Glutamine-rich protein 2

Overview
NameGlutamine-rich protein 2
Smed IDSMED30020666
Length (bp)3265
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020666

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30020666SMESG000081231.1 SmedASXL_007976SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30020666SMESG000081231.1 dd_Smed_v4_6048_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30020666SMESG000081231.1 dd_Smed_v4_6048_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30020666SMESG000081231.1 dd_Smed_v4_6048_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30020666SMESG000081231.1 dd_Smed_v4_6048_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020666SMESG000081231.1 dd_Smed_v4_6048_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30020666SMESG000081231.1 dd_Smed_v4_6048_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutamine-rich protein 2 vs. Ensembl Human
Match: QRICH2 (glutamine rich 2 [Source:HGNC Symbol;Acc:HGNC:25326])

HSP 1 Score: 144.436 bits (363), Expect = 4.869e-34
Identity = 108/363 (29.75%), Postives = 176/363 (48.48%), Query Frame = 3
Query: 1674 KNRDGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVXXXXXXXXXXXXXXXXXXXXDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLD--IMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNK-----------------NMYIHNHTKRFQDVRVINPKYVSYGA---------------------------DIVD-VYQT-PRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTLKEEADLTGADGHIYKGRID 2618
            + +D E L R++  +  +Q     +N T   L  +H+     +  L+   +  E  KA+  ++E  +  KADKS L TKV+   FD T   L+ ++ +++ K+   E++ + +L  L ++++ K+D+ +L+ +K+ +E R ++L ++L+  R      D+AA +R+QLL HFHC+SCDRPL+  +  H I      P   GLP   S+RPYT FEL+ +RQHS+N K                       H+K   ++  +    + +G                            D+ D  Y T PR CGGSHT +YP  +          +  EE+      +E D+ G DGHIYKGR+D
Sbjct: 1419 QRQDEELLGRVQSAILQVQGDCEKLNITTSNLIEDHRQKQKDIAMLYQGLEKLEKEKANREHLEMEIDVKADKSALATKVSRVQFDATTEQLNHMMQELVAKMSGQEQDWQKMLDRLLTEMDNKLDRLELDPVKQLLEDRWKSLRQQLRE-RPPLYQADEAAAMRRQLLAHFHCLSCDRPLETPVTGHAIPV---TPAGPGLPGHHSIRPYTVFELEQVRQHSRNLKLGSAFPRGDLAQMEQSVGRLRSMHSKMLMNIEKVQ---IHFGGSTKASSQIIRELLHAQCLGSPCYKRVTDMADYTYSTVPRRCGGSHTLTYPYHRSRPQHLPRGLYPTEEIQIAMKHDEVDILGLDGHIYKGRMD 1774          

HSP 2 Score: 55.4546 bits (132), Expect = 6.346e-7
Identity = 58/244 (23.77%), Postives = 103/244 (42.21%), Query Frame = 3
Query:   90 ISMRSMVDLALGAPEVGAVNFNVLHSLLHAILAKLEMGDNPVDI---------AVEENKTPASKSKLPV---IP----------VSTIPYHGLQDRIKILENQISDLNSLPSNKDILNTILDNNTKDQAKSDNQRLVSDLW---QTINIRKKVNANEEGIDRLSSMVDSILNEMKQLKSENETMKKQLEDLSGLKGMGDKVDGLQNEIADLLDQFNKLKDILAEYPPPDAFKNIVTWDGLEKAL 746
            +S+R + DL++G PEVGAVNF  LH+L+ A+L  L++ +  +D          +++  ++  S   LP    +P          V   P   L+ ++K L  Q+ DL+      D     +  + +  +++    L +  W   Q + +R          DR+ +                  MK   E+LS  + +  +VD L+    D  +QF +L        P      +VTW+ LE+A+
Sbjct:    7 VSLRELADLSIGTPEVGAVNFTALHTLIVAMLKNLDLQNTRIDFQPSSPEPSRSLQSVRSSFSIPHLPAPKEVPKGAPREKRRGVGQAPSSALESQVKDLGGQVEDLSKQLKRVDGQVQGIATHVQHFSQASGLDLAALEWPEEQEVGVR--------AFDRVRT---------------GSIMKDAAEELSFARVLLQRVDELEKLFKD-REQFLELVSRKLSLVPGAEEVTMVTWEELEQAI 226          
BLAST of Glutamine-rich protein 2 vs. Ensembl Human
Match: QRICH2 (glutamine rich 2 [Source:HGNC Symbol;Acc:HGNC:25326])

HSP 1 Score: 143.665 bits (361), Expect = 6.892e-34
Identity = 108/363 (29.75%), Postives = 176/363 (48.48%), Query Frame = 3
Query: 1674 KNRDGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVXXXXXXXXXXXXXXXXXXXXDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLD--IMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNK-----------------NMYIHNHTKRFQDVRVINPKYVSYGA---------------------------DIVD-VYQT-PRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTLKEEADLTGADGHIYKGRID 2618
            + +D E L R++  +  +Q     +N T   L  +H+     +  L+   +  E  KA+  ++E  +  KADKS L TKV+   FD T   L+ ++ +++ K+   E++ + +L  L ++++ K+D+ +L+ +K+ +E R ++L ++L+  R      D+AA +R+QLL HFHC+SCDRPL+  +  H I      P   GLP   S+RPYT FEL+ +RQHS+N K                       H+K   ++  +    + +G                            D+ D  Y T PR CGGSHT +YP  +          +  EE+      +E D+ G DGHIYKGR+D
Sbjct: 1253 QRQDEELLGRVQSAILQVQGDCEKLNITTSNLIEDHRQKQKDIAMLYQGLEKLEKEKANREHLEMEIDVKADKSALATKVSRVQFDATTEQLNHMMQELVAKMSGQEQDWQKMLDRLLTEMDNKLDRLELDPVKQLLEDRWKSLRQQLRE-RPPLYQADEAAAMRRQLLAHFHCLSCDRPLETPVTGHAIPV---TPAGPGLPGHHSIRPYTVFELEQVRQHSRNLKLGSAFPRGDLAQMEQSVGRLRSMHSKMLMNIEKVQ---IHFGGSTKASSQIIRELLHAQCLGSPCYKRVTDMADYTYSTVPRRCGGSHTLTYPYHRSRPQHLPRGLYPTEEIQIAMKHDEVDILGLDGHIYKGRMD 1608          
BLAST of Glutamine-rich protein 2 vs. Ensembl Human
Match: QRICH2 (glutamine rich 2 [Source:HGNC Symbol;Acc:HGNC:25326])

HSP 1 Score: 90.8929 bits (224), Expect = 2.748e-19
Identity = 46/108 (42.59%), Postives = 71/108 (65.74%), Query Frame = 3
Query: 2031 DVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLD--IMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNK 2348
            +++ K+D+ +L+ +K+ +E R ++L ++L+  R      D+AA +R+QLL HFHC+SCDRPL+  +  H I      P   GLP   S+RPYT FEL+ +RQHS+N K
Sbjct:   20 EMDNKLDRLELDPVKQLLEDRWKSLRQQLRE-RPPLYQADEAAAMRRQLLAHFHCLSCDRPLETPVTGHAIPVTPAGP---GLPGHHSIRPYTVFELEQVRQHSRNLK 123          
BLAST of Glutamine-rich protein 2 vs. Ensembl Human
Match: C16orf96 (chromosome 16 open reading frame 96 [Source:HGNC Symbol;Acc:HGNC:40031])

HSP 1 Score: 69.707 bits (169), Expect = 2.764e-11
Identity = 64/213 (30.05%), Postives = 112/213 (52.58%), Query Frame = 3
Query: 1593 LENLKIPDDLLKTIALLKAQMDSLMASKNRDGEALARIR-DILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVXXXXXXXXXXXXXXXXXXXXDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLDIMT 2228
            L N+  P  L  T+ +L+ ++ SL  S+ ++ E L RI  + +  ++D+      TLDK     +  +++ + L    K  E  K +   +E  LR KAD+S L  K +    +  A  L+ +I  +L K+   E+  +  +  L+ DVN K+   DL+ LK+ +E+  + + + L  + G  +  D AAG R++L +   CISCDRP+++MT
Sbjct:  718 LANMGGPSSLGTTVDILQKKIGSLQKSRLKE-EELERIWGNQIEMMKDRYI----TLDKAVENLQIRMDEFKTLQAQIKRLEMNKVNKSTMEEELREKADRSALAGKASRVDLETVALELNEMIQGILFKVTIHEDSWKKAMEELSKDVNTKLVHSDLDPLKKEMEEVWKIVRKLL--IEGLRLDPDSAAGFRRKLFKRVKCISCDRPVEMMT 923          

HSP 2 Score: 60.4622 bits (145), Expect = 1.787e-8
Identity = 57/240 (23.75%), Postives = 101/240 (42.08%), Query Frame = 3
Query:  120 LGAPEVGAVNFNVLHSLLHAILAKLEMGDNPVDIAVEENKTPASKSKL------------PVIPVSTIPYHGLQDRIKILENQISDLNSLPSNKDILNTILDNNTKDQAKSDNQRLVSDLWQTINIRKKVNANEEGIDRLSSMVDSILNEMKQLKSENETMKKQLEDLSGLKGMGDKVD-------------------GLQNEIADLLDQFNKLKDILAEYPPPDAFKNIVTWDGLEKAL 746
            +  P+ G +NF  LH LLH IL  + M +    ++ +E+    S+  +            P+  +S + +  +  R+  LENQ++ L  LPS   +L          +A     R V DLW  I +RK V  ++E + +    +  +L ++  L+     ++K+++    LK M DKV                     LQ E+A L ++F  +             +++V W GL  A+
Sbjct:   13 IAIPQCGVLNFKALHLLLHGILEHIHMAELKKVLSGDEDFLQTSQVVIMPREGDAQPILNPMKRLSNV-FDHVVSRLDKLENQLALLQDLPSTAQLL----------EASQGTARPVQDLWHLIKLRKMVEGHDEVMAKSMQTLQDLLTDLHALQVTITALRKEVD---MLKNMLDKVHPERMDIFAEDFKIQNWKMVALQREVASLQNKFKTIPKT----------EDMVLWSGLHDAM 228          
BLAST of Glutamine-rich protein 2 vs. Ensembl Fly
Match: CG10869 (gene:FBgn0031347 transcript:FBtr0077917)

HSP 1 Score: 62.7734 bits (151), Expect = 1.604e-9
Identity = 79/321 (24.61%), Postives = 133/321 (41.43%), Query Frame = 3
Query: 1611 PDDLLKTIALLKAQMDSLMASKNRDGEALAR----------------IRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVXXXXXXXXXXXXXXXXXXXXDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDD--AAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHS---KNNKNMYIHNHTKRFQDVRVINPKYVSYGADIVDVYQTPRPCGGSHTTSYPQKKMVRL 2510
            P+ +L  +  LK+Q  +L    N    AL +                +RDI   +     A N  + +LN    D + Q++ L       +  K D   +E LL  K D   L TKV+    +E    L  +  +V   +   E+ +  ++ +L   +     +  L   +E IE+R++ +AE L+  +  ++T DD  AA  R +++Q   C++CD    + T   +    LP  KG   S  L P  T+EL  IR+        K+ + H+              +    + +  V  TPR  GGSHTT    + M ++
Sbjct:  349 PEKMLTELLDLKSQFCALTNKVNELAAALLKQDSQRLMDQMKDLSETVRDIKLYMASNKEATNGMMTRLN----DCVYQIQVLKKSASHLDEVKIDKTEVELLLAEKVDFQQLATKVSLEQLEEYKARLEQMFCEVRHIVSLNEKNVLQIIDNLRMTLGIDALELSLKDFREMIERRVQIIAEALQ--KYMEMTNDDCAAAAGRVKVMQDLACLACDTTCVMRTVERSKVPSLPNAKG---STGLGPIVTYELGQIRKSGIMGYYRKDEFPHS-----------TSAWTKGASGVPMVKCTPRHAGGSHTTHTADEHMQKV 649          
BLAST of Glutamine-rich protein 2 vs. Ensembl Xenopus
Match: ENSXETT00000013175.1 (glutamine rich 2 [Source:NCBI gene;Acc:100497746])

HSP 1 Score: 164.466 bits (415), Expect = 1.151e-40
Identity = 135/471 (28.66%), Postives = 234/471 (49.68%), Query Frame = 3
Query: 1488 EMLEKLGILTTAHDLLDKRVVVLEEEMPNKADKKDLE-------NLKIPDDLLKTIALLKAQMD------SLMASKNRDGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVXXXXXXXXXXXXXXXXXXXXDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNKNMYIHNHTKRFQDVRVINPKYVSYGADIVDVYQTPRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTLK--------EEADLTGADGHIYKGRIDRSQTTMINNNNYIEQPSNDKLPPVTASQRSQTIVNNNFTPRGAFVTSRPKSAVKITPRHSSSAGPTRPSSARV 2837
            E L K+G LT  + +L +RV  L   + NKAD+ +L+        L +PD     +A L+ +M+       + A + +DGE +  ++  L   Q +   +  +L +   E +     ++ L+      E +KAD  ++E  +  KADK  LD KV+ + FD TA  L+S++ ++L ++   E++ + +L  L  ++  K+D+ +L+  K+ +E+R +++  +L+  R      D+AAG+RKQL+ HFHC+SCDRPLDI   G      +P   GLP  +S RP + +EL+ IRQH       +  +  +   D   ++               + R CGGSHT +Y  ++  +L N+      EE      +        EE D+ G DGHIY+GR+D     + N  + +   S  +L     SQ+S  I++ +  P+ A  T +  + +  +P  ++     RP SA++
Sbjct:  481 EALRKMGALTDKYSVLRERVEAL---LRNKADRSELKALLEGRGQLTVPDGS-NNVAGLQEKMNVARFMQEIKAEREKDGELIGDLQTKLLTFQGECERLEKSLAE---EQQQTQKHIDVLYEKLDKLEEKKADKEHLELEIDVKADKQALDGKVSRAQFDATAEQLNSIVHELLGRVSGQEQDWQKVLEKLNMEMQNKLDRMELDPFKKKLEERWKSIRRQLQE-RSPQYEADEAAGIRKQLISHFHCLSCDRPLDISMPGPPILT-IPNVPGLPVHRSTRPQSVYELEQIRQH-------FCSDRAQELADYSCMS---------------SMRNCGGSHTLTYSHRRFPKLQNITPRNSSEEGSAAFAQKVGGDIKCEEIDILGLDGHIYRGRMDSRLPAIYNVRDGL---SKARLKLSQTSQKS--ILSCDSRPQSAKSTRQCSTDLH-SPYPTAGISQERPGSAQL 914          

HSP 2 Score: 91.6633 bits (226), Expect = 4.338e-18
Identity = 69/285 (24.21%), Postives = 119/285 (41.75%), Query Frame = 3
Query:   87 LISMRSMVDLALGAPEVGAVNFNVLHSLLHAILAKLEMGDNPVDIAVEENKTPASKSKLP-VIPVSTIPYHGLQDRIKILENQISDLNSLPSNKDILNTILDNNTKDQAKSDNQRLVSDLWQTINIRKKVNANEEGIDRLSSMVDSILNEMKQLKSENETMKKQL-------------------------------------EDLSGLKGMGD-------------------KVDGLQNEIADLLDQFNKLKDILAEYPPPDAFKNIVTWDGLEKALKGIKDDMD 770
            LIS+  + +L++G PE GAVNFN L +LLHAIL  L + D   +++          ++ P  +PV    Y  +++R++ +E Q+  LN LP+  D++            ++     V D+W  + ++K++ ANE+G+     ++  +LN    L+  N+  + QL                                     E LS  + MGD                   K+  +Q E+  +      L++ L +YP P    N+V WD L + L     D +
Sbjct:    4 LISLSDLANLSIGTPEAGAVNFNALRTLLHAILQHLHLQDIKAEVSEAAGWARMDGTEQPGKVPVG---YRQMEERMERVEKQMEALNRLPTGSDLIE-----------RAGGATPVEDVWHMLQMKKRIEANEDGVSTAMGLLQDLLNITTALQEANKDFQSQLQKVRESVELTMQEDIQKCLSQMELQRSDVEKLAQVERELLSLQQRMGDQDTMHQQLNQMELQRVEEAKLANVQAELESIQKCLADLEERLMQYPSPSELNNMVGWDILRETLVTCGTDAE 274          
BLAST of Glutamine-rich protein 2 vs. Ensembl Mouse
Match: Qrich2 (glutamine rich 2 [Source:MGI Symbol;Acc:MGI:2684912])

HSP 1 Score: 138.272 bits (347), Expect = 2.394e-33
Identity = 111/359 (30.92%), Postives = 179/359 (49.86%), Query Frame = 3
Query: 1674 KNRDGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVXXXXXXXXXXXXXXXXXXXXDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNK--------NM--------YIHN-HTKRFQDVRVI-------------------------NPKYVSYGADIVDV-YQT-PRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTLKEEADLTGADGHIYKGRID 2618
            + +D E L  ++  +  +Q     +N T   L  +H+     +E L+   +  +  KA+  ++E  +  KADKS L +KV+   FD T   L+ ++ +++ K+   E++ + LL  L ++++ K+D+ +L+ LK+ +E R ++L ++LK  R      D+AA +R+QLL HFHC+SCDRPL+    G    +  P    +P  +S+RPYT FEL+ IRQ S+N K        +M         +H+ H++   D+  +                         +P Y   GAD  D  Y T  R CGGSHT +YP     R     +    EE+      +E D+ G DGHIYKGR+D
Sbjct:   98 QGQDEELLGHVQSAILQVQGDCEKLNITTSNLIEDHRQKQKDIEVLYQGIERLDKEKANREHLEMEIDEKADKSALASKVSRIQFDATTEQLNHMMQELVAKMSGQEQDWQKLLDKLLAEMDSKLDRLELDPLKQMLEDRWKSLRQQLKE-RPPLYQADEAAAMRRQLLAHFHCLSCDRPLETTVTG-QVISVTPIISSMPGHRSVRPYTVFELEQIRQQSRNLKLGSSFPRVDMSQMERSVGRLHSMHSRMLMDMEKVQVHFGGSVKASSQMIRELLHTQCLSHPCY-KRGADTADYSYSTVSRRCGGSHTLTYP----YRRNRPQHLSPLEEIQIAMKHDEVDILGLDGHIYKGRMD 449          
BLAST of Glutamine-rich protein 2 vs. Ensembl Mouse
Match: Qrich2 (glutamine rich 2 [Source:MGI Symbol;Acc:MGI:2684912])

HSP 1 Score: 135.961 bits (341), Expect = 1.180e-31
Identity = 111/360 (30.83%), Postives = 180/360 (50.00%), Query Frame = 3
Query: 1674 KNRDGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVXXXXXXXXXXXXXXXXXXXXDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNK--------NM--------YIHN-HTKRFQDVRVI-------------------------NPKYVSYGADIVDV-YQT-PRPCGGSHTTSYPQKKMVRLGNMNNSFID-EELHTRTLKEEADLTGADGHIYKGRID 2618
            + +D E L  ++  +  +Q     +N T   L  +H+     +E L+   +  +  KA+  ++E  +  KADKS L +KV+   FD T   L+ ++ +++ K+   E++ + LL  L ++++ K+D+ +L+ LK+ +E R ++L ++LK  R      D+AA +R+QLL HFHC+SCDRPL+    G    +  P    +P  +S+RPYT FEL+ IRQ S+N K        +M         +H+ H++   D+  +                         +P Y   GAD  D  Y T  R CGGSHT +YP ++     N        EE+      +E D+ G DGHIYKGR+D
Sbjct: 1843 QGQDEELLGHVQSAILQVQGDCEKLNITTSNLIEDHRQKQKDIEVLYQGIERLDKEKANREHLEMEIDEKADKSALASKVSRIQFDATTEQLNHMMQELVAKMSGQEQDWQKLLDKLLAEMDSKLDRLELDPLKQMLEDRWKSLRQQLKE-RPPLYQADEAAAMRRQLLAHFHCLSCDRPLETTVTG-QVISVTPIISSMPGHRSVRPYTVFELEQIRQQSRNLKLGSSFPRVDMSQMERSVGRLHSMHSRMLMDMEKVQVHFGGSVKASSQMIRELLHTQCLSHPCY-KRGADTADYSYSTVSRRCGGSHTLTYPYRR-----NRPQHLSPLEEIQIAMKHDEVDILGLDGHIYKGRMD 2194          

HSP 2 Score: 59.6918 bits (143), Expect = 2.863e-8
Identity = 73/269 (27.14%), Postives = 117/269 (43.49%), Query Frame = 3
Query:   90 ISMRSMVDLALGAPEVGAVNFNVLHSLLHAILAKLEMGDNPVDIAVEENKT----------------PASKSKLPVIP-VSTIPYHGLQDRIKILENQISDLNSLPSNKDILNTILDNNTKDQAKSDNQRLVSDLWQTINIR-----------KKVNANEEGIDRLSSMVDSILNEMKQLK-SENETMKKQ-------LEDLSGLKGMGDKVDGLQNEIADLLDQFNKLKDILA---EY-----------PPPDAFKNIVTWDGLEKAL 746
            +S+R + DLA+G PEVGAVNF  LH+L+ +IL  L + +  +D      +T                P SK K   +P +S  P   L++++K L NQ+ DL             +DN  +  A   +Q  V +L Q   I             K+  +EE +++    V  +  EM QLK S   ++ K        +ED+  LK          +E+ +LL +FN+L+ ++    EY            P      +VTW+ LE+ +
Sbjct:   10 VSLRELADLAIGTPEVGAVNFTALHTLIVSILKSLNLQEVLIDFHYPSTETGRGTESLHGTHSAPHLPTSKEKHQSLPRLSQTPQE-LENQVKDLGNQVLDLTK-------QFKTMDNKVQGMATQIDQISVPELQQEEEIALVTQQVSLTKFSKIYESEEMMEKPEPTV-KMPTEMVQLKPSRTPSLTKPTSVLQDLIEDVKILKQA--------SELQELLQRFNELEKLVKSREEYLDLLSRRLNLLAPGGEEITMVTWEELEQVI 261          
BLAST of Glutamine-rich protein 2 vs. Ensembl Mouse
Match: 4930562C15Rik (RIKEN cDNA 4930562C15 gene [Source:MGI Symbol;Acc:MGI:1926059])

HSP 1 Score: 67.781 bits (164), Expect = 8.176e-11
Identity = 52/239 (21.76%), Postives = 117/239 (48.95%), Query Frame = 3
Query:   90 ISMRSMVDLALGAPEVGAVNFNVLHSLLHAILAKLEMGDNPVDIAVEENKTPASKSKL--------PVI-PVSTIP--YHGLQDRIKILENQISDLNSLPSNKDILNTILDNNTKDQAKSDNQRLVSDLWQTINIRKKVNANEEGIDRLSSMVDSILNEMKQLKSENETMKKQLEDL---------SGLKGMGDKVDGLQNEIADLLDQFNKLKDILAEYPPPDAFKNIVTWDGLEKAL 746
            I+   +V++A+  P+ G VNF  LH LL  IL  +++ +    ++ EE+   +S +          PVI P+  +   +  + DRI+ +E++++++  +P+   ++          +    ++R   ++W  I I+K++  NE+  ++ +  +  +LN++  LK   ET++K ++ +           L+ +GD +     ++  L  +   L++ +   P P+    +V W GL +A+
Sbjct:    5 ITFTELVNVAI--PQCGVVNFKALHLLLQGILEHIQITELKKVLSGEEDFLQSSPAVFIPREGDAQPVINPMKRLSNIFDQVVDRIEKIESKLAEMQDIPTTSQLV----------EESYGDKRPAEEMWNNIKIQKRIEGNEKATEKFTRTLQDLLNDLHVLKGSVETVQKDVDTIKFIFEKVNPQKLELLGDDLKTQSRKLGALQREVVTLQNKVRAVPQPE---EMVLWSGLHEAM 228          

HSP 2 Score: 64.3142 bits (155), Expect = 9.650e-10
Identity = 74/262 (28.24%), Postives = 119/262 (45.42%), Query Frame = 3
Query: 1842 KADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVXXXXXXXXXXXXXXXXXXXXDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTH----GINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNKNMYIHNHTKRFQDVRVINPKYVSYGADIVDVYQTPRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTLKEEADLTGADGHIYKGRI 2615
            KAD   ++  L  KA++  L +K N    +  A  L+ +I  +L K+   E + +  L+ L  D+N K+ + DLN+LK+ IE+  + + + L  L G     D AAG +K+L +   CISCDRP+++MT      I   +GL   +  P S +   Y   +L   +Q   + +N  +H   + FQ      P+  +          T +      +T YP             + D EL       E D+ G DG +YKGR+
Sbjct:  812 KADKNVMDLELNEKANRDALASKANRVDLETVAMELNEMIHSMLLKITNYESDWKKALKHLRKDLNTKLVQSDLNSLKKDIEEVWKVVRKLL--LEGLRFDPDSAAGFKKKLFERVKCISCDRPVEMMTGPQLITIRNTHGLSRIR--PASANSYEYLQRQLIREQQQHLHFQNFGVHEEGQGFQKDWGDGPRNEN----------TLKHKSHDLSTLYP-------------YGDPELMNYDTA-EVDILGVDGVLYKGRM 1045          
BLAST of Glutamine-rich protein 2 vs. Ensembl Mouse
Match: 4930562C15Rik (RIKEN cDNA 4930562C15 gene [Source:MGI Symbol;Acc:MGI:1926059])

HSP 1 Score: 51.2174 bits (121), Expect = 4.075e-6
Identity = 37/115 (32.17%), Postives = 59/115 (51.30%), Query Frame = 3
Query: 2052 KDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTH----GINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNKNMYIHNHTKRFQ 2384
            + DLN+LK+ IE+  + + + L  L G     D AAG +K+L +   CISCDRP+++MT      I   +GL   +  P S +   Y   +L   +Q   + +N  +H   + FQ
Sbjct:   43 QSDLNSLKKDIEEVWKVVRKLL--LEGLRFDPDSAAGFKKKLFERVKCISCDRPVEMMTGPQLITIRNTHGLSRIR--PASANSYEYLQRQLIREQQQHLHFQNFGVHEEGQGFQ 153          
BLAST of Glutamine-rich protein 2 vs. UniProt/SwissProt
Match: sp|Q9H0J4|QRIC2_HUMAN (Glutamine-rich protein 2 OS=Homo sapiens OX=9606 GN=QRICH2 PE=1 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 3.310e-33
Identity = 108/363 (29.75%), Postives = 176/363 (48.48%), Query Frame = 3
Query: 1674 KNRDGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVXXXXXXXXXXXXXXXXXXXXDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLD--IMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNK-----------------NMYIHNHTKRFQDVRVINPKYVSYGA---------------------------DIVD-VYQT-PRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTLKEEADLTGADGHIYKGRID 2618
            + +D E L R++  +  +Q     +N T   L  +H+     +  L+   +  E  KA+  ++E  +  KADKS L TKV+   FD T   L+ ++ +++ K+   E++ + +L  L ++++ K+D+ +L+ +K+ +E R ++L ++L+  R      D+AA +R+QLL HFHC+SCDRPL+  +  H I      P   GLP   S+RPYT FEL+ +RQHS+N K                       H+K   ++  +    + +G                            D+ D  Y T PR CGGSHT +YP  +          +  EE+      +E D+ G DGHIYKGR+D
Sbjct: 1253 QRQDEELLGRVQSAILQVQGDCEKLNITTSNLIEDHRQKQKDIAMLYQGLEKLEKEKANREHLEMEIDVKADKSALATKVSRVQFDATTEQLNHMMQELVAKMSGQEQDWQKMLDRLLTEMDNKLDRLELDPVKQLLEDRWKSLRQQLRE-RPPLYQADEAAAMRRQLLAHFHCLSCDRPLETPVTGHAIPV---TPAGPGLPGHHSIRPYTVFELEQVRQHSRNLKLGSAFPRGDLAQMEQSVGRLRSMHSKMLMNIEKVQ---IHFGGSTKASSQIIRELLHAQCLGSPCYKRVTDMADYTYSTVPRRCGGSHTLTYPYHRSRPQHLPRGLYPTEEIQIAMKHDEVDILGLDGHIYKGRMD 1608          
BLAST of Glutamine-rich protein 2 vs. UniProt/SwissProt
Match: sp|Q3V2A7|QRIC2_MOUSE (Glutamine-rich protein 2 OS=Mus musculus OX=10090 GN=Qrich2 PE=2 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 1.674e-32
Identity = 111/359 (30.92%), Postives = 179/359 (49.86%), Query Frame = 3
Query: 1674 KNRDGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVXXXXXXXXXXXXXXXXXXXXDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNK--------NM--------YIHN-HTKRFQDVRVI-------------------------NPKYVSYGADIVDV-YQT-PRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTLKEEADLTGADGHIYKGRID 2618
            + +D E L  ++  +  +Q     +N T   L  +H+     +E L+   +  +  KA+  ++E  +  KADKS L +KV+   FD T   L+ ++ +++ K+   E++ + LL  L ++++ K+D+ +L+ LK+ +E R ++L ++LK  R      D+AA +R+QLL HFHC+SCDRPL+    G    +  P    +P  +S+RPYT FEL+ IRQ S+N K        +M         +H+ H++   D+  +                         +P Y   GAD  D  Y T  R CGGSHT +YP     R     +    EE+      +E D+ G DGHIYKGR+D
Sbjct:   98 QGQDEELLGHVQSAILQVQGDCEKLNITTSNLIEDHRQKQKDIEVLYQGIERLDKEKANREHLEMEIDEKADKSALASKVSRIQFDATTEQLNHMMQELVAKMSGQEQDWQKLLDKLLAEMDSKLDRLELDPLKQMLEDRWKSLRQQLKE-RPPLYQADEAAAMRRQLLAHFHCLSCDRPLETTVTG-QVISVTPIISSMPGHRSVRPYTVFELEQIRQQSRNLKLGSSFPRVDMSQMERSVGRLHSMHSRMLMDMEKVQVHFGGSVKASSQMIRELLHTQCLSHPCY-KRGADTADYSYSTVSRRCGGSHTLTYP----YRRNRPQHLSPLEEIQIAMKHDEVDILGLDGHIYKGRMD 449          
BLAST of Glutamine-rich protein 2 vs. UniProt/SwissProt
Match: sp|A6NNT2|CP096_HUMAN (Uncharacterized protein C16orf96 OS=Homo sapiens OX=9606 GN=C16orf96 PE=4 SV=3)

HSP 1 Score: 69.707 bits (169), Expect = 1.328e-10
Identity = 64/213 (30.05%), Postives = 112/213 (52.58%), Query Frame = 3
Query: 1593 LENLKIPDDLLKTIALLKAQMDSLMASKNRDGEALARIR-DILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVXXXXXXXXXXXXXXXXXXXXDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLDIMT 2228
            L N+  P  L  T+ +L+ ++ SL  S+ ++ E L RI  + +  ++D+      TLDK     +  +++ + L    K  E  K +   +E  LR KAD+S L  K +    +  A  L+ +I  +L K+   E+  +  +  L+ DVN K+   DL+ LK+ +E+  + + + L  + G  +  D AAG R++L +   CISCDRP+++MT
Sbjct:  718 LANMGGPSSLGTTVDILQKKIGSLQKSRLKE-EELERIWGNQIEMMKDRYI----TLDKAVENLQIRMDEFKTLQAQIKRLEMNKVNKSTMEEELREKADRSALAGKASRVDLETVALELNEMIQGILFKVTIHEDSWKKAMEELSKDVNTKLVHSDLDPLKKEMEEVWKIVRKLL--IEGLRLDPDSAAGFRRKLFKRVKCISCDRPVEMMT 923          

HSP 2 Score: 60.4622 bits (145), Expect = 8.583e-8
Identity = 57/240 (23.75%), Postives = 101/240 (42.08%), Query Frame = 3
Query:  120 LGAPEVGAVNFNVLHSLLHAILAKLEMGDNPVDIAVEENKTPASKSKL------------PVIPVSTIPYHGLQDRIKILENQISDLNSLPSNKDILNTILDNNTKDQAKSDNQRLVSDLWQTINIRKKVNANEEGIDRLSSMVDSILNEMKQLKSENETMKKQLEDLSGLKGMGDKVD-------------------GLQNEIADLLDQFNKLKDILAEYPPPDAFKNIVTWDGLEKAL 746
            +  P+ G +NF  LH LLH IL  + M +    ++ +E+    S+  +            P+  +S + +  +  R+  LENQ++ L  LPS   +L          +A     R V DLW  I +RK V  ++E + +    +  +L ++  L+     ++K+++    LK M DKV                     LQ E+A L ++F  +             +++V W GL  A+
Sbjct:   13 IAIPQCGVLNFKALHLLLHGILEHIHMAELKKVLSGDEDFLQTSQVVIMPREGDAQPILNPMKRLSNV-FDHVVSRLDKLENQLALLQDLPSTAQLL----------EASQGTARPVQDLWHLIKLRKMVEGHDEVMAKSMQTLQDLLTDLHALQVTITALRKEVD---MLKNMLDKVHPERMDIFAEDFKIQNWKMVALQREVASLQNKFKTIPKT----------EDMVLWSGLHDAM 228          
BLAST of Glutamine-rich protein 2 vs. UniProt/SwissProt
Match: sp|E9QMW4|CP096_MOUSE (Uncharacterized protein C16orf96 homolog OS=Mus musculus OX=10090 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 5.719e-10
Identity = 52/239 (21.76%), Postives = 117/239 (48.95%), Query Frame = 3
Query:   90 ISMRSMVDLALGAPEVGAVNFNVLHSLLHAILAKLEMGDNPVDIAVEENKTPASKSKL--------PVI-PVSTIP--YHGLQDRIKILENQISDLNSLPSNKDILNTILDNNTKDQAKSDNQRLVSDLWQTINIRKKVNANEEGIDRLSSMVDSILNEMKQLKSENETMKKQLEDL---------SGLKGMGDKVDGLQNEIADLLDQFNKLKDILAEYPPPDAFKNIVTWDGLEKAL 746
            I+   +V++A+  P+ G VNF  LH LL  IL  +++ +    ++ EE+   +S +          PVI P+  +   +  + DRI+ +E++++++  +P+   ++          +    ++R   ++W  I I+K++  NE+  ++ +  +  +LN++  LK   ET++K ++ +           L+ +GD +     ++  L  +   L++ +   P P+    +V W GL +A+
Sbjct:    5 ITFTELVNVAI--PQCGVVNFKALHLLLQGILEHIQITELKKVLSGEEDFLQSSPAVFIPREGDAQPVINPMKRLSNIFDQVVDRIEKIESKLAEMQDIPTTSQLV----------EESYGDKRPAEEMWNNIKIQKRIEGNEKATEKFTRTLQDLLNDLHVLKGSVETVQKDVDTIKFIFEKVNPQKLELLGDDLKTQSRKLGALQREVVTLQNKVRAVPQPE---EMVLWSGLHEAM 228          

HSP 2 Score: 64.3142 bits (155), Expect = 6.750e-9
Identity = 74/262 (28.24%), Postives = 119/262 (45.42%), Query Frame = 3
Query: 1842 KADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVXXXXXXXXXXXXXXXXXXXXDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTH----GINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNKNMYIHNHTKRFQDVRVINPKYVSYGADIVDVYQTPRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTLKEEADLTGADGHIYKGRI 2615
            KAD   ++  L  KA++  L +K N    +  A  L+ +I  +L K+   E + +  L+ L  D+N K+ + DLN+LK+ IE+  + + + L  L G     D AAG +K+L +   CISCDRP+++MT      I   +GL   +  P S +   Y   +L   +Q   + +N  +H   + FQ      P+  +          T +      +T YP             + D EL       E D+ G DG +YKGR+
Sbjct:  812 KADKNVMDLELNEKANRDALASKANRVDLETVAMELNEMIHSMLLKITNYESDWKKALKHLRKDLNTKLVQSDLNSLKKDIEEVWKVVRKLL--LEGLRFDPDSAAGFKKKLFERVKCISCDRPVEMMTGPQLITIRNTHGLSRIR--PASANSYEYLQRQLIREQQQHLHFQNFGVHEEGQGFQKDWGDGPRNEN----------TLKHKSHDLSTLYP-------------YGDPELMNYDTA-EVDILGVDGVLYKGRM 1045          
BLAST of Glutamine-rich protein 2 vs. TrEMBL
Match: A0A1I8H6J2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000636g1 PE=4 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 7.638e-102
Identity = 223/478 (46.65%), Postives = 300/478 (62.76%), Query Frame = 3
Query: 1443 PASQISSPGPSEVCAEMLEKLGILTTAHDLLDKRVVVLEEEMPNKADKKDLENLKIPDDLLKTIALLKAQMDSLMASKNRDGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVXXXXXXXXXXXXXXXXXXXXDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRG---GDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNKNMYIHNHTKRFQDVRVINPKYVSYGADIVDVYQTPRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTL----------KEEADLTGADGHIYKGRIDRSQTTMINNNNYIEQPSNDKLPPVTASQRSQTIVNNNFTPRGAFVTSRPKSAVKITPR-HSSSAGPTRPSSAR 2834
            P S+  SPGPSE   EMLE LG LT  H+ L+ RV  LE EMPNKADKKDLENLK+PDDLLK +  L++ +D++  S++RD EAL RIR  L+  Q ++  +N  L+ L    KD+  +L+ELF IT   +  KAD  Y++  L +KADK  LDTKVNFSLFDET GNL+S ID++L+KL+A E++LR LL+ L +D++GK+D+ +++ALK+W+EKRL+ALA K+K   G    D+ EDDAAGLR+QLLQHFHCISCDRPL++  H       LPE   L  +KS+RPYTTFELD+IRQH+K+                  IN        +++D Y TPR  GGSHT +YP K++ R      +  +E+ H+ T           +EE ++ G DGHIYKGRIDR  T +  ++   E P+  KLPPV+ ++ S    +      G     RP ++ +   R HSS A   RP SAR
Sbjct:  272 PMSRPQSPGPSEALREMLESLGKLTNRHESLEVRVDKLEHEMPNKADKKDLENLKLPDDLLKQLNDLRSLVDNMRQSRDRDVEALNRIRKALSDQQKELERINTVLEALAQGGKDVGEKLQELFRITAHLDEVKADKDYLDQQLESKADKIQLDTKVNFSLFDETTGNLNSQIDELLQKLMATEDDLRRLLKLLGADLDGKLDRLEMDALKDWLEKRLKALAAKIKSGGGAGVADINEDDAAGLRRQLLQHFHCISCDRPLEMGAH--PPAPSLPEKPALSVTKSMRPYTTFELDSIRQHAKS------------------IN------AGEMLDAYYTPRAAGGSHTLTYPSKRVTRTA----AVPEEDYHSPTRGAAAAAAPPNREETEIQGMDGHIYKGRIDRFFTEVRASD---EPPT--KLPPVSGAKSS---ASRGSGTSGDASGQRPSTSGQQQQRPHSSRA---RPVSAR 708          

HSP 2 Score: 172.17 bits (435), Expect = 1.630e-40
Identity = 100/282 (35.46%), Postives = 162/282 (57.45%), Query Frame = 3
Query:   78 EIKLISMRSMVDLALGAPEVGAVNFNVLHSLLHAILAKL---------------EMGDNPVDIAVEENKTPASKSKLP-----VIPVSTIPY---------------HGLQDRIKILENQISDLNSLPSNKDILNTILDNNTKDQAKSDNQRLVSDLWQTINIRKKVNANEEGIDRLSSMVDSILNEMKQLKSENETMKKQLEDLSGLKGMGDKVDGLQNEIADLLDQFNKLKDILAEYPPPDAFKNIVTWDGLEKALKGIKDDMDDLRKPTERVVVNMATE 818
            + +++++  +VD+A+G+PE GAVNFN+LH LLHAI+ KL               E    PV +  +  K+  S+  L      V   S +P                  L DR+  +E Q+  LNSLPS KD+ + +  +    + KSD  R  +D++Q + +R++ +ANEEG+ RLSS+VD ++ EM +L+ ENE ++ +++DLS +K + ++       +A L  Q ++L+D +   P  + FK+ VTW+ LEKAL+GI++DM  +  P ERVVVNM+T+
Sbjct:    4 QAEVVNLSKLVDMAVGSPEQGAVNFNLLHGLLHAIVEKLNDPSVSTDRLMRPQSEAAGQPVQVGGQ--KSAKSRRDLDGTESVVTTDSGLPRDGTFGSGGAGGGLNSEQLLDRLSNVETQLDALNSLPSGKDVFDLVFGS----KGKSDG-RATADMFQMVQMRRRTDANEEGVARLSSLVDELMKEMGRLRKENENLRSEMKDLSSMKSVWER-------LAQLESQLSELRDSMQNLPTKEMFKDFVTWESLEKALRGIREDMARMANPPERVVVNMSTD 271          
BLAST of Glutamine-rich protein 2 vs. TrEMBL
Match: A0A267EEH7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007219g1 PE=4 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 1.048e-100
Identity = 222/479 (46.35%), Postives = 301/479 (62.84%), Query Frame = 3
Query: 1443 PASQISSPGPSEVCAEMLEKLGILTTAHDLLDKRVVVLEEEMPNKADKKDLENLKIPDDLLKTIALLKAQMDSLMASKNRDGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVXXXXXXXXXXXXXXXXXXXXDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRG---GDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNKNMYIHNHTKRFQDVRVINPKYVSYGADIVDVYQTPRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTL----------KEEADLTGADGHIYKGRIDRSQTTMINNNNYIEQPSNDKLPPVTASQRSQTIVNNNFTPRGAFVTSRPKSAVKITPR--HSSSAGPTRPSSAR 2834
            P S+  SPGPSE   EMLE LG LT  H+ L+ RV  LE EMPNKADKKDLENLK+PDDLLK +  L++ +D++  S++RD EAL RIR  L+  Q ++  +N  L+ L    KD+  +L+ELF IT   +  KAD  Y++  L +KADK  LDTKVNFSLFDET GNL+S ID++L+KL+A E++LR LL+ L +D++GK+D+ +++ALK+W+EKRL+ALA K+K   G    D+ EDDAAGLR+QLLQHFHCISCDRPL++  H       LPE   L  +KS+RPYTTFELD+IRQH+K+                       V+ G +++D Y TPR  GGSHT +YP K++ R      +  +E+ H+ T           +EE ++ G DGHIYKGRIDR  T +  ++   E P+  KLPPV+ ++ S    +      G     RP ++ +   +  HSS A   RP SAR
Sbjct:  272 PMSRPQSPGPSEALREMLESLGKLTNRHESLEVRVDKLEHEMPNKADKKDLENLKLPDDLLKQLNDLRSLVDNMRQSRDRDVEALNRIRKALSDQQKELERINTVLEALAQGGKDVGEKLQELFRITAHLDEVKADKDYLDQQLESKADKIQLDTKVNFSLFDETTGNLNSQIDELLQKLMATEDDLRRLLKLLGADLDGKLDRLEMDALKDWLEKRLKALAAKIKSGGGAGVADINEDDAAGLRRQLLQHFHCISCDRPLEMGAH--PPAPSLPEKPALSVTKSMRPYTTFELDSIRQHAKS-----------------------VNAG-EMLDAYYTPRAAGGSHTLTYPSKRVTRTA----AVPEEDYHSPTRGAAAAAAPPNREETEIQGMDGHIYKGRIDRFFTEVRASD---EPPT--KLPPVSGAKSS---ASRGSGTSGDASGQRPSTSGQQQQQRPHSSRA---RPVSAR 709          

HSP 2 Score: 171.014 bits (432), Expect = 4.344e-40
Identity = 99/282 (35.11%), Postives = 161/282 (57.09%), Query Frame = 3
Query:   78 EIKLISMRSMVDLALGAPEVGAVNFNVLHSLLHAILAKL---------------EMGDNPVDIAVEENKTPASKSKLP-----VIPVSTIPY---------------HGLQDRIKILENQISDLNSLPSNKDILNTILDNNTKDQAKSDNQRLVSDLWQTINIRKKVNANEEGIDRLSSMVDSILNEMKQLKSENETMKKQLEDLSGLKGMGDKVDGLQNEIADLLDQFNKLKDILAEYPPPDAFKNIVTWDGLEKALKGIKDDMDDLRKPTERVVVNMATE 818
            + +++++  +VD+A+G+PE GAVNFN+LH LLHAI+ KL               E    P  +  +  K+  S+  L      V   S +P                  L DR+  +E Q+  LNSLPS KD+ + +  +    + KSD  R  +D++Q + +R++ +ANEEG+ RLSS+VD ++ EM +L+ ENE ++ +++DLS +K + ++       +A L  Q ++L+D +   P  + FK+ VTW+ LEKAL+GI++DM  +  P ERVVVNM+T+
Sbjct:    4 QAEVVNLSKLVDMAVGSPEQGAVNFNLLHGLLHAIVEKLNDPSVSTDRLMRPQSEAAGQPAQVGGQ--KSAKSRRDLDGTESVVTTDSGLPRDGTFGSGGAGGGLNSEQLLDRLSNVETQLDALNSLPSGKDVFDQVFGS----KGKSDG-RATADMFQMVQMRRRTDANEEGVARLSSLVDELMKEMGRLRKENENLRSEMKDLSSMKSVWER-------LAQLESQLSELRDSMQNLPTKEMFKDFVTWESLEKALRGIREDMARMANPPERVVVNMSTD 271          
BLAST of Glutamine-rich protein 2 vs. TrEMBL
Match: A0A267GEA9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019241g1 PE=4 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 1.048e-100
Identity = 222/479 (46.35%), Postives = 301/479 (62.84%), Query Frame = 3
Query: 1443 PASQISSPGPSEVCAEMLEKLGILTTAHDLLDKRVVVLEEEMPNKADKKDLENLKIPDDLLKTIALLKAQMDSLMASKNRDGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVXXXXXXXXXXXXXXXXXXXXDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRG---GDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNKNMYIHNHTKRFQDVRVINPKYVSYGADIVDVYQTPRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTL----------KEEADLTGADGHIYKGRIDRSQTTMINNNNYIEQPSNDKLPPVTASQRSQTIVNNNFTPRGAFVTSRPKSAVKITPR--HSSSAGPTRPSSAR 2834
            P S+  SPGPSE   EMLE LG LT  H+ L+ RV  LE EMPNKADKKDLENLK+PDDLLK +  L++ +D++  S++RD EAL RIR  L+  Q ++  +N  L+ L    KD+  +L+ELF IT   +  KAD  Y++  L +KADK  LDTKVNFSLFDET GNL+S ID++L+KL+A E++LR LL+ L +D++GK+D+ +++ALK+W+EKRL+ALA K+K   G    D+ EDDAAGLR+QLLQHFHCISCDRPL++  H       LPE   L  +KS+RPYTTFELD+IRQH+K+                       V+ G +++D Y TPR  GGSHT +YP K++ R      +  +E+ H+ T           +EE ++ G DGHIYKGRIDR  T +  ++   E P+  KLPPV+ ++ S    +      G     RP ++ +   +  HSS A   RP SAR
Sbjct:  272 PMSRPQSPGPSEALREMLESLGKLTNRHESLEVRVDKLEHEMPNKADKKDLENLKLPDDLLKQLNDLRSLVDNMRQSRDRDVEALNRIRKALSDQQKELERINTVLEALAQGGKDVGEKLQELFRITAHLDEVKADKDYLDQQLESKADKIQLDTKVNFSLFDETTGNLNSQIDELLQKLMATEDDLRRLLKLLGADLDGKLDRLEMDALKDWLEKRLKALAAKIKSGGGAGVADINEDDAAGLRRQLLQHFHCISCDRPLEMGAH--PPAPSLPEKPALSVTKSMRPYTTFELDSIRQHAKS-----------------------VNAG-EMLDAYYTPRAAGGSHTLTYPSKRVTRTA----AVPEEDYHSPTRGAAAAAAPPNREETEIQGMDGHIYKGRIDRFFTEVRASD---EPPT--KLPPVSGAKSS---ASRGSGTSGDASGQRPSTSGQQQQQRPHSSRA---RPVSAR 709          

HSP 2 Score: 172.555 bits (436), Expect = 1.398e-40
Identity = 100/282 (35.46%), Postives = 162/282 (57.45%), Query Frame = 3
Query:   78 EIKLISMRSMVDLALGAPEVGAVNFNVLHSLLHAILAKL---------------EMGDNPVDIAVEENKTPASKSKLP-----VIPVSTIPY---------------HGLQDRIKILENQISDLNSLPSNKDILNTILDNNTKDQAKSDNQRLVSDLWQTINIRKKVNANEEGIDRLSSMVDSILNEMKQLKSENETMKKQLEDLSGLKGMGDKVDGLQNEIADLLDQFNKLKDILAEYPPPDAFKNIVTWDGLEKALKGIKDDMDDLRKPTERVVVNMATE 818
            + +++++  +VD+A+G+PE GAVNFN+LH LLHAI+ KL               E    PV +  +  K+  S+  L      V   S +P                  L DR+  +E Q+  LNSLPS KD+ + +  +    + KSD  R  +D++Q + +R++ +ANEEG+ RLSS+VD ++ EM +L+ ENE ++ +++DLS +K + ++       +A L  Q ++L+D +   P  + FK+ VTW+ LEKAL+GI++DM  +  P ERVVVNM+T+
Sbjct:    4 QAEVVNLSKLVDMAVGSPEQGAVNFNLLHGLLHAIVEKLNDPSVSTDRLMRPQSEAAGQPVQVGGQ--KSAKSRRDLDGTESVVTTDSGLPRDGTFGSGGAGGGLNSEQLLDRLSNVETQLDALNSLPSGKDVFDQVFGS----KGKSDG-RATADMFQMVQMRRRTDANEEGVARLSSLVDELMKEMGRLRKENENLRSEMKDLSSMKSVWER-------LAQLESQLSELRDSMQNLPTKEMFKDFVTWESLEKALRGIREDMARMANPPERVVVNMSTD 271          
BLAST of Glutamine-rich protein 2 vs. TrEMBL
Match: A0A1I8IU87 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 344.354 bits (882), Expect = 1.162e-100
Identity = 222/479 (46.35%), Postives = 301/479 (62.84%), Query Frame = 3
Query: 1443 PASQISSPGPSEVCAEMLEKLGILTTAHDLLDKRVVVLEEEMPNKADKKDLENLKIPDDLLKTIALLKAQMDSLMASKNRDGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVXXXXXXXXXXXXXXXXXXXXDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRG---GDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNKNMYIHNHTKRFQDVRVINPKYVSYGADIVDVYQTPRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTL----------KEEADLTGADGHIYKGRIDRSQTTMINNNNYIEQPSNDKLPPVTASQRSQTIVNNNFTPRGAFVTSRPKSAVKITPR--HSSSAGPTRPSSAR 2834
            P S+  SPGPSE   EMLE LG LT  H+ L+ RV  LE EMPNKADKKDLENLK+PDDLLK +  L++ +D++  S++RD EAL RIR  L+  Q ++  +N  L+ L    KD+  +L+ELF IT   +  KAD  Y++  L +KADK  LDTKVNFSLFDET GNL+S ID++L+KL+A E++LR LL+ L +D++GK+D+ +++ALK+W+EKRL+ALA K+K   G    D+ EDDAAGLR+QLLQHFHCISCDRPL++  H       LPE   L  +KS+RPYTTFELD+IRQH+K+                       V+ G +++D Y TPR  GGSHT +YP K++ R      +  +E+ H+ T           +EE ++ G DGHIYKGRIDR  T +  ++   E P+  KLPPV+ ++ S    +      G     RP ++ +   +  HSS A   RP SAR
Sbjct:  272 PMSRPQSPGPSEALREMLESLGKLTNRHESLEVRVDKLEHEMPNKADKKDLENLKLPDDLLKQLNDLRSLVDNMRQSRDRDVEALNRIRKALSDQQKELERINTVLEALAQGGKDVGEKLQELFRITAHLDEVKADKDYLDQQLESKADKIQLDTKVNFSLFDETTGNLNSQIDELLQKLMATEDDLRRLLKLLGADLDGKLDRLEMDALKDWLEKRLKALAAKIKSGGGAGVADINEDDAAGLRRQLLQHFHCISCDRPLEMGAH--PPAPSLPEKPALSVTKSMRPYTTFELDSIRQHAKS-----------------------VNAG-EMLDAYYTPRAAGGSHTLTYPSKRVTRTA----AVPEEDYHSPTRGAAAAAAPPNREETEIQGMDGHIYKGRIDRFFTEVRASD---EPPT--KLPPVSGAKSS---ASRGSGTSGDASGQRPSTSGQQQQQRPHSSRA---RPVSAR 709          

HSP 2 Score: 172.555 bits (436), Expect = 1.449e-40
Identity = 100/282 (35.46%), Postives = 162/282 (57.45%), Query Frame = 3
Query:   78 EIKLISMRSMVDLALGAPEVGAVNFNVLHSLLHAILAKL---------------EMGDNPVDIAVEENKTPASKSKLP-----VIPVSTIPY---------------HGLQDRIKILENQISDLNSLPSNKDILNTILDNNTKDQAKSDNQRLVSDLWQTINIRKKVNANEEGIDRLSSMVDSILNEMKQLKSENETMKKQLEDLSGLKGMGDKVDGLQNEIADLLDQFNKLKDILAEYPPPDAFKNIVTWDGLEKALKGIKDDMDDLRKPTERVVVNMATE 818
            + +++++  +VD+A+G+PE GAVNFN+LH LLHAI+ KL               E    PV +  +  K+  S+  L      V   S +P                  L DR+  +E Q+  LNSLPS KD+ + +  +    + KSD  R  +D++Q + +R++ +ANEEG+ RLSS+VD ++ EM +L+ ENE ++ +++DLS +K + ++       +A L  Q ++L+D +   P  + FK+ VTW+ LEKAL+GI++DM  +  P ERVVVNM+T+
Sbjct:    4 QAEVVNLSKLVDMAVGSPEQGAVNFNLLHGLLHAIVEKLNDPSVSTDRLMRPQSEAAGQPVQVGGQ--KSAKSRRDLDGTESVVTTDSGLPRDGTFGSGGAGGGLNSEQLLDRLSNVETQLDALNSLPSGKDVFDQVFGS----KGKSDG-RATADMFQMVQMRRRTDANEEGVARLSSLVDELMKEMGRLRKENENLRSEMKDLSSMKSVWER-------LAQLESQLSELRDSMQNLPTKEMFKDFVTWESLEKALRGIREDMARMANPPERVVVNMSTD 271          
BLAST of Glutamine-rich protein 2 vs. TrEMBL
Match: A0A1I8GW59 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 3.521e-89
Identity = 211/469 (44.99%), Postives = 285/469 (60.77%), Query Frame = 3
Query: 1443 PASQISSPGPSEVCAEMLEKLGILTTAHDLLDKRVVVLEEEMPNKADKKDLENLKIPDDLLKTIALLKAQMDSLMASKNRDGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVXXXXXXXXXXXXXXXXXXXXDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRG---GDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNKNMYIHNHTKRFQDVRVINPKYVSYGADIVDVYQTPRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTLKEEADLTGADGHIYKGRIDRSQTTMINNNNYIEQPSNDKLPPVTASQRSQTIVNNNFTPRGAFVTSRPKSAVKITPR--HSSSAGPTRPSSAR 2834
            P S+  SPGPSE   EMLE LG LT  H+ L+ RV  LE EMPNKADKKDLENLK+PDDLLK +  L++ +D++  S++RD EAL RIR  L+  Q ++  +N  L+ L    KD+  +L+ELF IT   +  KAD  Y++  L +KADK  LDTKVNFSLFDET GNL+S ID++L+KL+A E++LR LL+ L +D++GK+D+ +++ALK+W+EKRL+ALA K+K   G    D+ EDDAAGLR+QLLQHFHCISCDRPL++  H       LPE   L  +KS+RPYTTFELD+IRQH+K+                       V+ G +++D Y TPR    +   + P                        +EE ++ G DGHIYKGRIDR  T +  ++   E P+  KLPPV+ ++ S    +      G     RP ++ +   +  HSS A   RP SAR
Sbjct:  245 PMSRPQSPGPSEALREMLESLGKLTNRHESLEVRVDKLEHEMPNKADKKDLENLKLPDDLLKQLNDLRSLVDNMRQSRDRDVEALNRIRKALSDQQKELERINTVLEALAQGGKDVGEKLQELFRITAHLDEVKADKDYLDQQLESKADKIQLDTKVNFSLFDETTGNLNSQIDELLQKLMATEDDLRRLLKLLGADLDGKLDRLEMDALKDWLEKRLKALAAKIKSGGGAGVADINEDDAAGLRRQLLQHFHCISCDRPLEMGAH--PPAPSLPEKPALSVTKSMRPYTTFELDSIRQHAKS-----------------------VNAG-EMLDAYYTPRA---AAAAAAPPN----------------------REETEIQGMDGHIYKGRIDRFFTEVRASD---EPPT--KLPPVSGAKSS---ASRGSGTSGDASGQRPSTSGQQQQQRPHSSRA---RPVSAR 651          

HSP 2 Score: 166.777 bits (421), Expect = 6.401e-39
Identity = 96/258 (37.21%), Postives = 151/258 (58.53%), Query Frame = 3
Query:  114 LALGAPEVGAVNFNVLHSLLHAILAKL---EMGDNPVDIAVEENKTPASKSKLP-----VIPVSTIPY---------------HGLQDRIKILENQISDLNSLPSNKDILNTILDNNTKDQAKSDNQRLVSDLWQTINIRKKVNANEEGIDRLSSMVDSILNEMKQLKSENETMKKQLEDLSGLKGMGDKVDGLQNEIADLLDQFNKLKDILAEYPPPDAFKNIVTWDGLEKALKGIKDDMDDLRKPTERVVVNMATE 818
            +A+G+PE GAVNFN+LH LLHAI+ KL        P  +  +  K+  S+  L      V   S +P                  L DR+  +E Q+  LNSLPS KD+ + +  +    + KSD  R  +D++Q + +R++ +ANEEG+ RLSS+VD ++ EM +L+ ENE ++ +++DLS +K + ++       +A L  Q ++L+D +   P  + FK+ VTW+ LEKAL+GI++DM  +  P ERVVVNM+T+
Sbjct:    1 MAVGSPEQGAVNFNLLHGLLHAIVEKLNDPSAAGQPAQVGGQ--KSAKSRRDLDGTESVVTTDSGLPRDGTFGSGGAGGGLNSEQLLDRLSNVETQLDALNSLPSGKDVFDQVFGS----KGKSDG-RATADMFQMVQMRRRTDANEEGVARLSSLVDELMKEMGRLRKENENLRSEMKDLSSMKSVWER-------LAQLESQLSELRDSMQNLPTKEMFKDFVTWESLEKALRGIREDMARMANPPERVVVNMSTD 244          
BLAST of Glutamine-rich protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000046271.1 (glutamine rich 2 [Source:NCBI gene;Acc:103028394])

HSP 1 Score: 149.058 bits (375), Expect = 1.124e-36
Identity = 114/423 (26.95%), Postives = 206/423 (48.70%), Query Frame = 3
Query: 1488 EMLEKLGILTTAHDLLDKRVVVLEEEMPNKADKKDLENLK----------IPDDLLKTIALLKAQMDSLMASKNRDGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVXXXXXXXXXXXXXXXXXXXXDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNKNMYIH-NHTKRFQDVRVIN-----------------------------------PKYVSYGADIVDVYQT-PRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTLKEEADLTGADGHIYKGRI 2615
            E L  +G L   H+ L+ RV  LE     KAD   ++ L+          +P+++ + +  L   M++++A +++  E  + ++  +  LQ +   ++ T   L  +      +++ L+   ++ + +KAD   +E  +  KADK  L++KV+ + FD     L+ + +++L ++   E++    +  +++++  K+D+ +L  LK+ +E R R++ ++L+     +   D+AAG RKQL+  F+CISCDRP+D+MT G +    +P   G P  KS RPYT +EL+ +RQ  ++   +  + +   R+ D RV N                                   P+  SYG      Y T  R CGG+HT +Y  ++   L ++      EE        E D+ G DGHIYKGR+
Sbjct:  162 EALRNVGRLQEKHESLEARVKCLE---GGKADHAQVQQLRELLSDMGERDMPENIQEQLNHLNTLMETVIADRDKTSELASDVQSTILCLQSECEQIHITTTHLQEDQSQKQRRIDYLYKAVEELDKKKADREVVEMKIGIKADKQALESKVSRTQFDTKTEQLNGMFEELLGRVTCQEQDWNKFIDKISTEMESKLDRIELEPLKQQLEDRWRSIRKQLQTQPAPEY--DEAAGFRKQLVARFNCISCDRPVDMMTPGQHLLT-VPSAPGFPCHKSNRPYTVYELEQVRQPKRSIAQIRQNSSEMCRWTD-RVQNKFDSSQRDTSQSSLFPPISLPLLRTSQSLPQHERIPEMASYG------YLTMSRSCGGNHTLTYANRRYSHLQHITQLIQTEE------DSEVDILGVDGHIYKGRV 565          
BLAST of Glutamine-rich protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000051793.1 (glutamine rich 2 [Source:NCBI gene;Acc:103028394])

HSP 1 Score: 132.109 bits (331), Expect = 6.098e-31
Identity = 101/365 (27.67%), Postives = 176/365 (48.22%), Query Frame = 3
Query: 1635 ALLKAQMDSLMA-SKNRDGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVXXXXXXXXXXXXXXXXXXXXDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNKNMYIH-NHTKRFQDVRVIN-----------------------------------PKYVSYGADIVDVYQT-PRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTLKEEADLTGADGHIYKGRI 2615
              +K Q  S MA   +   E  + ++  +  LQ +   ++ T   L  +      +++ L+   ++ + +KAD   +E  +  KADK  L++KV+ + FD     L+ + +++L ++   E++    +  +++++  K+D+ +L  LK+ +E R R++ ++L+     +   D+AAG RKQL+  F+CISCDRP+D+MT G +    +P   G P  KS RPYT +EL+ +RQ  ++   +  + +   R+ D RV N                                   P+  SYG      Y T  R CGG+HT +Y  ++   L ++      EE        E D+ G DGHIYKGR+
Sbjct:  393 GFMKQQASSRMAQCTDATSELASDVQSTILCLQSECEQIHITTTHLQEDQSQKQRRIDYLYKAVEELDKKKADREVVEMKIGIKADKQALESKVSRTQFDTKTEQLNGMFEELLGRVTCQEQDWNKFIDKISTEMESKLDRIELEPLKQQLEDRWRSIRKQLQTQPAPEY--DEAAGFRKQLVARFNCISCDRPVDMMTPGQHLLT-VPSAPGFPCHKSNRPYTVYELEQVRQPKRSIAQIRQNSSEMCRWTD-RVQNKFDSSQRDTSQSSLFPPISLPLLRTSQSLPQHERIPEMASYG------YLTMSRSCGGNHTLTYANRRYSHLQHITQLIQTEE------DSEVDILGVDGHIYKGRV 741          
BLAST of Glutamine-rich protein 2 vs. Ensembl Nematostella
Match: EDO37286 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG74])

HSP 1 Score: 123.635 bits (309), Expect = 1.372e-28
Identity = 106/327 (32.42%), Postives = 174/327 (53.21%), Query Frame = 3
Query: 1683 DGEALARIRDILNALQ---DKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVXXXXXXXXXXXXXXXXXXXXDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNKNMYIHNHTKRFQDVRVINPKYVSYGADIVDVYQTP----------RPCGGSHTTSYPQKKMVRLG-NMNNSFIDEELHTRTLK-EEADLTGADGHIYKGRID 2618
            D + L+ IR ++  LQ   DK+   N ++     + K +++ +++   +T  H+  KAD   +   +  KADK+ +  KV    FD   G +   + D+L++L   E  L+  + S++S+V  K+DKD++  LK ++E+R++AL  K K +      E+ AAG RK L+++FHCISCD+P++    G+     LP  + +P  KS RPYTTFEL+ IRQH      M +    +RF+   VI+ +      +++ +   P          RPCGG+HT S+P  + V  G +MN   +  E   +       ++ G DGHIYKG +D
Sbjct:  569 DDKDLSLIRTMIFDLQEEKDKLKQANRSIWDEIYQQKKVIDDIDD--QVTTLHDV-KADKSQLLSEVEVKADKADMLLKVGRDDFDHYIGLVDQSLRDLLQRLEGHETALKQAIESISSNVRTKLDKDEVEPLKHYLEERIKAL--KPKPVEAAP-PEEFAAGFRKVLIKNFHCISCDKPVEFARDGM--FPPLPSAQPMPGKKSNRPYTTFELEQIRQHMLRG-GMALEQ--ERFE---VIDKQRQKIQKELLMLSGVPNIQGLAEVIDRPCGGTHTLSFPHSRQVVRGLHMNKEDVTLETICKMKNYTSVNIMGQDGHIYKGLVD 881          
BLAST of Glutamine-rich protein 2 vs. Ensembl Nematostella
Match: EDO40381 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7E0])

HSP 1 Score: 116.316 bits (290), Expect = 2.529e-26
Identity = 125/485 (25.77%), Postives = 218/485 (44.95%), Query Frame = 3
Query: 1461 SPGPSEVCAEMLEKLGILTTAHDLLDKRVVVLEEEMPNKADKKDLENLKIPDDLLKTIALLKAQMDSL-----------------MASKNR-------------------------------DGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQ----LEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVXXXX---XXXXXXXXXXXXXXXXDVNGKVDKDDLNALKEWIEKRLRALAEKLKHL--RGGDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNKNMYIHNHTKRFQDVRVINPKYVSYGADIVDVYQTPRPCGGSHTT-SYPQKKMVRLGNMNNSFI-------DEELHTRTLKEEAD----LTGADGHIYKGR------IDRSQTTMINNNNYIEQPSNDKLPPV 2690
            S  PS+   E L ++G L+  + +++++V V++E +PNK DK +L+   IP+DL   I  ++A +DS+                 +  +NR                               D EA+  IR +L  +QD+       +D    + +D L+Q    +E L+   +  +  KAD   +   +  KADK  LD+KV+ + FD +   L   + + L+K+   +  E  L+  L+ L+ ++  K+D     A+++++E+R+ A  +K +++  R   V    AAG+R+ LL +FHCISC+RP+++  +  +    LP P+ +   +S  PY ++E+D IR + +  +   +H   K   +                  +   RPCGGSHT  ++  +K  R+ +   S +       D   H      E      L G DGH+Y+GR      I RS         +   PS   LPP+
Sbjct:  370 SSHPSQEMRECLRQIGELSDKNRIVEEQVKVIKEVLPNKIDKTELD---IPEDLKNRIDAMQADLDSISQKMYGNSSGELDELRQLYQENRDKIEAIKRELAAMARQAKQAYIQRPSSGKGVDNEAMDNIRALLKDVQDEQEKAAKKMDYKLTDLQDDLSQKREHIEALYNYVQKLQDSKADKDNVAIEMDIKADKEALDSKVSLTTFDNSFNMLDEGLREALQKMDDYMNEELALKQALKQLSCEMKEKMDGQAFKAMQDFLERRI-ADVQKSRNMIAREAKVELTGAAGIRRPLL-NFHCISCNRPVEV-PYNRDAQQSLPSPQAVKLKRSKGPYISYEMDQIRHYQRTFQQPALHPIEKPMNE------------------FVAKRPCGGSHTVLNHTIRKPTRIVSSQLSNVLAASVRDDPTAHVPNWSREISVIDLLKGKDGHVYRGRYKAIPPISRS---------HKHTPSESDLPPL 821          

HSP 2 Score: 64.6994 bits (156), Expect = 1.646e-10
Identity = 75/310 (24.19%), Postives = 127/310 (40.97%), Query Frame = 3
Query:   90 ISMRSMVDLALGAPEVGAVNFNVLHSLLHAILAKLEMGDNPVDIA-VEENKTPASKSKLPVIPVSTI-------------------PYHGLQDRIKILENQI---------------------------SDLNSLPSNKDILNTILDNNT----KDQAKSDNQRLVSD-----LWQTINIRKKVNANEEGIDRLSSMVDSILNEMKQLKSENETMKKQLEDLSGLKG-MGDKVDGLQN-EIADLLDQFNKLKDILAEYPPPDAFKNIVTWDGLEKALKGIKDDMDDLRKPTERVVVNMATEDEIKQDKEL 845
            + +  +VDL+L  PEVG VNFN LH LLHAIL  + +G +  +I  V  +K+P S+SK      S                      Y G ++   + E +                            S ++ L     IL+ +  N +      Q++S NQ    D     +WQ + I  ++ A EE IDR+ ++++  L   K +   N+ ++   ++LS LK  + +  D + + E  + + +  +++  L+     +  +  V W  LE AL   K      R  + +      TED    D EL
Sbjct:    6 LELHKLVDLSLRTPEVGVVNFNHLHKLLHAILDHIGLGYDGKNITKVYASKSPVSESKTRTDHTSEAEDVKDEGDTKATNETEKEKEYAGTEESTVVSEQETLKSPTNAVRAVQEDEIERLQSVQRYMQSKISELEEKLKILDALPTNRSIIEKAQQSESTNQLTSKDNALAGIWQFLKINSRLLAAEEAIDRIMNILNEFLGSGKSVGELNDNLQDIAKELSNLKSQINNNNDAISSTEHQEAMGKIEEIQRKLSGLASKEDLREYVKWPALENALNAGKQ-----RNSSAKNETKTHTEDAKLDDSEL 310          
BLAST of Glutamine-rich protein 2 vs. Ensembl Nematostella
Match: EDO30155 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1K8])

HSP 1 Score: 97.0561 bits (240), Expect = 1.211e-21
Identity = 76/265 (28.68%), Postives = 134/265 (50.57%), Query Frame = 3
Query:   90 ISMRSMVDLALGAPEVGAVNFNVLHSLLHAILAKLEMGDNPVDIA---------------------VEENKTPASKS-KLPVIPV---------STIPYHGLQDRIKILENQISDLNSLPSNKDILNTILDNNTKDQAKSDNQRLVSDLWQTINIRKKVNANEEGIDRLSSMVDSIL---NEMKQLKSENETMKKQLEDLSGLK-GMGDKVDGL--------QNEIADLLDQFNKLKDILAEYPPPDAFKNI---VTWDGLEKAL 746
            + +  ++ LALG PEVGAVNFN+LH +L  IL  L +     +I+                     +E+ +T + ++ K+   P          ST  Y  L+ ++  +E ++  L+ +PSN +IL        + + K D +  V D+WQ INI +++ A E  I++L+S++D+++   N++K+L +  + +KKQ+ +L   +  +  +V  L        Q ++ DL+ + NKLK  + E P  D   N+   V W  LE+AL
Sbjct:    5 VELEQLLGLALGTPEVGAVNFNILHGILREILKHLGIDKKVTEISEDGGLRGAIAILKSANEGRQDIEKTETDSGQTEKVKSEPTANLAKPSVFSTPQYGNLESKLSKIEKRLELLDDIPSNTEILQ-------RAKQKQDARTPVGDMWQFININRRLGATETAIEKLTSLLDNMMAEVNDVKELANGIDDLKKQISELEKQQSSLESRVKALESVDNSEEQKKLEDLIKELNKLKSRVNELPTKDDLDNLDIYVKWPQLEEAL 262          
BLAST of Glutamine-rich protein 2 vs. Ensembl Nematostella
Match: EDO41266 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4W5])

HSP 1 Score: 97.0561 bits (240), Expect = 2.186e-20
Identity = 99/354 (27.97%), Postives = 169/354 (47.74%), Query Frame = 3
Query: 1584 KKDLE-NLKIPDDLLKTIALLKAQMDSLMASKNRDGE---ALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVXXXXXXXXXXXXXXXXXX---XXDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDA--AGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNKNMY--------------IHNHTKRFQD-VRVINPKY-------------VSYGADIVDVYQTPRPCGGSHTTSYPQKKMVRLGNMNNSFI 2534
            KKD+E N K  D L + ++L +A      A K +D E   A+  +  ++  LQ K + +  T  +L  E+      L+EL       E +KAD   +   +  KA+K  L++KV+ + FDE+   L   +++ L+K+         L  +L    S +  K+D+++L+ L+  +E R++ +      ++   V  +D   AG R+ + +  HCISCDR LD+ T        LP+ + LP  KS +PYTT+EL+ IRQH K N  +               + N      + V +I+P +                G D++D+  + R CGGSHT  +P ++ V+  +  N ++
Sbjct:  490 KKDMEKNKKAIDQLSRELSLFRA------ARKAQDAEGFNAVHHVHSMVLELQTKHDKMMATTAELVNEYNRREKVLDELADSIDKLEQKKADKQDVNKNIDIKANKEDLESKVSMNQFDESFNLLDRGLNEALEKMGNQMTIEDALKETLMDLQSKLTLKLDRNELDNLRAQLESRIKEVQVTRTVIQ---VKPEDGEPAGFRRNITEKVHCISCDRLLDVQTS--VAPPPLPKNQPLPSHKSAKPYTTYELEHIRQHQKMNVGLRKAVIGADLPYSAQKLRNEVVAMTEMVDLIDPLFRLPSVVLAIPFIPCRNGMDLIDLPPSQRYCGGSHTIIHPLRRNVKSNSHFNQYV 832          
BLAST of Glutamine-rich protein 2 vs. Ensembl Nematostella
Match: EDO30154 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1K7])

HSP 1 Score: 83.1889 bits (204), Expect = 1.641e-16
Identity = 66/193 (34.20%), Postives = 107/193 (55.44%), Query Frame = 3
Query: 1671 SKNRDGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVXXXXXXXXXXXXXXXXXXXXDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGD--VTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINY 2243
             K + G A+  +R+++  LQ +   + +T ++L  E       L+ L+      +  KAD   +   +  KADK  LD  V+   FD+T G L   I D+L +L   +  L++ L  L ++V+ K+D+ +++ LK++ E++++A+  K KH    D  + ED AAG RK LL+ FHCISCDRP+D M  G  Y
Sbjct:  156 GKTQGGGAIDSLRNMVLDLQAENEKLKNTTNELIEEENRKQKHLDALYSYCDKLQENKADKEQVAMEIDVKADKRSLDNLVSRLKFDQTVGTLDQAIQDLLSRLDGYDAGLKDALAQLGNEVDQKLDRMEIDPLKDYFERKIKAM--KCKH---ADLPLNEDPAAGFRKALLR-FHCISCDRPVD-MAQGPQY 341          
BLAST of Glutamine-rich protein 2 vs. Planmine SMEST
Match: SMESG000081231.1 (SMESG000081231.1)

HSP 1 Score: 1910.58 bits (4948), Expect = 0.000e+0
Identity = 988/1000 (98.80%), Postives = 988/1000 (98.80%), Query Frame = 3
Query:   54 MEVLNPINEIKLISMRSMVDLALGAPEVGAVNFNVLHSLLHAILAKLEMGDNPVDIAVEENKTPASKSKLPVIPVSTIPYHGLQDRIKILENQISDLNSLPSNKDILNTILDNNTKDQAKSDNQRLVSDLWQTINIRKKVNANEEGIDRLSSMVDSILNEMKQLKSENETMKKQLEDLSGLKGMGDKVDGLQNEIADLLDQFNKLKDILAEYPPPDAFKNIVTWDGLEKALKGIKDDMDDLRKPTERVVVNMATEDEIKQDKELLKKYEAYLEWIDGGCNLKLTLPVEHVILEVNRLVELGQITPNVAKDEDEIMFNLKIPLKDAQSDFKSDKLKTIIWKLIPKTEDTKDRITYADELELNVPLTKWQLLQAGVINVPNQEILEGIDHFVIDIPIRNEQICKSNYIVPEPVETAPLPPEPVSTPSTISPPKPVFTPSAVFPLXXXXXXXXXXXXXXXXXXXXRPASQISSPGPSEVCAEMLEKLGILTTAHDLLDKRVVVLEEEMPNKADKKDLENLKIPDDLLKTIALLKAQMDSLMASKNRDGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVXXXXXXXXXXXXXXXXXXXXDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNKNMYIHNHTKRFQDVRVINPKYVSYGADIVDVYQTPRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTLKEEADLTGADGHIYKGRIDRSQTTMINNNNYIEQPSNDKLPPVTASQRSQTIVNNNFTPRGAFVTSRPKSAVKITPRHSSSAGPTRPSSARVILQEPDSRPTSPVPQVNENSIQESSDELMQVTNNFNQMSNNETIITSESFNLEILNQSENEPKSAVDEAVAL 3053
            MEVLNPINEIKLISMRSMVDLALGAPEVGAVNFNVLHSLLHAILAKLEMGDNPVDIAVEENKTPASKSKLPVIPVSTIPYHGLQDRIKILENQISDLNSLPSNKDILNTILDNNTKDQAKSDNQRLVSDLWQTINIRKKVNANEEGIDRLSSMVDSILNEMKQLKSENETMKKQLEDLSGLKGMGDKVDGLQNEIADLLDQFNKLKDILAEYPPPDAFKNIVTWDGLEKALKGIKDDMDDLRKPTERVVVNMATE            YEAYLEWIDGGCNLKLTLPVEHVILEVNRLVELGQITPNVAKDEDEIMFNLKIPLKDAQSDFKSDKLKTIIWKLIPKTEDTKDRITYADELELNVPLTKWQLLQAGVINVPNQEILEGIDHFVIDIPIRNEQICKSNYIVPEPVETAPLPPEPVSTPSTISPPKPVFTPSAVFPLKPAPAPSTSSDKKSSSLPMSRPASQISSPGPSEVCAEMLEKLGILTTAHDLLDKRVVVLEEEMPNKADKKDLENLKIPDDLLKTIALLKAQMDSLMASKNRDGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVLKKLLAAEEELRNLLRSLASDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNKNMYIHNHTKRFQDVRVINPKYVSYGADIVDVYQTPRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTLKEEADLTGADGHIYKGRIDRSQTTMINNNNYIEQPSNDKLPPVTASQRSQTIVNNNFTPRGAFVTSRPKSAVKITPRHSSSAGPTRPSSARVILQEPDSRPTSPVPQVNENSIQESSDELMQVTNNFNQMSNNETIITSESFNLEILNQSENEPKSAVDEAVAL
Sbjct:    1 MEVLNPINEIKLISMRSMVDLALGAPEVGAVNFNVLHSLLHAILAKLEMGDNPVDIAVEENKTPASKSKLPVIPVSTIPYHGLQDRIKILENQISDLNSLPSNKDILNTILDNNTKDQAKSDNQRLVSDLWQTINIRKKVNANEEGIDRLSSMVDSILNEMKQLKSENETMKKQLEDLSGLKGMGDKVDGLQNEIADLLDQFNKLKDILAEYPPPDAFKNIVTWDGLEKALKGIKDDMDDLRKPTERVVVNMATE------------YEAYLEWIDGGCNLKLTLPVEHVILEVNRLVELGQITPNVAKDEDEIMFNLKIPLKDAQSDFKSDKLKTIIWKLIPKTEDTKDRITYADELELNVPLTKWQLLQAGVINVPNQEILEGIDHFVIDIPIRNEQICKSNYIVPEPVETAPLPPEPVSTPSTISPPKPVFTPSAVFPLKPAPAPSTSSDKKSSSLPMSRPASQISSPGPSEVCAEMLEKLGILTTAHDLLDKRVVVLEEEMPNKADKKDLENLKIPDDLLKTIALLKAQMDSLMASKNRDGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVLKKLLAAEEELRNLLRSLASDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNKNMYIHNHTKRFQDVRVINPKYVSYGADIVDVYQTPRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTLKEEADLTGADGHIYKGRIDRSQTTMINNNNYIEQPSNDKLPPVTASQRSQTIVNNNFTPRGAFVTSRPKSAVKITPRHSSSAGPTRPSSARVILQEPDSRPTSPVPQVNENSIQESSDELMQVTNNFNQMSNNETIITSESFNLEILNQSENEPKSAVDEAVAL 988          
BLAST of Glutamine-rich protein 2 vs. Planmine SMEST
Match: SMESG000081231.1 (SMESG000081231.1)

HSP 1 Score: 1869.36 bits (4841), Expect = 0.000e+0
Identity = 976/1008 (96.83%), Postives = 976/1008 (96.83%), Query Frame = 3
Query:   54 MEVLNPINEIKLISMRSMVDLALGAPEVGAVNFNVLHSLLHAILAKLEMGDNPVDIAVEENKTPASKSKLPVIPVSTIPYHGLQDRIKILENQISDLNSLPSNKDILNTILDNNTKDQAKSDNQRLVSDLWQTINIRKKVNANEEGIDRLSSMVDSILNEMKQLKSENETMKKQLEDLSGLKGMGDKVDGLQNEIADLLDQFNKLKDILAEYPPPDAFKNIVTWDGLEKALKGIKDDMDDLRKPTERVVVNMATEDEIKQDKELLKKYEAYLEWIDGGCNLKLTLPVEHVILEVNRLVELGQITPNVAKDEDEIMFNLKIPLKDAQSDFKSDKLKTIIWKLIPKTEDTKDRITYADELELNVPLTKWQLLQAGVINVPNQEILEGIDHFVIDIPIRNEQICKSNYIVPEPVETAPLPPEPVSTPSTISPPKPVFTPSAVFPLXXXXXXXXXXXXXXXXXXXXRPASQISSPGPSEVCAEMLEKLGILTTAHDLLDKRVVVLEEEMPNKADKKDLENLKIPDDLLKTIALLKAQMDSLMASKNR--------DGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVXXXXXXXXXXXXXXXXXXXXDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNKNMYIHNHTKRFQDVRVINPKYVSYGADIVDVYQTPRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTLKEEADLTGADGHIYKGRIDRSQTTMINNNNYIEQPSNDKLPPVTASQRSQTIVNNNFTPRGAFVTSRPKSAVKITPRHSSSAGPTRPSSARVILQEPDSRPTSPVPQVNENSIQESSDELMQVTNNFNQMSNNETIITSESFNLEILNQSENEPKSAVDEAVAL 3053
            MEVLNPINEIKLISMRSMVDLALGAPEVGAVNFNVLHSLLHAILAKLEMGDNPVDIAVEENKTPASKSKLPVIPVSTIPYHGLQDRIKILENQISDLNSLPSNKDILNTILDNNTKDQAKSDNQRLVSDLWQTINIRKKVNANEEGIDRLSSMVDSILNEMKQLKSENETMKKQLEDLSGLKGMGDKVDGLQNEIADLLDQFNKLKDILAEYPPPDAFKNIVTWDGLEKALKGIKDDMDDLRKPTERVVVNMATE            YEAYLEWIDGGCNLKLTLPVEHVILEVNRLVELGQITPNVAKDEDEIMFNLKIPLKDAQSDFKSDKLKTIIWKLIPKTEDTKDRITYADELELNVPLTKWQLLQAGVINVPNQEILEGIDHFVIDIPIRNEQICKSNYIVPEPVETAPLPPEPVSTPSTISPPKPVFTPSAVFPLKPAPAPSTSSDKKSSSLPMSRPASQISSPGPSEVCAEMLEKLGILTTAHDLLDKRVVVLEEEMPNKADKKDLENLKIPDDLLKTIALLKAQMDSLMASKNR        DGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVLKKLLAAEEELRNLLRSLASDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKN            FQDVRVINPKYVSYGADIVDVYQTPRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTLKEEADLTGADGHIYKGRIDRSQTTMINNNNYIEQPSNDKLPPVTASQRSQTIVNNNFTPRGAFVTSRPKSAVKITPRHSSSAGPTRPSSARVILQEPDSRPTSPVPQVNENSIQESSDELMQVTNNFNQMSNNETIITSESFNLEILNQSENEPKSAVDEAVAL
Sbjct:    1 MEVLNPINEIKLISMRSMVDLALGAPEVGAVNFNVLHSLLHAILAKLEMGDNPVDIAVEENKTPASKSKLPVIPVSTIPYHGLQDRIKILENQISDLNSLPSNKDILNTILDNNTKDQAKSDNQRLVSDLWQTINIRKKVNANEEGIDRLSSMVDSILNEMKQLKSENETMKKQLEDLSGLKGMGDKVDGLQNEIADLLDQFNKLKDILAEYPPPDAFKNIVTWDGLEKALKGIKDDMDDLRKPTERVVVNMATE------------YEAYLEWIDGGCNLKLTLPVEHVILEVNRLVELGQITPNVAKDEDEIMFNLKIPLKDAQSDFKSDKLKTIIWKLIPKTEDTKDRITYADELELNVPLTKWQLLQAGVINVPNQEILEGIDHFVIDIPIRNEQICKSNYIVPEPVETAPLPPEPVSTPSTISPPKPVFTPSAVFPLKPAPAPSTSSDKKSSSLPMSRPASQISSPGPSEVCAEMLEKLGILTTAHDLLDKRVVVLEEEMPNKADKKDLENLKIPDDLLKTIALLKAQMDSLMASKNRAVPEVVSTDGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVLKKLLAAEEELRNLLRSLASDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKN------------FQDVRVINPKYVSYGADIVDVYQTPRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTLKEEADLTGADGHIYKGRIDRSQTTMINNNNYIEQPSNDKLPPVTASQRSQTIVNNNFTPRGAFVTSRPKSAVKITPRHSSSAGPTRPSSARVILQEPDSRPTSPVPQVNENSIQESSDELMQVTNNFNQMSNNETIITSESFNLEILNQSENEPKSAVDEAVAL 984          
BLAST of Glutamine-rich protein 2 vs. Planmine SMEST
Match: SMESG000081231.1 (SMESG000081231.1)

HSP 1 Score: 1806.96 bits (4679), Expect = 0.000e+0
Identity = 946/1000 (94.60%), Postives = 946/1000 (94.60%), Query Frame = 3
Query:   54 MEVLNPINEIKLISMRSMVDLALGAPEVGAVNFNVLHSLLHAILAKLEMGDNPVDIAVEENKTPASKSKLPVIPVSTIPYHGLQDRIKILENQISDLNSLPSNKDILNTILDNNTKDQAKSDNQRLVSDLWQTINIRKKVNANEEGIDRLSSMVDSILNEMKQLKSENETMKKQLEDLSGLKGMGDKVDGLQNEIADLLDQFNKLKDILAEYPPPDAFKNIVTWDGLEKALKGIKDDMDDLRKPTERVVVNMATEDEIKQDKELLKKYEAYLEWIDGGCNLKLTLPVEHVILEVNRLVELGQITPNVAKDEDEIMFNLKIPLKDAQSDFKSDKLKTIIWKLIPKTEDTKDRITYADELELNVPLTKWQLLQAGVINVPNQEILEGIDHFVIDIPIRNEQICKSNYIVPEPVETAPLPPEPVSTPSTISPPKPVFTPSAVFPLXXXXXXXXXXXXXXXXXXXXRPASQISSPGPSEVCAEMLEKLGILTTAHDLLDKRVVVLEEEMPNKADKKDLENLKIPDDLLKTIALLKAQMDSLMASKNRDGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVXXXXXXXXXXXXXXXXXXXXDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNKNMYIHNHTKRFQDVRVINPKYVSYGADIVDVYQTPRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTLKEEADLTGADGHIYKGRIDRSQTTMINNNNYIEQPSNDKLPPVTASQRSQTIVNNNFTPRGAFVTSRPKSAVKITPRHSSSAGPTRPSSARVILQEPDSRPTSPVPQVNENSIQESSDELMQVTNNFNQMSNNETIITSESFNLEILNQSENEPKSAVDEAVAL 3053
            MEVLNPINEIKLISMRSMVDLALGAPEVGAVNFNVLHSLLHAILAKLEMGDNPVDIAVEENKTPASKSKLPVIPVSTIPYHGLQDRIKILENQISDLNSLPSNKDILNTILDNNTKDQAKSDNQRLVSDLWQTINIRKKVNANEEGIDRLSSMVDSILNEMKQLKSENETMKKQLEDLSGLKGMGDKVDGLQNEIADLLDQFNKLKDILAEYPPPDAFKNIVTWDGLEKALKGIKDDMDDLRKPTERVVVNMATE            YEAYLEWIDGGCNLKLTLPVEHVILEVNRLVELGQITPNVAKDEDEIMFNLKIPLK                                          KWQLLQAGVINVPNQEILEGIDHFVIDIPIRNEQICKSNYIVPEPVETAPLPPEPVSTPSTISPPKPVFTPSAVFPLKPAPAPSTSSDKKSSSLPMSRPASQISSPGPSEVCAEMLEKLGILTTAHDLLDKRVVVLEEEMPNKADKKDLENLKIPDDLLKTIALLKAQMDSLMASKNRDGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVLKKLLAAEEELRNLLRSLASDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNKNMYIHNHTKRFQDVRVINPKYVSYGADIVDVYQTPRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTLKEEADLTGADGHIYKGRIDRSQTTMINNNNYIEQPSNDKLPPVTASQRSQTIVNNNFTPRGAFVTSRPKSAVKITPRHSSSAGPTRPSSARVILQEPDSRPTSPVPQVNENSIQESSDELMQVTNNFNQMSNNETIITSESFNLEILNQSENEPKSAVDEAVAL
Sbjct:    1 MEVLNPINEIKLISMRSMVDLALGAPEVGAVNFNVLHSLLHAILAKLEMGDNPVDIAVEENKTPASKSKLPVIPVSTIPYHGLQDRIKILENQISDLNSLPSNKDILNTILDNNTKDQAKSDNQRLVSDLWQTINIRKKVNANEEGIDRLSSMVDSILNEMKQLKSENETMKKQLEDLSGLKGMGDKVDGLQNEIADLLDQFNKLKDILAEYPPPDAFKNIVTWDGLEKALKGIKDDMDDLRKPTERVVVNMATE------------YEAYLEWIDGGCNLKLTLPVEHVILEVNRLVELGQITPNVAKDEDEIMFNLKIPLK------------------------------------------KWQLLQAGVINVPNQEILEGIDHFVIDIPIRNEQICKSNYIVPEPVETAPLPPEPVSTPSTISPPKPVFTPSAVFPLKPAPAPSTSSDKKSSSLPMSRPASQISSPGPSEVCAEMLEKLGILTTAHDLLDKRVVVLEEEMPNKADKKDLENLKIPDDLLKTIALLKAQMDSLMASKNRDGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVLKKLLAAEEELRNLLRSLASDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNKNMYIHNHTKRFQDVRVINPKYVSYGADIVDVYQTPRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTLKEEADLTGADGHIYKGRIDRSQTTMINNNNYIEQPSNDKLPPVTASQRSQTIVNNNFTPRGAFVTSRPKSAVKITPRHSSSAGPTRPSSARVILQEPDSRPTSPVPQVNENSIQESSDELMQVTNNFNQMSNNETIITSESFNLEILNQSENEPKSAVDEAVAL 946          
BLAST of Glutamine-rich protein 2 vs. Planmine SMEST
Match: SMESG000081231.1 (SMESG000081231.1)

HSP 1 Score: 1764.2 bits (4568), Expect = 0.000e+0
Identity = 934/1008 (92.66%), Postives = 934/1008 (92.66%), Query Frame = 3
Query:   54 MEVLNPINEIKLISMRSMVDLALGAPEVGAVNFNVLHSLLHAILAKLEMGDNPVDIAVEENKTPASKSKLPVIPVSTIPYHGLQDRIKILENQISDLNSLPSNKDILNTILDNNTKDQAKSDNQRLVSDLWQTINIRKKVNANEEGIDRLSSMVDSILNEMKQLKSENETMKKQLEDLSGLKGMGDKVDGLQNEIADLLDQFNKLKDILAEYPPPDAFKNIVTWDGLEKALKGIKDDMDDLRKPTERVVVNMATEDEIKQDKELLKKYEAYLEWIDGGCNLKLTLPVEHVILEVNRLVELGQITPNVAKDEDEIMFNLKIPLKDAQSDFKSDKLKTIIWKLIPKTEDTKDRITYADELELNVPLTKWQLLQAGVINVPNQEILEGIDHFVIDIPIRNEQICKSNYIVPEPVETAPLPPEPVSTPSTISPPKPVFTPSAVFPLXXXXXXXXXXXXXXXXXXXXRPASQISSPGPSEVCAEMLEKLGILTTAHDLLDKRVVVLEEEMPNKADKKDLENLKIPDDLLKTIALLKAQMDSLMASKNR--------DGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVXXXXXXXXXXXXXXXXXXXXDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNKNMYIHNHTKRFQDVRVINPKYVSYGADIVDVYQTPRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTLKEEADLTGADGHIYKGRIDRSQTTMINNNNYIEQPSNDKLPPVTASQRSQTIVNNNFTPRGAFVTSRPKSAVKITPRHSSSAGPTRPSSARVILQEPDSRPTSPVPQVNENSIQESSDELMQVTNNFNQMSNNETIITSESFNLEILNQSENEPKSAVDEAVAL 3053
            MEVLNPINEIKLISMRSMVDLALGAPEVGAVNFNVLHSLLHAILAKLEMGDNPVDIAVEENKTPASKSKLPVIPVSTIPYHGLQDRIKILENQISDLNSLPSNKDILNTILDNNTKDQAKSDNQRLVSDLWQTINIRKKVNANEEGIDRLSSMVDSILNEMKQLKSENETMKKQLEDLSGLKGMGDKVDGLQNEIADLLDQFNKLKDILAEYPPPDAFKNIVTWDGLEKALKGIKDDMDDLRKPTERVVVNMATE            YEAYLEWIDGGCNLKLTLPVEHVILEVNRLVELGQITPNVAKDEDEIMFNLKIPLK                                          KWQLLQAGVINVPNQEILEGIDHFVIDIPIRNEQICKSNYIVPEPVETAPLPPEPVSTPSTISPPKPVFTPSAVFPLKPAPAPSTSSDKKSSSLPMSRPASQISSPGPSEVCAEMLEKLGILTTAHDLLDKRVVVLEEEMPNKADKKDLENLKIPDDLLKTIALLKAQMDSLMASKNR        DGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVLKKLLAAEEELRNLLRSLASDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKN            FQDVRVINPKYVSYGADIVDVYQTPRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTLKEEADLTGADGHIYKGRIDRSQTTMINNNNYIEQPSNDKLPPVTASQRSQTIVNNNFTPRGAFVTSRPKSAVKITPRHSSSAGPTRPSSARVILQEPDSRPTSPVPQVNENSIQESSDELMQVTNNFNQMSNNETIITSESFNLEILNQSENEPKSAVDEAVAL
Sbjct:    1 MEVLNPINEIKLISMRSMVDLALGAPEVGAVNFNVLHSLLHAILAKLEMGDNPVDIAVEENKTPASKSKLPVIPVSTIPYHGLQDRIKILENQISDLNSLPSNKDILNTILDNNTKDQAKSDNQRLVSDLWQTINIRKKVNANEEGIDRLSSMVDSILNEMKQLKSENETMKKQLEDLSGLKGMGDKVDGLQNEIADLLDQFNKLKDILAEYPPPDAFKNIVTWDGLEKALKGIKDDMDDLRKPTERVVVNMATE------------YEAYLEWIDGGCNLKLTLPVEHVILEVNRLVELGQITPNVAKDEDEIMFNLKIPLK------------------------------------------KWQLLQAGVINVPNQEILEGIDHFVIDIPIRNEQICKSNYIVPEPVETAPLPPEPVSTPSTISPPKPVFTPSAVFPLKPAPAPSTSSDKKSSSLPMSRPASQISSPGPSEVCAEMLEKLGILTTAHDLLDKRVVVLEEEMPNKADKKDLENLKIPDDLLKTIALLKAQMDSLMASKNRAVPEVVSTDGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVLKKLLAAEEELRNLLRSLASDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKN------------FQDVRVINPKYVSYGADIVDVYQTPRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTLKEEADLTGADGHIYKGRIDRSQTTMINNNNYIEQPSNDKLPPVTASQRSQTIVNNNFTPRGAFVTSRPKSAVKITPRHSSSAGPTRPSSARVILQEPDSRPTSPVPQVNENSIQESSDELMQVTNNFNQMSNNETIITSESFNLEILNQSENEPKSAVDEAVAL 942          
BLAST of Glutamine-rich protein 2 vs. Planmine SMEST
Match: SMESG000081231.1 (SMESG000081231.1)

HSP 1 Score: 1704.88 bits (4414), Expect = 0.000e+0
Identity = 907/994 (91.25%), Postives = 907/994 (91.25%), Query Frame = 3
Query:   96 MRSMVDLALGAPEVGAVNFNVLHSLLHAILAKLEMGDNPVDIAVEENKTPASKSKLPVIPVSTIPYHGLQDRIKILENQISDLNSLPSNKDILNTILDNNTKDQAKSDNQRLVSDLWQTINIRKKVNANEEGIDRLSSMVDSILNEMKQLKSENETMKKQLEDLSGLKGMGDKVDGLQNEIADLLDQFNKLKDILAEYPPPDAFKNIVTWDGLEKALKGIKDDMDDLRKPTERVVVNMATEDEIKQDKELLKKYEAYLEWIDGGCNLKLTLPVEHVILEVNRLVELGQITPNVAKDEDEIMFNLKIPLKDAQSDFKSDKLKTIIWKLIPKTEDTKDRITYADELELNVPLTKWQLLQAGVINVPNQEILEGIDHFVIDIPIRNEQICKSNYIVPEPVETAPLPPEPVSTPSTISPPKPVFTPSAVFPLXXXXXXXXXXXXXXXXXXXXRPASQISSPGPSEVCAEMLEKLGILTTAHDLLDKRVVVLEEEMPNKADKKDLENLKIPDDLLKTIALLKAQMDSLMASKNR--------DGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVXXXXXXXXXXXXXXXXXXXXDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKNNKNMYIHNHTKRFQDVRVINPKYVSYGADIVDVYQTPRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTLKEEADLTGADGHIYKGRIDRSQTTMINNNNYIEQPSNDKLPPVTASQRSQTIVNNNFTPRGAFVTSRPKSAVKITPRHSSSAGPTRPSSARVILQEPDSRPTSPVPQVNENSIQESSDELMQVTNNFNQMSNNETIITSESFNLEILNQSENEPKSAVDEAVAL 3053
            MRSMVDLALGAPEVGAVNFNVLHSLLHAILAKLEMGDNPVDIAVEENKTPASKSKLPVIPVSTIPYHGLQDRIKILENQISDLNSLPSNKDILNTILDNNTKDQAKSDNQRLVSDLWQTINIRKKVNANEEGIDRLSSMVDSILNEMKQLKSENETMKKQLEDLSGLKGMGDKVDGLQNEIADLLDQFNKLKDILAEYPPPDAFKNIVTWDGLEKALKGIKDDMDDLRKPTERVVVNMATE            YEAYLEWIDGGCNLKLTLPVEHVILEVNRLVELGQITPNVAKDEDEIMFNLKIPLK                                          KWQLLQAGVINVPNQEILEGIDHFVIDIPIRNEQICKSNYIVPEPVETAPLPPEPVSTPSTISPPKPVFTPSAVFPLKPAPAPSTSSDKKSSSLPMSRPASQISSPGPSEVCAEMLEKLGILTTAHDLLDKRVVVLEEEMPNKADKKDLENLKIPDDLLKTIALLKAQMDSLMASKNR        DGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVLKKLLAAEEELRNLLRSLASDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKN                         YGADIVDVYQTPRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTLKEEADLTGADGHIYKGRIDRSQTTMINNNNYIEQPSNDKLPPVTASQRSQTIVNNNFTPRGAFVTSRPKSAVKITPRHSSSAGPTRPSSARVILQEPDSRPTSPVPQVNENSIQESSDELMQVTNNFNQMSNNETIITSESFNLEILNQSENEPKSAVDEAVAL
Sbjct:    1 MRSMVDLALGAPEVGAVNFNVLHSLLHAILAKLEMGDNPVDIAVEENKTPASKSKLPVIPVSTIPYHGLQDRIKILENQISDLNSLPSNKDILNTILDNNTKDQAKSDNQRLVSDLWQTINIRKKVNANEEGIDRLSSMVDSILNEMKQLKSENETMKKQLEDLSGLKGMGDKVDGLQNEIADLLDQFNKLKDILAEYPPPDAFKNIVTWDGLEKALKGIKDDMDDLRKPTERVVVNMATE------------YEAYLEWIDGGCNLKLTLPVEHVILEVNRLVELGQITPNVAKDEDEIMFNLKIPLK------------------------------------------KWQLLQAGVINVPNQEILEGIDHFVIDIPIRNEQICKSNYIVPEPVETAPLPPEPVSTPSTISPPKPVFTPSAVFPLKPAPAPSTSSDKKSSSLPMSRPASQISSPGPSEVCAEMLEKLGILTTAHDLLDKRVVVLEEEMPNKADKKDLENLKIPDDLLKTIALLKAQMDSLMASKNRAVPEVVSTDGEALARIRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADLGYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVLKKLLAAEEELRNLLRSLASDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDDAAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYTTFELDAIRQHSKN-------------------------YGADIVDVYQTPRPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTLKEEADLTGADGHIYKGRIDRSQTTMINNNNYIEQPSNDKLPPVTASQRSQTIVNNNFTPRGAFVTSRPKSAVKITPRHSSSAGPTRPSSARVILQEPDSRPTSPVPQVNENSIQESSDELMQVTNNFNQMSNNETIITSESFNLEILNQSENEPKSAVDEAVAL 915          
The following BLAST results are available for this feature:
BLAST of Glutamine-rich protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
QRICH24.869e-3429.75glutamine rich 2 [Source:HGNC Symbol;Acc:HGNC:2532... [more]
QRICH26.892e-3429.75glutamine rich 2 [Source:HGNC Symbol;Acc:HGNC:2532... [more]
QRICH22.748e-1942.59glutamine rich 2 [Source:HGNC Symbol;Acc:HGNC:2532... [more]
C16orf962.764e-1130.05chromosome 16 open reading frame 96 [Source:HGNC S... [more]
back to top
BLAST of Glutamine-rich protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamine-rich protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG108691.604e-924.61gene:FBgn0031347 transcript:FBtr0077917[more]
back to top
BLAST of Glutamine-rich protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamine-rich protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000013175.11.151e-4028.66glutamine rich 2 [Source:NCBI gene;Acc:100497746][more]
back to top
BLAST of Glutamine-rich protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Qrich22.394e-3330.92glutamine rich 2 [Source:MGI Symbol;Acc:MGI:268491... [more]
Qrich21.180e-3130.83glutamine rich 2 [Source:MGI Symbol;Acc:MGI:268491... [more]
4930562C15Rik8.176e-1121.76RIKEN cDNA 4930562C15 gene [Source:MGI Symbol;Acc:... [more]
4930562C15Rik4.075e-632.17RIKEN cDNA 4930562C15 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Glutamine-rich protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q9H0J4|QRIC2_HUMAN3.310e-3329.75Glutamine-rich protein 2 OS=Homo sapiens OX=9606 G... [more]
sp|Q3V2A7|QRIC2_MOUSE1.674e-3230.92Glutamine-rich protein 2 OS=Mus musculus OX=10090 ... [more]
sp|A6NNT2|CP096_HUMAN1.328e-1030.05Uncharacterized protein C16orf96 OS=Homo sapiens O... [more]
sp|E9QMW4|CP096_MOUSE5.719e-1021.76Uncharacterized protein C16orf96 homolog OS=Mus mu... [more]
back to top
BLAST of Glutamine-rich protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8H6J27.638e-10246.65Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EEH71.048e-10046.35Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GEA91.048e-10046.35Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IU871.162e-10046.35Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GW593.521e-8944.99Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Glutamine-rich protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000046271.11.124e-3626.95glutamine rich 2 [Source:NCBI gene;Acc:103028394][more]
ENSAMXT00000051793.16.098e-3127.67glutamine rich 2 [Source:NCBI gene;Acc:103028394][more]
back to top
BLAST of Glutamine-rich protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamine-rich protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamine-rich protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO372861.372e-2832.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403812.529e-2625.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO301551.211e-2128.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412662.186e-2027.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO301541.641e-1634.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutamine-rich protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamine-rich protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081231.10.000e+098.80SMESG000081231.1[more]
SMESG000081231.10.000e+096.83SMESG000081231.1[more]
SMESG000081231.10.000e+094.60SMESG000081231.1[more]
SMESG000081231.10.000e+092.66SMESG000081231.1[more]
SMESG000081231.10.000e+091.25SMESG000081231.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020666 ID=SMED30020666|Name=Glutamine-rich protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=3265bp
TATAATTAATTTCATTTTCTTGACTTACTATTTTAGCACTTGTTAAATCA
AAAATGGAAGTTCTAAATCCCATAAATGAAATTAAACTAATTTCTATGAG
AAGCATGGTGGATTTGGCTTTAGGAGCACCTGAAGTTGGAGCAGTGAATT
TTAATGTTTTACATTCTTTACTGCATGCGATTCTTGCTAAACTAGAAATG
GGCGATAATCCTGTAGATATAGCAGTAGAAGAAAATAAAACACCAGCTTC
AAAATCAAAATTACCTGTAATACCGGTTTCCACAATTCCATATCATGGTC
TACAGGATCGAATAAAAATATTAGAAAATCAAATTAGTGATTTGAATTCT
TTGCCATCAAATAAAGATATTCTGAATACTATACTGGATAACAACACCAA
AGATCAAGCAAAATCCGACAATCAACGATTGGTTTCAGATTTATGGCAAA
CAATAAACATACGAAAAAAAGTCAATGCAAATGAAGAAGGAATAGATAGA
CTCTCGTCAATGGTGGATTCAATTCTAAATGAAATGAAGCAGTTGAAGTC
TGAAAATGAAACCATGAAAAAACAACTGGAAGATCTATCCGGATTAAAAG
GCATGGGTGACAAAGTTGACGGACTTCAAAACGAAATTGCCGATTTATTA
GATCAATTTAATAAATTAAAAGATATTTTGGCTGAATATCCGCCTCCGGA
TGCTTTTAAAAACATTGTTACTTGGGATGGTTTGGAAAAGGCATTGAAAG
GCATCAAAGACGACATGGATGATTTAAGAAAACCCACTGAAAGAGTTGTA
GTCAATATGGCTACTGAAGATGAAATAAAACAAGACAAAGAACTTTTGAA
AAAGTATGAAGCCTATTTAGAATGGATAGATGGTGGTTGTAATTTGAAAT
TGACTTTACCAGTCGAACATGTCATTTTGGAAGTAAATCGCTTAGTAGAG
TTAGGGCAAATCACTCCTAATGTTGCTAAAGACGAAGATGAAATTATGTT
TAACTTGAAAATACCGTTGAAGGATGCTCAAAGTGATTTCAAATCAGATA
AACTTAAAACAATTATATGGAAACTTATTCCAAAAACCGAAGACACTAAA
GATCGAATAACTTATGCTGACGAGCTGGAATTAAATGTTCCACTAACTAA
ATGGCAGCTTTTACAAGCTGGAGTGATAAATGTTCCAAATCAAGAAATTC
TGGAAGGAATTGACCACTTTGTCATAGATATACCGATAAGAAATGAACAA
ATTTGTAAATCCAATTATATTGTTCCTGAACCAGTTGAAACTGCACCCCT
TCCTCCAGAACCGGTATCCACCCCTTCAACGATATCCCCTCCAAAACCGG
TATTTACCCCTTCAGCGGTATTCCCTCTGAAACCGGCCCCAGCACCATCT
ACTAGTAGTGACAAAAAATCTTCATCATTACCAATGAGTAGACCGGCGAG
TCAAATTAGCTCCCCTGGTCCGAGTGAAGTATGCGCCGAAATGTTGGAGA
AGCTTGGCATTTTAACAACGGCTCATGATTTATTAGACAAAAGAGTTGTG
GTATTAGAGGAAGAAATGCCTAATAAAGCCGATAAAAAGGATTTAGAAAA
TTTAAAAATTCCAGATGATTTATTGAAAACTATTGCATTATTAAAGGCTC
AAATGGATTCATTAATGGCTTCGAAAAATCGGGATGGCGAAGCCTTGGCT
AGAATCAGAGATATTCTAAATGCTCTCCAGGATAAAATGAATGCCGTCAA
TGATACTCTTGATAAACTAAACGGAGAACATAAAGACCTGTTAAATCAAC
TCGAAGAACTATTCGGCATAACTAAAGATCACGAAACCAGAAAAGCTGAT
TTAGGCTACATTGAAGGTTTATTAAGAACGAAAGCAGATAAAAGTTTGCT
GGATACTAAAGTTAACTTCAGTTTATTTGATGAAACAGCCGGCAATTTGC
ATAGCTTAATTGATGATGTTTTGAAAAAACTCCTTGCTGCGGAAGAAGAA
TTAAGAAATCTTTTGCGATCTCTAGCATCTGATGTTAATGGAAAGGTTGA
CAAAGATGATTTGAATGCTCTCAAAGAATGGATAGAAAAACGGCTGCGTG
CATTAGCTGAAAAACTTAAACATTTACGAGGTGGTGATGTGACTGAAGAT
GATGCCGCAGGACTAAGAAAACAGTTATTGCAGCATTTCCATTGTATTTC
TTGCGATCGACCTCTCGATATAATGACTCATGGAATTAATTATGGCAATG
GACTACCTGAACCAAAGGGATTGCCACCATCGAAATCCTTAAGACCATAC
ACTACATTTGAATTGGATGCTATTCGACAACACTCTAAAAACAATAAAAA
TATGTATATTCATAACCACACAAAACGTTTTCAGGACGTCCGAGTCATCA
ATCCAAAATATGTAAGTTATGGAGCAGATATTGTTGATGTATATCAAACT
CCACGACCATGTGGAGGTAGTCATACAACTTCTTATCCTCAAAAGAAAAT
GGTACGTTTAGGAAATATGAATAATTCCTTTATCGATGAAGAGTTACATA
CTAGAACATTGAAAGAAGAAGCTGATTTAACAGGGGCAGATGGTCACATT
TACAAAGGTAGAATAGATCGCAGTCAAACAACAATGATAAATAATAACAA
TTATATTGAACAACCAAGCAATGATAAACTACCTCCTGTCACAGCATCAC
AACGAAGTCAAACAATAGTCAATAATAATTTCACCCCTAGGGGAGCATTT
GTAACGTCTCGTCCAAAATCTGCAGTGAAAATAACTCCAAGACATTCTTC
TAGTGCTGGTCCGACGCGTCCATCATCTGCAAGAGTTATCTTGCAAGAAC
CAGATTCAAGACCAACCTCTCCAGTTCCACAAGTCAATGAAAATAGTATC
CAAGAATCATCAGACGAATTAATGCAAGTCACAAACAATTTCAATCAGAT
GTCAAATAACGAAACAATCATCACATCAGAGAGTTTCAATCTGGAAATCC
TAAATCAGTCCGAAAACGAACCCAAGTCAGCGGTAGATGAGGCAGTCGCA
TTGTAATATGTATAGAACGTTCAAGTATTACCAATATCAAAATCAGAAAT
TTGACAACTCTAATCGACTGATCTTAGAATCCTATTATTATATTATTATT
ATATTTTTCTTATATTTTTATTAAATGATTTTTAATTGCACGATGACTGA
TAAAAACAAAAATCATGGATGATGATTCTCTTTCATGATGTTACGGAGAA
AATATTTAAATAAAG
back to top

protein sequence of SMED30020666-orf-1

>SMED30020666-orf-1 ID=SMED30020666-orf-1|Name=SMED30020666-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1001bp
MEVLNPINEIKLISMRSMVDLALGAPEVGAVNFNVLHSLLHAILAKLEMG
DNPVDIAVEENKTPASKSKLPVIPVSTIPYHGLQDRIKILENQISDLNSL
PSNKDILNTILDNNTKDQAKSDNQRLVSDLWQTINIRKKVNANEEGIDRL
SSMVDSILNEMKQLKSENETMKKQLEDLSGLKGMGDKVDGLQNEIADLLD
QFNKLKDILAEYPPPDAFKNIVTWDGLEKALKGIKDDMDDLRKPTERVVV
NMATEDEIKQDKELLKKYEAYLEWIDGGCNLKLTLPVEHVILEVNRLVEL
GQITPNVAKDEDEIMFNLKIPLKDAQSDFKSDKLKTIIWKLIPKTEDTKD
RITYADELELNVPLTKWQLLQAGVINVPNQEILEGIDHFVIDIPIRNEQI
CKSNYIVPEPVETAPLPPEPVSTPSTISPPKPVFTPSAVFPLKPAPAPST
SSDKKSSSLPMSRPASQISSPGPSEVCAEMLEKLGILTTAHDLLDKRVVV
LEEEMPNKADKKDLENLKIPDDLLKTIALLKAQMDSLMASKNRDGEALAR
IRDILNALQDKMNAVNDTLDKLNGEHKDLLNQLEELFGITKDHETRKADL
GYIEGLLRTKADKSLLDTKVNFSLFDETAGNLHSLIDDVLKKLLAAEEEL
RNLLRSLASDVNGKVDKDDLNALKEWIEKRLRALAEKLKHLRGGDVTEDD
AAGLRKQLLQHFHCISCDRPLDIMTHGINYGNGLPEPKGLPPSKSLRPYT
TFELDAIRQHSKNNKNMYIHNHTKRFQDVRVINPKYVSYGADIVDVYQTP
RPCGGSHTTSYPQKKMVRLGNMNNSFIDEELHTRTLKEEADLTGADGHIY
KGRIDRSQTTMINNNNYIEQPSNDKLPPVTASQRSQTIVNNNFTPRGAFV
TSRPKSAVKITPRHSSSAGPTRPSSARVILQEPDSRPTSPVPQVNENSIQ
ESSDELMQVTNNFNQMSNNETIITSESFNLEILNQSENEPKSAVDEAVAL
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR032013DUF4795