATCCAACATGGGAATGGACATTTCAAGA
TTACCCATTGCCTAACCAATTTAACCAATATCGCATGAAAACAATTAATA
ATAATGATACTTCAACATCCGAGTTGATAATATTGCCAAACTTTCAAAAT
GATGCAATATTTGGAACCTATGAGTGTTCTGCTAGAAATTCATTGGGGAA
CATTAGGAAGACAATTTCATTTTCTCAAGCTTGGCAGCCAGGTGCTCCAA
ATGTCAATGTTTGTAAGGTAACAGCCAGTACTATTCAACTTTGTGTGACA
CCGAATTCCGATTCGGGCGGTTTACCTCTAACTCATTATGAGATGCGTTT
TAAAGATTTTGAAGTTAATAGAGTCTTTGGGCCTTATTACTATCCTGTCA
ATCCGTCTACGATTACACTATCTCATTTGAAACCGAATACCCGATACAAA
CTTTCTTTATCAGCTGCCTCCGAAGCTGGAAGAGGAGCCAATACTGATAT
CGAGGTTATGACAAAGCATCTCGGACGGCCCGTTATTGAATTAGTCAATT
CATCTACTGCTGACTCTAAATCTTTTAATCTTCATTGGGTCGTTGATACA
GATGGTGGGGCACCAATAATTCGATACGATGTTGTCGTTCAACAGGTGGA
CGTTGATCCTTCAGACAATTCCAAAATCATCAATAGAATTGGAAATGTAA
AAAATTATATGGTCGATGATTTGGGTCAATTTAAACAAATGTTTCACGTG
AATAGTTTGAAGTCTAATACTTGGTATGAGTTGAACTTTACCGCAACTAA
TTCTTTTGGGCAATCTCCGATGCAAGAAGTTATTTTTCGTACTCTTGACG
AGCATGCGTTAGCCAAAGCTGAAGGATTGAAACAGTACTACAGTGAGGCA
GCCATTCTGATGCAGTCTCGACTCAGTCTCATGATGGCTGTTTTCTTATT
TCTCGTTCTCATTCATAATTAATCATTGAGTCCGTTATTAGACTTTCTAT
TAGCCATTTTTTCAATGTGTCATTTCAAGGTCATCTATTATTTTATCGGT
TTTTGATCCATAATACCATTTTAGGACAAAGTGATTGAAATAATTGATCC
GACTCTCTCTTTCTCTCTGTTGTTGATCCCATTTGATTTCTAGCATTGAT
ACAATTGTGCAGGTCACTACTGTTTTTCTTTATAATATCTTTTCTTGGAT
TACCAAACTTTATGATGAAAGCATTTTAATGAGAATACCGCGTAATTCTT
TTAAAGTAGAAATTAGATTTTCATATATTTATATTATGCATTTATATTAT
CAGAAACGTTATATATTAATTGTTTACTCAGATTATGTAGACGTTTGATT
TGAG
back to top

protein sequence of SMED30020684-orf-1

>SMED30020684-orf-1 ID=SMED30020684-orf-1|Name=SMED30020684-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=842bp
MIIHRNQIFILLNILVFNFMNVESNKYSECENLPANSIKILDHKNEMKVW
FGSEVSLTCCMKENLKFNDNSDFYEDDFEIANSKNSPPLIWYDPNMEPVV
NYFTDPQKAQTNKIFMIPDMLNKAKGIQVVHLIIKDFKPANNGIYKCDTV
QSNNKTPSKINIIGNPKVVIDSPRYQFIEEGKTGYINCTSRGHPRIDVVW
FFEGEHLSPDNHKFSFIENHQTLRISEVTERFRGKYLCKAEVSFDDQEDM
PPRGSFIEVLPIDVIVYKDPEISPDSPSVTVQKSETGIQGTIFEDGNLEI
ECDSRGLPPPKITWFKDSKMINHTVDPRVQISESYYSRNVYSVLKIYPVQ
AQDIGVYTCNSSYSYHGFSRSVARNITPEFIFQPRFLKIGTNLNATSLTD
KSVNLSCSVFGAFSNRLTVSFIHEDFNNSIFEYTNKSMGKYSVEMIQDKP
NPYISHYTLTISDIKPQDAGSYYCKASVRSDKYFSLSHNGIVSVLYAPEI
LPTKSTLYGLWYKKNVLKCKAKAYPNPTWEWTFQDYPLPNQFNQYRMKTI
NNNDTSTSELIILPNFQNDAIFGTYECSARNSLGNIRKTISFSQAWQPGA
PNVNVCKVTASTIQLCVTPNSDSGGLPLTHYEMRFKDFEVNRVFGPYYYP
VNPSTITLSHLKPNTRYKLSLSAASEAGRGANTDIEVMTKHLGRPVIELV
NSSTADSKSFNLHWVVDTDGGAPIIRYDVVVQQVDVDPSDNSKIINRIGN
VKNYMVDDLGQFKQMFHVNSLKSNTWYELNFTATNSFGQSPMQEVIFRTL
DEHALAKAEGLKQYYSEAAILMQSRLSLMMAVFLFLVLIHN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000025nervous system
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR036116FN3_sf
IPR003961FN3_dom
IPR003598Ig_sub2
IPR003599Ig_sub
IPR013783Ig-like_fold
IPR013098Ig_I-set
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 516..584
e-value: 0.16
score: 14.8
coord: 179..245
e-value: 0.0043
score: 26.3
coord: 293..366
e-value: 1.1E-6
score: 38.2
coord: 398..481
e-value: 0.35
score: 11.5
IPR003961Fibronectin type IIISMARTSM00060FN3_2coord: 598..680
e-value: 3.4E-4
score: 29.9
coord: 693..790
e-value: 0.35
score: 19.9
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 597..695
score: 14.414
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 696..803
score: 9.31
IPR003961Fibronectin type IIICDDcd00063FN3coord: 598..689
e-value: 1.21415E-7
score: 48.2615
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 287..377
e-value: 0.0014
score: 27.8
coord: 392..495
e-value: 9.5E-5
score: 31.8
coord: 44..171
e-value: 38.0
score: 6.5
coord: 173..267
e-value: 0.05
score: 22.7
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 385..492
e-value: 3.1E-10
score: 42.0
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 276..373
e-value: 1.1E-13
score: 53.1
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 699..806
e-value: 1.0E-10
score: 43.6
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 493..602
e-value: 1.1E-13
score: 53.2
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 164..250
e-value: 1.6E-12
score: 49.3
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 603..698
e-value: 9.9E-9
score: 37.4
NoneNo IPR availablePFAMPF13927Ig_3coord: 277..360
e-value: 2.3E-11
score: 44.1
coord: 515..581
e-value: 2.9E-7
score: 31.0
NoneNo IPR availablePANTHERPTHR12231CTX-RELATED TYPE I TRANSMEMBRANE PROTEINcoord: 454..742
coord: 114..411
coord: 278..477
NoneNo IPR availableCDDcd00096Igcoord: 516..591
e-value: 3.41258E-9
score: 51.8592
NoneNo IPR availableCDDcd00096Igcoord: 298..372
e-value: 2.00009E-10
score: 55.326
NoneNo IPR availableCDDcd00096Igcoord: 186..241
e-value: 8.89394E-8
score: 48.0072
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.69
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 398..482
e-value: 1.3E-5
score: 25.2
coord: 172..248
e-value: 2.2E-12
score: 46.8
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 166..241
score: 11.007
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 270..377
score: 12.096
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 34..163
score: 7.667
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 384..485
score: 9.718
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 498..593
score: 7.994
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 291..366
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 396..500
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 166..241
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 494..599
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 598..799