GP-PDE domain-containing protein

Overview
NameGP-PDE domain-containing protein
Smed IDSMED30020676
Length (bp)1000
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GP-PDE domain-containing protein (SMED30020676) t-SNE clustered cells

Violin plots show distribution of expression levels for GP-PDE domain-containing protein (SMED30020676) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GP-PDE domain-containing protein (SMED30020676) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GP-PDE domain-containing protein (SMED30020676) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020676

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30020676h1SMcG0003595 Contig53998newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020676h1SMcG0003595 Contig53998uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GP-PDE domain-containing protein vs. Ensembl Human
Match: GDPD1 (glycerophosphodiester phosphodiesterase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:20883])

HSP 1 Score: 67.781 bits (164), Expect = 1.510e-13
Identity = 30/53 (56.60%), Postives = 39/53 (73.58%), Query Frame = 3
Query:  711 LLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLN 869
            LLMR +L  HL  RGI  Y+WV N +Q+++ AF+ GA GVMTD+PT LR FL+
Sbjct:   65 LLMRKALFDHLTARGIQVYIWVLNEEQEYKRAFDLGATGVMTDYPTKLRDFLH 117          
BLAST of GP-PDE domain-containing protein vs. Ensembl Human
Match: GDPD1 (glycerophosphodiester phosphodiesterase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:20883])

HSP 1 Score: 68.5514 bits (166), Expect = 1.923e-12
Identity = 30/53 (56.60%), Postives = 39/53 (73.58%), Query Frame = 3
Query:  711 LLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLN 869
            LLMR +L  HL  RGI  Y+WV N +Q+++ AF+ GA GVMTD+PT LR FL+
Sbjct:  258 LLMRKALFDHLTARGIQVYIWVLNEEQEYKRAFDLGATGVMTDYPTKLRDFLH 310          
BLAST of GP-PDE domain-containing protein vs. Ensembl Human
Match: GDPD3 (glycerophosphodiester phosphodiesterase domain containing 3 [Source:HGNC Symbol;Acc:HGNC:28638])

HSP 1 Score: 63.5438 bits (153), Expect = 8.263e-11
Identity = 27/53 (50.94%), Postives = 36/53 (67.92%), Query Frame = 3
Query:  711 LLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLN 869
            L+MR SLIRHL +RG+    W  N +  F+ AF  GA GV+TD+PT LR +L+
Sbjct:  257 LIMRKSLIRHLEERGVQVVFWCLNEESDFEAAFSVGATGVITDYPTALRHYLD 309          
BLAST of GP-PDE domain-containing protein vs. Ensembl Zebrafish
Match: gdpd1 (glycerophosphodiester phosphodiesterase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-040822-22])

HSP 1 Score: 71.633 bits (174), Expect = 1.115e-13
Identity = 30/56 (53.57%), Postives = 41/56 (73.21%), Query Frame = 3
Query:  708 RLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLNEN 875
            ++LMR SL  HL  RGI  Y+WV N ++ FQ AF+ GA GVMTD+PT L++F+ +N
Sbjct:  256 KVLMRKSLFDHLTGRGIQVYIWVLNDEEDFQRAFDLGATGVMTDYPTKLKEFMEKN 311          
BLAST of GP-PDE domain-containing protein vs. Ensembl Zebrafish
Match: gdpd1 (glycerophosphodiester phosphodiesterase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-040822-22])

HSP 1 Score: 71.633 bits (174), Expect = 1.115e-13
Identity = 30/56 (53.57%), Postives = 41/56 (73.21%), Query Frame = 3
Query:  708 RLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLNEN 875
            ++LMR SL  HL  RGI  Y+WV N ++ FQ AF+ GA GVMTD+PT L++F+ +N
Sbjct:  256 KVLMRKSLFDHLTGRGIQVYIWVLNDEEDFQRAFDLGATGVMTDYPTKLKEFMEKN 311          
BLAST of GP-PDE domain-containing protein vs. Ensembl Zebrafish
Match: gdpd3a (glycerophosphodiester phosphodiesterase domain containing 3a [Source:ZFIN;Acc:ZDB-GENE-040426-2279])

HSP 1 Score: 68.9366 bits (167), Expect = 9.214e-13
Identity = 30/59 (50.85%), Postives = 42/59 (71.19%), Query Frame = 3
Query:  690 VIYALFRLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFL 866
            VI+ + RL MR +L +HL +RGI  +++VCN +Q    AF AGA GVMTD+PTLL  ++
Sbjct:  250 VIFLIERLTMRKALFKHLRERGIQIHLFVCNEEQDIDAAFAAGATGVMTDYPTLLSNYI 308          
BLAST of GP-PDE domain-containing protein vs. Ensembl Zebrafish
Match: gdpd3b (glycerophosphodiester phosphodiesterase domain containing 3b [Source:ZFIN;Acc:ZDB-GENE-121210-2])

HSP 1 Score: 57.3806 bits (137), Expect = 5.929e-9
Identity = 26/63 (41.27%), Postives = 39/63 (61.90%), Query Frame = 3
Query:  690 VIYALFRLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLNENP 878
            V+Y L +L+   SL  HL  RG+   ++VCN +     AF  GA GVMTD+PT+L  ++ ++P
Sbjct:  252 VVYLLQKLITWKSLFEHLIKRGLQVQLFVCNEETDMAAAFAMGATGVMTDYPTVLSDYIRKHP 314          
BLAST of GP-PDE domain-containing protein vs. Ensembl Zebrafish
Match: gdpd3b (glycerophosphodiester phosphodiesterase domain containing 3b [Source:ZFIN;Acc:ZDB-GENE-121210-2])

HSP 1 Score: 57.3806 bits (137), Expect = 6.112e-9
Identity = 26/63 (41.27%), Postives = 39/63 (61.90%), Query Frame = 3
Query:  690 VIYALFRLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLNENP 878
            V+Y L +L+   SL  HL  RG+   ++VCN +     AF  GA GVMTD+PT+L  ++ ++P
Sbjct:  245 VVYLLQKLITWKSLFEHLIKRGLQVQLFVCNEETDMAAAFAMGATGVMTDYPTVLSDYIRKHP 307          
BLAST of GP-PDE domain-containing protein vs. Ensembl Xenopus
Match: ddc (dopa decarboxylase [Source:Xenbase;Acc:XB-GENE-983285])

HSP 1 Score: 65.855 bits (159), Expect = 1.472e-11
Identity = 27/65 (41.54%), Postives = 44/65 (67.69%), Query Frame = 3
Query:  690 VIYALFRLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLNENPKY 884
            V++    L+MR +L  HL  RGI  Y+WV N  ++++ AF+ GA G+MTD+PT L++FL ++  +
Sbjct:  237 VVWLADALIMRKALFDHLKARGIQVYIWVLNNDEEYKRAFDLGATGIMTDYPTRLKEFLEKHSHF 301          
BLAST of GP-PDE domain-containing protein vs. Ensembl Xenopus
Match: ddc (dopa decarboxylase [Source:Xenbase;Acc:XB-GENE-983285])

HSP 1 Score: 65.855 bits (159), Expect = 1.567e-11
Identity = 27/65 (41.54%), Postives = 44/65 (67.69%), Query Frame = 3
Query:  690 VIYALFRLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLNENPKY 884
            V++    L+MR +L  HL  RGI  Y+WV N  ++++ AF+ GA G+MTD+PT L++FL ++  +
Sbjct:  250 VVWLADALIMRKALFDHLKARGIQVYIWVLNNDEEYKRAFDLGATGIMTDYPTRLKEFLEKHSHF 314          
BLAST of GP-PDE domain-containing protein vs. Ensembl Xenopus
Match: ddc (dopa decarboxylase [Source:Xenbase;Acc:XB-GENE-983285])

HSP 1 Score: 65.855 bits (159), Expect = 1.567e-11
Identity = 27/65 (41.54%), Postives = 44/65 (67.69%), Query Frame = 3
Query:  690 VIYALFRLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLNENPKY 884
            V++    L+MR +L  HL  RGI  Y+WV N  ++++ AF+ GA G+MTD+PT L++FL ++  +
Sbjct:  250 VVWLADALIMRKALFDHLKARGIQVYIWVLNNDEEYKRAFDLGATGIMTDYPTRLKEFLEKHSHF 314          
BLAST of GP-PDE domain-containing protein vs. Ensembl Xenopus
Match: ddc (dopa decarboxylase [Source:Xenbase;Acc:XB-GENE-983285])

HSP 1 Score: 65.855 bits (159), Expect = 1.567e-11
Identity = 27/65 (41.54%), Postives = 44/65 (67.69%), Query Frame = 3
Query:  690 VIYALFRLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLNENPKY 884
            V++    L+MR +L  HL  RGI  Y+WV N  ++++ AF+ GA G+MTD+PT L++FL ++  +
Sbjct:  250 VVWLADALIMRKALFDHLKARGIQVYIWVLNNDEEYKRAFDLGATGIMTDYPTRLKEFLEKHSHF 314          
BLAST of GP-PDE domain-containing protein vs. Ensembl Mouse
Match: Gdpd1 (glycerophosphodiester phosphodiesterase domain containing 1 [Source:MGI Symbol;Acc:MGI:1913819])

HSP 1 Score: 67.0106 bits (162), Expect = 4.210e-12
Identity = 30/53 (56.60%), Postives = 38/53 (71.70%), Query Frame = 3
Query:  711 LLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLN 869
            LLMR +L  HL  RGI  YVWV N + +++ AF+ GA GVMTD+PT L+ FLN
Sbjct:  258 LLMRKALFDHLTARGIQVYVWVLNEEYEYKRAFDLGATGVMTDYPTKLKDFLN 310          
BLAST of GP-PDE domain-containing protein vs. Ensembl Mouse
Match: Gdpd3 (glycerophosphodiester phosphodiesterase domain containing 3 [Source:MGI Symbol;Acc:MGI:1915866])

HSP 1 Score: 66.2402 bits (160), Expect = 7.437e-12
Identity = 29/63 (46.03%), Postives = 40/63 (63.49%), Query Frame = 3
Query:  711 LLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLNENPKYLHYPK 899
            ++MR SLIRHL DRG+    W  N +  F+ AF  GA GVMTD+PT LR +L++  +    P+
Sbjct:  257 IIMRKSLIRHLQDRGVQVLFWCLNEESDFEVAFSLGANGVMTDYPTALRHYLDKQEEETQPPQ 319          
BLAST of GP-PDE domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8N9F7|GDPD1_HUMAN (Lysophospholipase D GDPD1 OS=Homo sapiens OX=9606 GN=GDPD1 PE=1 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 9.233e-12
Identity = 30/53 (56.60%), Postives = 39/53 (73.58%), Query Frame = 3
Query:  711 LLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLN 869
            LLMR +L  HL  RGI  Y+WV N +Q+++ AF+ GA GVMTD+PT LR FL+
Sbjct:  258 LLMRKALFDHLTARGIQVYIWVLNEEQEYKRAFDLGATGVMTDYPTKLRDFLH 310          
BLAST of GP-PDE domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0VGK4|GDPD1_RAT (Lysophospholipase D GDPD1 OS=Rattus norvegicus OX=10116 GN=Gdpd1 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.246e-11
Identity = 29/53 (54.72%), Postives = 39/53 (73.58%), Query Frame = 3
Query:  711 LLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLN 869
            LLMR +L  HL  RGI  Y+WV N + +++ AF+ GA GVMTD+PT L++FLN
Sbjct:  258 LLMRKALFDHLTARGIQVYIWVLNEEHEYKRAFDLGATGVMTDYPTKLKEFLN 310          
BLAST of GP-PDE domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9CRY7|GDPD1_MOUSE (Lysophospholipase D GDPD1 OS=Mus musculus OX=10090 GN=Gdpd1 PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 2.945e-11
Identity = 30/53 (56.60%), Postives = 38/53 (71.70%), Query Frame = 3
Query:  711 LLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLN 869
            LLMR +L  HL  RGI  YVWV N + +++ AF+ GA GVMTD+PT L+ FLN
Sbjct:  258 LLMRKALFDHLTARGIQVYVWVLNEEYEYKRAFDLGATGVMTDYPTKLKDFLN 310          
BLAST of GP-PDE domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99LY2|GDPD3_MOUSE (Lysophospholipase D GDPD3 OS=Mus musculus OX=10090 GN=Gdpd3 PE=1 SV=2)

HSP 1 Score: 66.2402 bits (160), Expect = 5.202e-11
Identity = 29/63 (46.03%), Postives = 40/63 (63.49%), Query Frame = 3
Query:  711 LLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLNENPKYLHYPK 899
            ++MR SLIRHL DRG+    W  N +  F+ AF  GA GVMTD+PT LR +L++  +    P+
Sbjct:  257 IIMRKSLIRHLQDRGVQVLFWCLNEESDFEVAFSLGANGVMTDYPTALRHYLDKQEEETQPPQ 319          
BLAST of GP-PDE domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7L5L3|GDPD3_HUMAN (Lysophospholipase D GDPD3 OS=Homo sapiens OX=9606 GN=GDPD3 PE=2 SV=3)

HSP 1 Score: 63.5438 bits (153), Expect = 3.968e-10
Identity = 27/53 (50.94%), Postives = 36/53 (67.92%), Query Frame = 3
Query:  711 LLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLN 869
            L+MR SLIRHL +RG+    W  N +  F+ AF  GA GV+TD+PT LR +L+
Sbjct:  257 LIMRKSLIRHLEERGVQVVFWCLNEESDFEAAFSVGATGVITDYPTALRHYLD 309          
BLAST of GP-PDE domain-containing protein vs. TrEMBL
Match: A0A267FLU4 (GP-PDE domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004934g5 PE=4 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 5.644e-16
Identity = 40/70 (57.14%), Postives = 51/70 (72.86%), Query Frame = 3
Query:  681 FSNVIYALF-RLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLNENPKYL 887
            F   +  +F +L+M P LIRHLH+RG+PTYVWV N +Q F  AF+AG EGVMTD P LLR+F++ NP  L
Sbjct:  249 FGRCLVRIFDKLMMSPKLIRHLHERGVPTYVWVLNQEQHFLKAFQAGCEGVMTDRPELLRRFIDSNPDCL 318          
BLAST of GP-PDE domain-containing protein vs. TrEMBL
Match: A0A267E404 (GP-PDE domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004934g3 PE=4 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.267e-15
Identity = 38/59 (64.41%), Postives = 46/59 (77.97%), Query Frame = 3
Query:  711 LLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLNENPKYL 887
            L+M P LIRHLH+RG+PTYVWV N +Q F  AF+AG EGVMTD P LLR+F++ NP  L
Sbjct:  264 LMMSPKLIRHLHERGVPTYVWVLNQEQHFLKAFQAGCEGVMTDRPELLRRFIDSNPDCL 322          
BLAST of GP-PDE domain-containing protein vs. TrEMBL
Match: A0A1I8HS37 (GP-PDE domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.292e-15
Identity = 38/59 (64.41%), Postives = 46/59 (77.97%), Query Frame = 3
Query:  711 LLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLNENPKYL 887
            L+M P LIRHLH+RG+PTYVWV N +Q F  AF+AG EGVMTD P LLR+F++ NP  L
Sbjct:  267 LMMSPKLIRHLHERGVPTYVWVLNQEQHFLKAFQAGCEGVMTDRPELLRRFIDSNPDCL 325          
BLAST of GP-PDE domain-containing protein vs. TrEMBL
Match: A0A1I8II71 (GP-PDE domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.037e-15
Identity = 39/70 (55.71%), Postives = 51/70 (72.86%), Query Frame = 3
Query:  681 FSNVIYALF-RLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLNENPKYL 887
            F   +  +F +L+M P LIRHLH+RG+PTYVWV N ++ F  AF+AG EGVMTD P LLR+F++ NP  L
Sbjct:  256 FGRCLVRIFDKLMMSPKLIRHLHERGVPTYVWVLNQERHFLKAFQAGCEGVMTDRPELLRRFIDSNPDCL 325          
BLAST of GP-PDE domain-containing protein vs. TrEMBL
Match: A0A5J4NJU3 (Lysophospholipase D (Fragment) OS=Paragonimus westermani OX=34504 GN=DEA37_0000285 PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 4.717e-15
Identity = 34/58 (58.62%), Postives = 43/58 (74.14%), Query Frame = 3
Query:  711 LLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLNENPKY 884
            L+  P  I+HL  RGIP ++WVCNT  +FQ AF+ GA GVMTDFPT L+ FLN NP++
Sbjct:  141 LIASPGFIQHLKRRGIPVFIWVCNTDSEFQTAFDMGASGVMTDFPTRLQSFLNANPEF 198          
BLAST of GP-PDE domain-containing protein vs. Ensembl Cavefish
Match: gdpd1 (glycerophosphodiester phosphodiesterase domain containing 1 [Source:NCBI gene;Acc:103036870])

HSP 1 Score: 69.3218 bits (168), Expect = 5.038e-13
Identity = 30/55 (54.55%), Postives = 40/55 (72.73%), Query Frame = 3
Query:  711 LLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLNEN 875
            LLMR +L  HL  RGI  Y+WV N ++ F+ AF+ GA GVMTD+PT L++FL +N
Sbjct:  237 LLMRKALFDHLTARGIQIYIWVLNDEEDFKRAFDLGATGVMTDYPTKLKEFLEKN 291          
BLAST of GP-PDE domain-containing protein vs. Ensembl Cavefish
Match: gdpd1 (glycerophosphodiester phosphodiesterase domain containing 1 [Source:NCBI gene;Acc:103036870])

HSP 1 Score: 69.3218 bits (168), Expect = 6.448e-13
Identity = 30/55 (54.55%), Postives = 40/55 (72.73%), Query Frame = 3
Query:  711 LLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLNEN 875
            LLMR +L  HL  RGI  Y+WV N ++ F+ AF+ GA GVMTD+PT L++FL +N
Sbjct:  257 LLMRKALFDHLTARGIQIYIWVLNDEEDFKRAFDLGATGVMTDYPTKLKEFLEKN 311          
BLAST of GP-PDE domain-containing protein vs. Ensembl Cavefish
Match: gdpd3a (glycerophosphodiester phosphodiesterase domain-containing protein 3 [Source:NCBI gene;Acc:103040887])

HSP 1 Score: 64.3142 bits (155), Expect = 2.627e-11
Identity = 29/59 (49.15%), Postives = 39/59 (66.10%), Query Frame = 3
Query:  690 VIYALFRLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFL 866
            VI  + +L +R  L +HL DRGI  +++VCN  Q  + A  AGA GVMTD+PTLL  +L
Sbjct:  250 VISLIEKLTLRKGLFQHLKDRGIQIHLFVCNEDQDIEAALAAGATGVMTDYPTLLSNYL 308          
BLAST of GP-PDE domain-containing protein vs. Ensembl Cavefish
Match: gdpd3b (glycerophosphodiester phosphodiesterase domain containing 3b [Source:ZFIN;Acc:ZDB-GENE-121210-2])

HSP 1 Score: 56.9954 bits (136), Expect = 5.876e-9
Identity = 27/68 (39.71%), Postives = 40/68 (58.82%), Query Frame = 3
Query:  675 IVFSNVIYALFRLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLNENP 878
            I+ +  + +L  L MR SL  HL  RG+   ++VCN +     AF  GA GVM+D+P LL ++L  +P
Sbjct:  223 ILKNRFVVSLIELTMRKSLFDHLVKRGM--QLFVCNEESDMDAAFSVGATGVMSDYPALLSEYLKNHP 288          
BLAST of GP-PDE domain-containing protein vs. Ensembl Sea Lamprey
Match: gdpd1 (glycerophosphodiester phosphodiesterase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-040822-22])

HSP 1 Score: 70.4774 bits (171), Expect = 1.161e-14
Identity = 30/59 (50.85%), Postives = 40/59 (67.80%), Query Frame = 3
Query:  708 RLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLNENPKY 884
            R+LM  +L +HL  RGI  Y+WV N  +  + AF  GA GVMTDFPT L+ FL ++P+Y
Sbjct:  136 RILMSKTLFKHLERRGIQVYLWVLNDDEDIERAFRLGATGVMTDFPTKLKHFLEQHPEY 194          
BLAST of GP-PDE domain-containing protein vs. Ensembl Nematostella
Match: EDO29566 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T397])

HSP 1 Score: 66.6254 bits (161), Expect = 5.328e-14
Identity = 33/63 (52.38%), Postives = 42/63 (66.67%), Query Frame = 3
Query:  696 YALFRLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEA-GAEGVMTDFPTLLRQFLNENPK 881
            YA   LL+ P LIRHL  RGI TY+WV N + +F  AFE  GA GVMTD+PT L  ++ ++ K
Sbjct:   35 YAADWLLLSPILIRHLRKRGIQTYIWVLNKKDEFTLAFEKLGAAGVMTDYPTELSDYVEQSVK 97          
BLAST of GP-PDE domain-containing protein vs. Ensembl Nematostella
Match: EDO30363 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T110])

HSP 1 Score: 65.855 bits (159), Expect = 2.255e-12
Identity = 33/63 (52.38%), Postives = 42/63 (66.67%), Query Frame = 3
Query:  696 YALFRLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEA-GAEGVMTDFPTLLRQFLNENPK 881
            YA   LL+ P LIRHL  RGI TY+WV N + +F  AFE  GA GVMTD+PT L  ++ ++ K
Sbjct:  213 YAADWLLLSPILIRHLRKRGIQTYIWVLNKKDEFTLAFEKLGAAGVMTDYPTELSDYVEQSVK 275          
BLAST of GP-PDE domain-containing protein vs. Ensembl Nematostella
Match: EDO29567 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T398])

HSP 1 Score: 56.6102 bits (135), Expect = 2.343e-9
Identity = 25/55 (45.45%), Postives = 38/55 (69.09%), Query Frame = 3
Query:  711 LLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEA-GAEGVMTDFPTLLRQFLNE 872
            L++RP+L +HL  RGI T++WV N   +F+ AFE     GVMTD+P+ L ++L +
Sbjct:  203 LMIRPTLFQHLAKRGIQTFLWVLNEDDEFELAFEKLKVAGVMTDYPSKLSEYLEK 257          
BLAST of GP-PDE domain-containing protein vs. Ensembl Nematostella
Match: EDO30362 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T109])

HSP 1 Score: 56.6102 bits (135), Expect = 3.654e-9
Identity = 25/55 (45.45%), Postives = 38/55 (69.09%), Query Frame = 3
Query:  711 LLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEA-GAEGVMTDFPTLLRQFLNE 872
            L++RP+L +HL  RGI T++WV N   +F+ AFE     GVMTD+P+ L ++L +
Sbjct:  257 LMIRPTLFQHLAKRGIQTFLWVLNEDDEFELAFEKLKVAGVMTDYPSKLSEYLEK 311          
BLAST of GP-PDE domain-containing protein vs. Ensembl Medaka
Match: gdpd1 (glycerophosphodiester phosphodiesterase domain containing 1 [Source:NCBI gene;Acc:101174208])

HSP 1 Score: 71.2478 bits (173), Expect = 1.080e-13
Identity = 31/55 (56.36%), Postives = 40/55 (72.73%), Query Frame = 3
Query:  711 LLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLNEN 875
            LLMR +L +HL  RGI  Y+WV N ++ FQ AF+ GA GVMTDFPT L+ F++ N
Sbjct:  237 LLMRKALFQHLTARGIQVYIWVLNDEEDFQRAFDLGATGVMTDFPTKLKDFMDRN 291          
BLAST of GP-PDE domain-containing protein vs. Ensembl Medaka
Match: gdpd1 (glycerophosphodiester phosphodiesterase domain containing 1 [Source:NCBI gene;Acc:101174208])

HSP 1 Score: 71.633 bits (174), Expect = 1.445e-13
Identity = 32/62 (51.61%), Postives = 43/62 (69.35%), Query Frame = 3
Query:  690 VIYALFRLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLNEN 875
            +I+    LLMR +L +HL  RGI  Y+WV N ++ FQ AF+ GA GVMTDFPT L+ F++ N
Sbjct:  317 IIWLADTLLMRKALFQHLTARGIQVYIWVLNDEEDFQRAFDLGATGVMTDFPTKLKDFMDRN 378          
BLAST of GP-PDE domain-containing protein vs. Ensembl Medaka
Match: gdpd3a (glycerophosphodiester phosphodiesterase domain containing 3a [Source:ZFIN;Acc:ZDB-GENE-040426-2279])

HSP 1 Score: 57.7658 bits (138), Expect = 3.436e-9
Identity = 25/51 (49.02%), Postives = 35/51 (68.63%), Query Frame = 3
Query:  711 LLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQF 863
            L MR SL +HL  RGI  +++VCN ++  + A E GA GVMTD+P+LL  +
Sbjct:  225 LTMRRSLFQHLAARGIQVHLFVCNEEEDIKAAMEVGATGVMTDYPSLLSTY 275          
BLAST of GP-PDE domain-containing protein vs. Ensembl Medaka
Match: gdpd3a (glycerophosphodiester phosphodiesterase domain containing 3a [Source:ZFIN;Acc:ZDB-GENE-040426-2279])

HSP 1 Score: 57.7658 bits (138), Expect = 3.938e-9
Identity = 25/58 (43.10%), Postives = 38/58 (65.52%), Query Frame = 3
Query:  690 VIYALFRLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQF 863
             +  L ++ MR SL +HL  RGI  +++VCN ++  + A E GA GVMTD+P+LL  +
Sbjct:  259 AVSLLEKVTMRRSLFQHLAARGIQVHLFVCNEEEDIKAAMEVGATGVMTDYPSLLSTY 316          
BLAST of GP-PDE domain-containing protein vs. Planmine SMEST
Match: SMESG000044810.1 (SMESG000044810.1)

HSP 1 Score: 171.4 bits (433), Expect = 1.496e-52
Identity = 79/85 (92.94%), Postives = 83/85 (97.65%), Query Frame = 3
Query:  690 VIYALFRLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLNENPKYLHYPKENDMLISNRGDLPPP 944
            +I+ + +LLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLNENPKYLHYPKENDMLISNRGDLPPP
Sbjct:   86 IIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLNENPKYLHYPKENDMLISNRGDLPPP 170          
BLAST of GP-PDE domain-containing protein vs. Planmine SMEST
Match: SMESG000031141.1 (SMESG000031141.1)

HSP 1 Score: 167.548 bits (423), Expect = 4.556e-51
Identity = 77/85 (90.59%), Postives = 82/85 (96.47%), Query Frame = 3
Query:  690 VIYALFRLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLNENPKYLHYPKENDMLISNRGDLPPP 944
            +I+ + +LLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTD+PTLL QFLNENPKYLHYPKENDMLISNRGDLPPP
Sbjct:   86 IIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNENPKYLHYPKENDMLISNRGDLPPP 170          
The following BLAST results are available for this feature:
BLAST of GP-PDE domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
GDPD11.510e-1356.60glycerophosphodiester phosphodiesterase domain con... [more]
GDPD11.923e-1256.60glycerophosphodiester phosphodiesterase domain con... [more]
GDPD38.263e-1150.94glycerophosphodiester phosphodiesterase domain con... [more]
back to top
BLAST of GP-PDE domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GP-PDE domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GP-PDE domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gdpd11.115e-1353.57glycerophosphodiester phosphodiesterase domain con... [more]
gdpd11.115e-1353.57glycerophosphodiester phosphodiesterase domain con... [more]
gdpd3a9.214e-1350.85glycerophosphodiester phosphodiesterase domain con... [more]
gdpd3b5.929e-941.27glycerophosphodiester phosphodiesterase domain con... [more]
gdpd3b6.112e-941.27glycerophosphodiester phosphodiesterase domain con... [more]
back to top
BLAST of GP-PDE domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ddc1.472e-1141.54dopa decarboxylase [Source:Xenbase;Acc:XB-GENE-983... [more]
ddc1.567e-1141.54dopa decarboxylase [Source:Xenbase;Acc:XB-GENE-983... [more]
ddc1.567e-1141.54dopa decarboxylase [Source:Xenbase;Acc:XB-GENE-983... [more]
ddc1.567e-1141.54dopa decarboxylase [Source:Xenbase;Acc:XB-GENE-983... [more]
back to top
BLAST of GP-PDE domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Gdpd14.210e-1256.60glycerophosphodiester phosphodiesterase domain con... [more]
Gdpd37.437e-1246.03glycerophosphodiester phosphodiesterase domain con... [more]
back to top
BLAST of GP-PDE domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8N9F7|GDPD1_HUMAN9.233e-1256.60Lysophospholipase D GDPD1 OS=Homo sapiens OX=9606 ... [more]
sp|Q0VGK4|GDPD1_RAT1.246e-1154.72Lysophospholipase D GDPD1 OS=Rattus norvegicus OX=... [more]
sp|Q9CRY7|GDPD1_MOUSE2.945e-1156.60Lysophospholipase D GDPD1 OS=Mus musculus OX=10090... [more]
sp|Q99LY2|GDPD3_MOUSE5.202e-1146.03Lysophospholipase D GDPD3 OS=Mus musculus OX=10090... [more]
sp|Q7L5L3|GDPD3_HUMAN3.968e-1050.94Lysophospholipase D GDPD3 OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of GP-PDE domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FLU45.644e-1657.14GP-PDE domain-containing protein (Fragment) OS=Mac... [more]
A0A267E4041.267e-1564.41GP-PDE domain-containing protein (Fragment) OS=Mac... [more]
A0A1I8HS371.292e-1564.41GP-PDE domain-containing protein OS=Macrostomum li... [more]
A0A1I8II712.037e-1555.71GP-PDE domain-containing protein OS=Macrostomum li... [more]
A0A5J4NJU34.717e-1558.62Lysophospholipase D (Fragment) OS=Paragonimus west... [more]
back to top
BLAST of GP-PDE domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gdpd15.038e-1354.55glycerophosphodiester phosphodiesterase domain con... [more]
gdpd16.448e-1354.55glycerophosphodiester phosphodiesterase domain con... [more]
gdpd3a2.627e-1149.15glycerophosphodiester phosphodiesterase domain-con... [more]
gdpd3b5.876e-939.71glycerophosphodiester phosphodiesterase domain con... [more]
back to top
BLAST of GP-PDE domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gdpd11.161e-1450.85glycerophosphodiester phosphodiesterase domain con... [more]
back to top
BLAST of GP-PDE domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GP-PDE domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO295665.328e-1452.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303632.255e-1252.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO295672.343e-945.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303623.654e-945.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GP-PDE domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gdpd11.080e-1356.36glycerophosphodiester phosphodiesterase domain con... [more]
gdpd11.445e-1351.61glycerophosphodiester phosphodiesterase domain con... [more]
gdpd3a3.436e-949.02glycerophosphodiester phosphodiesterase domain con... [more]
gdpd3a3.938e-943.10glycerophosphodiester phosphodiesterase domain con... [more]
back to top
BLAST of GP-PDE domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000044810.11.496e-5292.94SMESG000044810.1[more]
SMESG000031141.14.556e-5190.59SMESG000031141.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020676 ID=SMED30020676|Name=GP-PDE domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1000bp
CATAATTTCCGGTAATCTATCATCATTTTCTGAATTTCTTAAAATAGCTT
TAAACTTGAATTTTATTAAATAAATTATAATTTACATGGTCCTCTTTGTC
CTTATTTTACTCATGGACAGGTGAAATGGGAGAAACGTTTGAAATATCCT
CAAATTTTAAATCTTTACAATTTAAAATGCCTCCAATAATTTTTGTCCTA
TTTGTGTGTATTTTTATTATAGAGTTGTGGCGTATTGTGTATGTGATTTT
ATTTTATTTTAACCATAAAAATATAAATATAAAACATCTACAGTTTACTC
AAAATTTCTTCTTTCAATAGACATTTTTTAAATAATCTTTTGATATTGGG
AAATAATTTCTCAAAAATGTTTACGAAGGTCTTCTTGGATTTGTTGACTG
ATAACATGTCGAATATTGGAAGATATTGAAGACAAAGAGCTTTTAATCTT
ATCCCTTTTTTATTTTTTCTAAAATACAATTATTATAATCTAGTTTTTTA
AATAATTATTCAAGATGCAGTCTAATGACAATTTAGATTCTATTTAATGT
CCTTTGATGTAAATGCATAATCTTTGTCCATATTTCAAGTAAATGTGTGT
ATTTTGGGATAATGCTCTGCATAATTTATGATAACTGGTATATAATTACA
CAACAATGTAATATGGCAATACATATTGTTTTCTCAAATGTCATTTATGC
TTTGTTCAGATTGTTAATGCGACCATCGCTAATAAGACATTTGCACGATC
GTGGAATTCCAACTTACGTGTGGGTTTGTAATACTCAGCAACAGTTCCAA
GATGCGTTTGAAGCAGGAGCTGAAGGTGTCATGACAGATTTTCCTACTTT
ATTAAGGCAATTCCTCAATGAAAATCCAAAATATTTACATTATCCAAAAG
AAAATGATATGCTCATATCAAACCGTGGAGATCTGCCTCCCCCTTGAGGA
ATTTTATCAGTTTTTAGGAATATTTAAGTTTAAATGCAAAAGATCGGAAG
back to top

protein sequence of SMED30020676-orf-1

>SMED30020676-orf-1 ID=SMED30020676-orf-1|Name=SMED30020676-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=112bp
MLCIIYDNWYIITQQCNMAIHIVFSNVIYALFRLLMRPSLIRHLHDRGIP
TYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLNENPKYLHYPKENDM
LISNRGDLPPP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR017946PLC-like_Pdiesterase_TIM-brl
IPR030395GP_PDE_dom
Vocabulary: biological process
TermDefinition
GO:0006629lipid metabolic process
Vocabulary: molecular function
TermDefinition
GO:0008081phosphoric diester hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane