Potassium voltage-gated channel subfamily A member 2

Overview
NamePotassium voltage-gated channel subfamily A member 2
Smed IDSMED30020664
Length (bp)1892
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Potassium voltage-gated channel subfamily A member 2 (SMED30020664) t-SNE clustered cells

Violin plots show distribution of expression levels for Potassium voltage-gated channel subfamily A member 2 (SMED30020664) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Potassium voltage-gated channel subfamily A member 2 (SMED30020664) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Potassium voltage-gated channel subfamily A member 2 (SMED30020664) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020664

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30020664SMESG000006565.1 SmedASXL_014902SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30020664SMESG000028841.1 SmedASXL_018373SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30020664SMESG000028841.1 dd_Smed_v4_7533_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30020664SMESG000028841.1 dd_Smed_v4_7533_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30020664SMESG000028841.1 dd_Smed_v4_7533_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30020664SMESG000028841.1 dd_Smed_v6_7533_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30020664SMESG000028841.1 OX_Smed_1.0.00985ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30020664SMESG000028841.1 dd_Smed_v4_7533_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30020664SMESG000028841.1 dd_Smed_v4_7533_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30020664SMESG000028841.1 dd_Smed_v4_7533_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Human
Match: KCNA2 (potassium voltage-gated channel subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:6220])

HSP 1 Score: 336.65 bits (862), Expect = 3.218e-108
Identity = 162/385 (42.08%), Postives = 249/385 (64.68%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIP-----------------KYSKMCID-NKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXX-----FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV IN+SGL FET +  L + P TLLG P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +++RP NVP D+F  E+ +++L    +  F  D+GY+ E+ + LP N   +++W+LFEYPE+SG A  + IVS+++ ++SI +FC+ET+P                  YS   I   ++ +F   FFI ET+C IWF+ E + R  +CP+   +  +  N++DIVA+IPY+ITL   L ++   D ++G  ++++  +  +  +     FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E D ++S   SIPDAFWW V++M TVGYGDMVP ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   33 ERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGSGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTEL-AEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 416          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Human
Match: KCNA2 (potassium voltage-gated channel subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:6220])

HSP 1 Score: 336.65 bits (862), Expect = 3.218e-108
Identity = 162/385 (42.08%), Postives = 249/385 (64.68%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIP-----------------KYSKMCID-NKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXX-----FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV IN+SGL FET +  L + P TLLG P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +++RP NVP D+F  E+ +++L    +  F  D+GY+ E+ + LP N   +++W+LFEYPE+SG A  + IVS+++ ++SI +FC+ET+P                  YS   I   ++ +F   FFI ET+C IWF+ E + R  +CP+   +  +  N++DIVA+IPY+ITL   L ++   D ++G  ++++  +  +  +     FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E D ++S   SIPDAFWW V++M TVGYGDMVP ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   33 ERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGSGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTEL-AEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 416          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Human
Match: KCNA2 (potassium voltage-gated channel subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:6220])

HSP 1 Score: 336.65 bits (862), Expect = 3.218e-108
Identity = 162/385 (42.08%), Postives = 249/385 (64.68%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIP-----------------KYSKMCID-NKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXX-----FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV IN+SGL FET +  L + P TLLG P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +++RP NVP D+F  E+ +++L    +  F  D+GY+ E+ + LP N   +++W+LFEYPE+SG A  + IVS+++ ++SI +FC+ET+P                  YS   I   ++ +F   FFI ET+C IWF+ E + R  +CP+   +  +  N++DIVA+IPY+ITL   L ++   D ++G  ++++  +  +  +     FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E D ++S   SIPDAFWW V++M TVGYGDMVP ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   33 ERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGSGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTEL-AEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 416          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Human
Match: KCNA2 (potassium voltage-gated channel subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:6220])

HSP 1 Score: 336.65 bits (862), Expect = 3.218e-108
Identity = 162/385 (42.08%), Postives = 249/385 (64.68%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIP-----------------KYSKMCID-NKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXX-----FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV IN+SGL FET +  L + P TLLG P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +++RP NVP D+F  E+ +++L    +  F  D+GY+ E+ + LP N   +++W+LFEYPE+SG A  + IVS+++ ++SI +FC+ET+P                  YS   I   ++ +F   FFI ET+C IWF+ E + R  +CP+   +  +  N++DIVA+IPY+ITL   L ++   D ++G  ++++  +  +  +     FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E D ++S   SIPDAFWW V++M TVGYGDMVP ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   33 ERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGSGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTEL-AEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 416          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Human
Match: KCNA2 (potassium voltage-gated channel subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:6220])

HSP 1 Score: 336.65 bits (862), Expect = 3.218e-108
Identity = 162/385 (42.08%), Postives = 249/385 (64.68%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIP-----------------KYSKMCID-NKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXX-----FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV IN+SGL FET +  L + P TLLG P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +++RP NVP D+F  E+ +++L    +  F  D+GY+ E+ + LP N   +++W+LFEYPE+SG A  + IVS+++ ++SI +FC+ET+P                  YS   I   ++ +F   FFI ET+C IWF+ E + R  +CP+   +  +  N++DIVA+IPY+ITL   L ++   D ++G  ++++  +  +  +     FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E D ++S   SIPDAFWW V++M TVGYGDMVP ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   33 ERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGSGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTEL-AEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 416          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Celegans
Match: shk-1 (Potassium voltage-gated channel protein shk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4B0])

HSP 1 Score: 270.396 bits (690), Expect = 6.843e-84
Identity = 148/387 (38.24%), Postives = 226/387 (58.40%), Query Frame = 1
Query:  469 SVAEGH--SKSRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEK-IKLPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPK----------YSKMCIDNKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXXF-----KLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
            S  +GH  +   V INVSG+ F+T+ S L R+P +LLG    R+  F S  NE+FFDRHR  FE I + Y+ G ++KRP  VP D+FL EM +F++  +++  F   +GY   K + +P+N   +KIW L EYP++S  A  +  +S+ +  +SI +FC ET+P            +   +D  +    S FF  E +C +WFTIE+I R +SCP    +     N++D VA+ P+++   N  F+D      K  SS++   +  L  +      KL++HS GLQ+L  TF++S+    + +  M ++++LF+S +Y+ E    +S   SIP +FW+ ++TM TVGYGD+VP S  G++VG  CA+ GVLTLA+ VPII  NF  F
Sbjct:   34 SSTQGHPYTDQIVTINVSGMRFQTFESTLSRYPNSLLGDRNKRQHFFVSDTNEFFFDRHRTTFESILYIYQSGGRVKRPEIVPIDIFLKEMRFFQMGDDLLEEFWIAEGYEKPKEVMMPNNKTQRKIWELMEYPDSSLSARIIAFISIAVIALSIISFCWETVPSDIEEKPINNSATAELLDEMDEKHYSPFFWIELMCILWFTIELILRFISCPCKVTFATSVLNIIDFVAIAPFFV---NFFFADTS----KSNSSMSFAVLRVLRLVRVFRVFKLSRHSVGLQILGKTFRSSVQEFCLLIFFMAIALVLFASGMYFAEQGEPNSKFTSIPASFWFVLVTMTTVGYGDLVPLSPFGKVVGGMCAMIGVLTLALPVPIIVANFKHF 413          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Celegans
Match: shk-1 (Potassium voltage-gated channel protein shk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4B0])

HSP 1 Score: 270.396 bits (690), Expect = 6.843e-84
Identity = 148/387 (38.24%), Postives = 226/387 (58.40%), Query Frame = 1
Query:  469 SVAEGH--SKSRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEK-IKLPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPK----------YSKMCIDNKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXXF-----KLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
            S  +GH  +   V INVSG+ F+T+ S L R+P +LLG    R+  F S  NE+FFDRHR  FE I + Y+ G ++KRP  VP D+FL EM +F++  +++  F   +GY   K + +P+N   +KIW L EYP++S  A  +  +S+ +  +SI +FC ET+P            +   +D  +    S FF  E +C +WFTIE+I R +SCP    +     N++D VA+ P+++   N  F+D      K  SS++   +  L  +      KL++HS GLQ+L  TF++S+    + +  M ++++LF+S +Y+ E    +S   SIP +FW+ ++TM TVGYGD+VP S  G++VG  CA+ GVLTLA+ VPII  NF  F
Sbjct:   34 SSTQGHPYTDQIVTINVSGMRFQTFESTLSRYPNSLLGDRNKRQHFFVSDTNEFFFDRHRTTFESILYIYQSGGRVKRPEIVPIDIFLKEMRFFQMGDDLLEEFWIAEGYEKPKEVMMPNNKTQRKIWELMEYPDSSLSARIIAFISIAVIALSIISFCWETVPSDIEEKPINNSATAELLDEMDEKHYSPFFWIELMCILWFTIELILRFISCPCKVTFATSVLNIIDFVAIAPFFV---NFFFADTS----KSNSSMSFAVLRVLRLVRVFRVFKLSRHSVGLQILGKTFRSSVQEFCLLIFFMAIALVLFASGMYFAEQGEPNSKFTSIPASFWFVLVTMTTVGYGDLVPLSPFGKVVGGMCAMIGVLTLALPVPIIVANFKHF 413          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Celegans
Match: shk-1 (Potassium voltage-gated channel protein shk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4B0])

HSP 1 Score: 270.396 bits (690), Expect = 1.012e-83
Identity = 148/387 (38.24%), Postives = 226/387 (58.40%), Query Frame = 1
Query:  469 SVAEGH--SKSRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEK-IKLPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPK----------YSKMCIDNKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXXF-----KLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
            S  +GH  +   V INVSG+ F+T+ S L R+P +LLG    R+  F S  NE+FFDRHR  FE I + Y+ G ++KRP  VP D+FL EM +F++  +++  F   +GY   K + +P+N   +KIW L EYP++S  A  +  +S+ +  +SI +FC ET+P            +   +D  +    S FF  E +C +WFTIE+I R +SCP    +     N++D VA+ P+++   N  F+D      K  SS++   +  L  +      KL++HS GLQ+L  TF++S+    + +  M ++++LF+S +Y+ E    +S   SIP +FW+ ++TM TVGYGD+VP S  G++VG  CA+ GVLTLA+ VPII  NF  F
Sbjct:   47 SSTQGHPYTDQIVTINVSGMRFQTFESTLSRYPNSLLGDRNKRQHFFVSDTNEFFFDRHRTTFESILYIYQSGGRVKRPEIVPIDIFLKEMRFFQMGDDLLEEFWIAEGYEKPKEVMMPNNKTQRKIWELMEYPDSSLSARIIAFISIAVIALSIISFCWETVPSDIEEKPINNSATAELLDEMDEKHYSPFFWIELMCILWFTIELILRFISCPCKVTFATSVLNIIDFVAIAPFFV---NFFFADTS----KSNSSMSFAVLRVLRLVRVFRVFKLSRHSVGLQILGKTFRSSVQEFCLLIFFMAIALVLFASGMYFAEQGEPNSKFTSIPASFWFVLVTMTTVGYGDLVPLSPFGKVVGGMCAMIGVLTLALPVPIIVANFKHF 426          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Celegans
Match: shk-1 (Potassium voltage-gated channel protein shk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4B0])

HSP 1 Score: 270.011 bits (689), Expect = 3.194e-83
Identity = 148/387 (38.24%), Postives = 226/387 (58.40%), Query Frame = 1
Query:  469 SVAEGH--SKSRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEK-IKLPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPK----------YSKMCIDNKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXXF-----KLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
            S  +GH  +   V INVSG+ F+T+ S L R+P +LLG    R+  F S  NE+FFDRHR  FE I + Y+ G ++KRP  VP D+FL EM +F++  +++  F   +GY   K + +P+N   +KIW L EYP++S  A  +  +S+ +  +SI +FC ET+P            +   +D  +    S FF  E +C +WFTIE+I R +SCP    +     N++D VA+ P+++   N  F+D      K  SS++   +  L  +      KL++HS GLQ+L  TF++S+    + +  M ++++LF+S +Y+ E    +S   SIP +FW+ ++TM TVGYGD+VP S  G++VG  CA+ GVLTLA+ VPII  NF  F
Sbjct:   80 SSTQGHPYTDQIVTINVSGMRFQTFESTLSRYPNSLLGDRNKRQHFFVSDTNEFFFDRHRTTFESILYIYQSGGRVKRPEIVPIDIFLKEMRFFQMGDDLLEEFWIAEGYEKPKEVMMPNNKTQRKIWELMEYPDSSLSARIIAFISIAVIALSIISFCWETVPSDIEEKPINNSATAELLDEMDEKHYSPFFWIELMCILWFTIELILRFISCPCKVTFATSVLNIIDFVAIAPFFV---NFFFADTS----KSNSSMSFAVLRVLRLVRVFRVFKLSRHSVGLQILGKTFRSSVQEFCLLIFFMAIALVLFASGMYFAEQGEPNSKFTSIPASFWFVLVTMTTVGYGDLVPLSPFGKVVGGMCAMIGVLTLALPVPIIVANFKHF 459          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Celegans
Match: shk-1 (Potassium voltage-gated channel protein shk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4B0])

HSP 1 Score: 270.011 bits (689), Expect = 1.048e-82
Identity = 150/383 (39.16%), Postives = 230/383 (60.05%), Query Frame = 1
Query:  469 SVAEGH--SKSRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEK-IKLPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPK----------YSKMCIDNKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGG-SSXXXXXXXXXXXXFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
            S  +GH  +   V INVSG+ F+T+ S L R+P +LLG    R+  F S  NE+FFDRHR  FE I + Y+ G ++KRP  VP D+FL EM +F++  +++  F   +GY   K + +P+N   +KIW L EYP++S  A  +  +S+ +  +SI +FC ET+P            +   +D  +    S FF  E +C +WFTIE+I R +SCP    +     N++D VA+ P+++   N  F+D          + L +LR++R+ R+FKL++HS GLQ+L  TF++S+    + +  M ++++LF+S +Y+ E    +S   SIP +FW+ ++TM TVGYGD+VP S  G++VG  CA+ GVLTLA+ VPII  NF  F
Sbjct:  123 SSTQGHPYTDQIVTINVSGMRFQTFESTLSRYPNSLLGDRNKRQHFFVSDTNEFFFDRHRTTFESILYIYQSGGRVKRPEIVPIDIFLKEMRFFQMGDDLLEEFWIAEGYEKPKEVMMPNNKTQRKIWELMEYPDSSLSARIIAFISIAVIALSIISFCWETVPSDIEEKPINNSATAELLDEMDEKHYSPFFWIELMCILWFTIELILRFISCPCKVTFATSVLNIIDFVAIAPFFV---NFFFADTSKSNSSMSFAVLRVLRLVRVFRVFKLSRHSVGLQILGKTFRSSVQEFCLLIFFMAIALVLFASGMYFAEQGEPNSKFTSIPASFWFVLVTMTTVGYGDLVPLSPFGKVVGGMCAMIGVLTLALPVPIIVANFKHF 502          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Fly
Match: Sh (gene:FBgn0003380 transcript:FBtr0089660)

HSP 1 Score: 330.872 bits (847), Expect = 2.650e-105
Identity = 163/388 (42.01%), Postives = 241/388 (62.11%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKMCIDNKNYN-----------FLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLF-SDNCIDGKKGGSSXXXXXXXXXXXX--------------FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV INVSGL FET +  L++ P TLLG P  R ++FD  RNEYFFDR R +F+ I +YY+ G +++RP NVP DVF  E+++++L    IN F  D+G++ E+ + LP N   +K+W+LFEYPE+S  A  V I+S+ + ++SI  FC+ET+P++    + N   N               FF+ ET+C IWFT E+  R ++CPN   + +D  NV+DI+A+IPY+ITLA ++   ++ ++  K   S       + + +              FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E   ++S   SIPDAFWW V+TM TVGYGDM P    G+IVGS C ++GVLT+A+ VP+I  NFN F
Sbjct:   52 ERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDRSRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKVFNTTTNGTKIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLPKAPVSPQDKSSNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGFWGKIVGSLCVIAGVLTIALPVPVIVSNFNYF 439          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Fly
Match: Sh (gene:FBgn0003380 transcript:FBtr0089657)

HSP 1 Score: 333.183 bits (853), Expect = 3.174e-105
Identity = 164/388 (42.27%), Postives = 243/388 (62.63%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKMCIDNKNYN-----------FLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLF-SDNCIDGKKGGSSXXXXXXXXXXXX--------------FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV INVSGL FET +  L++ P TLLG P  R ++FD  RNEYFFDR R +F+ I +YY+ G +++RP NVP DVF  E+++++L    IN F  D+G++ E+ + LP N   +K+W+LFEYPE+S  A  V I+S+ + ++SI  FC+ET+P++    + N   N               FF+ ET+C IWFT E+  R ++CPN   + +D  NV+DI+A+IPY+ITLA ++   ++ ++  K   S       + + +              FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E   ++S   SIPDAFWW V+TM TVGYGDM P  + G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   97 ERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDRSRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKVFNTTTNGTKIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLPKAPVSPQDKSSNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 484          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Fly
Match: Sh (gene:FBgn0003380 transcript:FBtr0302903)

HSP 1 Score: 332.413 bits (851), Expect = 3.742e-105
Identity = 164/388 (42.27%), Postives = 243/388 (62.63%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKMCIDNKNYN-----------FLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLF-SDNCIDGKKGGSSXXXXXXXXXXXX--------------FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV INVSGL FET +  L++ P TLLG P  R ++FD  RNEYFFDR R +F+ I +YY+ G +++RP NVP DVF  E+++++L    IN F  D+G++ E+ + LP N   +K+W+LFEYPE+S  A  V I+S+ + ++SI  FC+ET+P++    + N   N               FF+ ET+C IWFT E+  R ++CPN   + +D  NV+DI+A+IPY+ITLA ++   ++ ++  K   S       + + +              FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E   ++S   SIPDAFWW V+TM TVGYGDM P  + G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   85 ERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDRSRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKVFNTTTNGTKIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLPKAPVSPQDKSSNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 472          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Fly
Match: Sh (gene:FBgn0003380 transcript:FBtr0089661)

HSP 1 Score: 332.413 bits (851), Expect = 3.742e-105
Identity = 164/388 (42.27%), Postives = 243/388 (62.63%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKMCIDNKNYN-----------FLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLF-SDNCIDGKKGGSSXXXXXXXXXXXX--------------FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV INVSGL FET +  L++ P TLLG P  R ++FD  RNEYFFDR R +F+ I +YY+ G +++RP NVP DVF  E+++++L    IN F  D+G++ E+ + LP N   +K+W+LFEYPE+S  A  V I+S+ + ++SI  FC+ET+P++    + N   N               FF+ ET+C IWFT E+  R ++CPN   + +D  NV+DI+A+IPY+ITLA ++   ++ ++  K   S       + + +              FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E   ++S   SIPDAFWW V+TM TVGYGDM P  + G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   85 ERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDRSRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKVFNTTTNGTKIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLPKAPVSPQDKSSNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 472          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Fly
Match: Sh (gene:FBgn0003380 transcript:FBtr0302902)

HSP 1 Score: 332.413 bits (851), Expect = 3.742e-105
Identity = 164/388 (42.27%), Postives = 243/388 (62.63%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKMCIDNKNYN-----------FLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLF-SDNCIDGKKGGSSXXXXXXXXXXXX--------------FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV INVSGL FET +  L++ P TLLG P  R ++FD  RNEYFFDR R +F+ I +YY+ G +++RP NVP DVF  E+++++L    IN F  D+G++ E+ + LP N   +K+W+LFEYPE+S  A  V I+S+ + ++SI  FC+ET+P++    + N   N               FF+ ET+C IWFT E+  R ++CPN   + +D  NV+DI+A+IPY+ITLA ++   ++ ++  K   S       + + +              FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E   ++S   SIPDAFWW V+TM TVGYGDM P  + G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   85 ERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDRSRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKVFNTTTNGTKIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLPKAPVSPQDKSSNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 472          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Zebrafish
Match: kcna2b (potassium voltage-gated channel, shaker-related subfamily, member 2b [Source:ZFIN;Acc:ZDB-GENE-080204-89])

HSP 1 Score: 338.576 bits (867), Expect = 3.641e-109
Identity = 163/381 (42.78%), Postives = 247/381 (64.83%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIKL-PSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKMCID-NKNYN-------------FLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXX-----FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV IN+SGL FET +  L + P TLLG P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +++RP NV  D+F  E+ +++L    I  F  D+G++ E+ KL P N   +++W+LFEYPE+SG A  + I+S+++ ++SI +FC+ET+P +     D +K Y              F   FFI ET+C IWF+ E + R  +CP+   +  +  N++DIVA+IPY+ITL   L ++   DG++G  ++++  +  +  +     FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E D  DS   SIPDAFWW V++M TVGYGDMVP ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   33 ERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVTLDIFSEEIRFYELGEEAIEMFREDEGFIKEEEKLLPENEFQRQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPVFRNEETDMHKAYRTDSNSTISYTSTYFTDPFFILETLCIIWFSFEFLVRFFACPSKAGFFVNIMNIIDIVAIIPYFITLGTEL-AEKAEDGQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEPDSQFVSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 412          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Zebrafish
Match: kcna1a (potassium voltage-gated channel, shaker-related subfamily, member 1a [Source:ZFIN;Acc:ZDB-GENE-110408-15])

HSP 1 Score: 335.88 bits (860), Expect = 4.214e-108
Identity = 165/380 (43.42%), Postives = 247/380 (65.00%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSK------MCIDNKNYNF-----LSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXX-------FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV IN++GL FET +  L + P TLLG+P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +++RPANVP D+F  E+++++L    +  F  D+G++ E+ + LP     ++IW+LFE+PE+SG A  + IVS+++ ++SI  FC+ET+P+  +        I N  Y +        FFI ET+C IWF+ E+I R  +CP+   + K+  N +DIVA+IPY+ITL   L  +   DGK+G    A    I  +         FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E + K+S  +SIPDAFWW V++M TVGYGDMVP ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   34 ERVVINIAGLRFETQLKTLAQFPETLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPANVPLDMFSEEIKFYELGVEAMEKFREDEGFIREEERPLPEKEFQRQIWLLFEHPESSGPARGIAIVSVMVILISIVIFCLETLPELKEDPEGRIKIIGNTTYYYKPSILADPFFIIETLCIIWFSFELIVRFFACPSKAAFFKNMMNTIDIVAIIPYFITLGTELAEEQ--DGKEGKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEKESYFSSIPDAFWWAVVSMTTVGYGDMVPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 411          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Zebrafish
Match: kcna1a (potassium voltage-gated channel, shaker-related subfamily, member 1a [Source:ZFIN;Acc:ZDB-GENE-110408-15])

HSP 1 Score: 335.88 bits (860), Expect = 4.214e-108
Identity = 165/380 (43.42%), Postives = 247/380 (65.00%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSK------MCIDNKNYNF-----LSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXX-------FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV IN++GL FET +  L + P TLLG+P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +++RPANVP D+F  E+++++L    +  F  D+G++ E+ + LP     ++IW+LFE+PE+SG A  + IVS+++ ++SI  FC+ET+P+  +        I N  Y +        FFI ET+C IWF+ E+I R  +CP+   + K+  N +DIVA+IPY+ITL   L  +   DGK+G    A    I  +         FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E + K+S  +SIPDAFWW V++M TVGYGDMVP ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   34 ERVVINIAGLRFETQLKTLAQFPETLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPANVPLDMFSEEIKFYELGVEAMEKFREDEGFIREEERPLPEKEFQRQIWLLFEHPESSGPARGIAIVSVMVILISIVIFCLETLPELKEDPEGRIKIIGNTTYYYKPSILADPFFIIETLCIIWFSFELIVRFFACPSKAAFFKNMMNTIDIVAIIPYFITLGTELAEEQ--DGKEGKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEKESYFSSIPDAFWWAVVSMTTVGYGDMVPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 411          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Zebrafish
Match: kcna2a (potassium voltage-gated channel, shaker-related subfamily, member 2a [Source:ZFIN;Acc:ZDB-GENE-131113-1])

HSP 1 Score: 329.717 bits (844), Expect = 8.978e-106
Identity = 159/381 (41.73%), Postives = 247/381 (64.83%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYS-------KMCIDNKNYNFL-------SGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXX-----FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV IN+SGL FET +  L + P TLLG P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +++RP NV  DVF  E+ +++L    I  F  D+G++ E+ + LP N   +++W+LFEYPE+SG A  + I+S+++ ++SI +FC+ET+P +        K+ ++  N             FFI ET+C IWF+ E + R  +CP+   +  +  N++D+VA+IPY+ITL   L ++   DG++G  ++++  +  +  +     FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E D  +S   SIPDAFWW V++M TVGYGDMVP ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   32 ERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVTLDVFSEEIRFYELGDEAIEIFREDEGFIKEEERPLPDNEFQKQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPIFRSDEEEMHKVPVNVNNSTTSYTSTYFTDPFFILETLCIIWFSFEFLVRFFACPSKASFFVNIMNMIDVVAIIPYFITLGTEL-AEKAEDGQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEPESQFYSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 411          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Zebrafish
Match: kcna2a (potassium voltage-gated channel, shaker-related subfamily, member 2a [Source:ZFIN;Acc:ZDB-GENE-131113-1])

HSP 1 Score: 329.717 bits (844), Expect = 8.978e-106
Identity = 159/381 (41.73%), Postives = 247/381 (64.83%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYS-------KMCIDNKNYNFL-------SGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXX-----FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV IN+SGL FET +  L + P TLLG P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +++RP NV  DVF  E+ +++L    I  F  D+G++ E+ + LP N   +++W+LFEYPE+SG A  + I+S+++ ++SI +FC+ET+P +        K+ ++  N             FFI ET+C IWF+ E + R  +CP+   +  +  N++D+VA+IPY+ITL   L ++   DG++G  ++++  +  +  +     FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E D  +S   SIPDAFWW V++M TVGYGDMVP ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   32 ERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVTLDVFSEEIRFYELGDEAIEIFREDEGFIKEEERPLPDNEFQKQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPIFRSDEEEMHKVPVNVNNSTTSYTSTYFTDPFFILETLCIIWFSFEFLVRFFACPSKASFFVNIMNMIDVVAIIPYFITLGTEL-AEKAEDGQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEPESQFYSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 411          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Xenopus
Match: KCNA2 (potassium channel, voltage gated shaker related subfamily A, member 3 [Source:NCBI gene;Acc:100496794])

HSP 1 Score: 338.576 bits (867), Expect = 6.654e-109
Identity = 161/385 (41.82%), Postives = 248/385 (64.42%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKMCID------------------NKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXX-----FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV IN+SGL FET +  L + P TLLG P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +++RP NVP D+F  E+ +++L    +  F  D+G++ E+ + LP N   +++W+LFEYPE+SG A  + I+S+++ ++SI +FC+ET+P +     D                   K+  F   FFI ET+C IWF+ E + R  +CP+   +  +  N++DIVA+IPY+ITL   L ++   DG++G  ++++  +  +  +     FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E D +DS   SIPDAFWW V++M TVGYGDMVP ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   33 ERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEIFREDEGFIKEEERPLPDNEYQKQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPVFRDENEDMHGSGVNYYPYSNSTVRYQKSNTFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTEL-AEKTEDGQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 416          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Xenopus
Match: KCNA5 (potassium channel, voltage gated shaker related subfamily A, member 5 [Source:NCBI gene;Acc:496997])

HSP 1 Score: 340.887 bits (873), Expect = 3.838e-108
Identity = 172/420 (40.95%), Postives = 258/420 (61.43%), Query Frame = 1
Query:  472 VAEGHSKSRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKY----------SKMCIDNKNY-----NFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXX--XFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF---------QSLLKLAVQQNVLTCCGSLMNGVVR 1650
            + +  S  RV IN++GL FET +S L++ P TLLG P  R + FD  RNEYFFDR+R +F+GI ++Y+ G KI+RP NV  DVF  E+ +++L    +  F  D+G++ ++ K LP N   +++W++FEYPE+S  A  + IVS+L+ ++SI  FC+ET+P++          SK+  D + +          FFI ET C IWFT E++ R  +CP+  ++ K+  N++DIVA+IPY+ITL   L      +G++  S   +  +  +    IFKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E D  +S  +SIPDAFWW V+TM TVGYGDM P ++ G+IVGS CA++GVLT+A+ VP+I  NFN F         Q +LK        +C G L     R
Sbjct:  162 IMDHESNQRVIINIAGLRFETQLSTLNQFPDTLLGDPEKRMRFFDPLRNEYFFDRNRPSFDGILYFYQSGGKIRRPVNVSIDVFADEIRFYELGEEAMERFREDEGFIKDEEKPLPCNEFQRQVWLIFEYPESSSSARGIAIVSVLVILISIITFCLETLPEFRDENELPPALSKVLNDTQEHPSPPSGLTDPFFIIETTCVIWFTFELLVRFFACPSKSDFSKNIMNIIDIVAIIPYFITLGTELAQHQTNNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPESHFSSIPDAFWWAVVTMTTVGYGDMRPVTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEQVMLKEESSSRQGSCAGDLKRSPSR 581          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Xenopus
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:HGNC Symbol;Acc:HGNC:6221])

HSP 1 Score: 333.183 bits (853), Expect = 3.939e-107
Identity = 164/381 (43.04%), Postives = 246/381 (64.57%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKMCIDNKNYN-----------------FLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXX--XFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV IN+SGL FET +  L + P TLLG P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +I+RP NVP D+F  E+ +++L    +  F  D+G++ E+ + LP N   +++W+LFEYPE+SG A  + IVS+L+ ++SI  FC+ET+P++     D+K Y+                 F   FF+ ET+C IWF+ E++ R  +CP+   + K+  N++DIVA+IPY+ITL   L ++   +G++  S   +  +  +    IFKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E D   S   SIPDAFWW V+TM TVGYGDM P ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   22 ERVVINISGLRFETQLKTLAQFPDTLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYELGEEAMEKFREDEGFIREEERPLPPNEFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFR----DDKEYSGTALPPGNGTGPYISSSFTDPFFVVETLCIIWFSFELLVRFFACPSKATFCKNIMNIIDIVAIIPYFITLGTEL-AERQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPSSGFNSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 397          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Xenopus
Match: KCNA1 (potassium channel, voltage gated shaker related subfamily A, member 1 [Source:NCBI gene;Acc:100492822])

HSP 1 Score: 333.569 bits (854), Expect = 4.290e-107
Identity = 167/375 (44.53%), Postives = 251/375 (66.93%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKMCIDNKNYN----------FLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXXF---KLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV INV+GL FET +  L + P TLLG+P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +++RP NVP D+F  E+++++L    +  F  D+G++ E+ + LP     +++W+LFEYPE+SG A  + IVS+++ ++SI  FC+ET+P+     I ++  N          F   FF+ ET+C IWF+ E++ R  +CP+  E+ K+  N +DIVA+IPY+ITL   +         +  +SLAILRVIRL+R+F   KL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E +  +S  ASIPDAFWW V++M TVGYGDM P ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   34 ERVVINVAGLRFETQLKTLSQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIREEERPLPEKEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVIFCLETLPELKDERIFSRRVNNSTVFYKSNIFTDPFFVVETLCIIWFSFELVVRFFACPSKPEFFKNIMNFIDIVAIIPYFITLGTEMAEQEGPQKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEDESHFASIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 408          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Xenopus
Match: ENSXETT00000049277.1 (potassium channel, voltage gated shaker related subfamily A, member 6 [Source:NCBI gene;Acc:100492986])

HSP 1 Score: 328.176 bits (840), Expect = 1.986e-105
Identity = 168/386 (43.52%), Postives = 249/386 (64.51%), Query Frame = 1
Query:  463 RYSVAEGHSKSRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKMCIDN------------KNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXX--XXFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
            R  +A      RV IN+SGL FET +  L + P TLLG P  R + FD  RNEYFFDR+R +F+ I +YY+ G +++RP NVP D+FL E+++++L   VI  F  D+G++ E+ + LP N   +++W+LFEYPE+SG A  + IVS+L+ ++SI  FC+ET+P++ +    +             N  F   FF+ ET+C IWF+ E++ R  +CP+   + K+  NV+DIVA+IPY+ITL   L      +G++  S   +  +  +   RIFKL++HS GLQ+L  T QAS+  LG+ +  + + ++LFSS +Y+ E D  +S   SIPDAFWW V++M TVGYGDM P ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:    4 RTDLATQDCCERVVINISGLRFETQLRTLSQFPQTLLGDPRKRMRFFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPVDIFLEEIKFYELGEEVIEIFRDDEGFIKEEERPLPENDFQRQVWLLFEYPESSGPARGIAIVSVLIILISIVIFCLETLPEFREEARQSGGQPAVNGTHTFTNSPFTDPFFLTETLCIIWFSFELLVRFFACPSKPAFFKNMMNVIDIVAIIPYFITLGTELAEQQGSNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAETDDPESLFTSIPDAFWWAVVSMTTVGYGDMYPMTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 389          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Mouse
Match: Kcna2 (potassium voltage-gated channel, shaker-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:96659])

HSP 1 Score: 338.191 bits (866), Expect = 6.658e-109
Identity = 163/385 (42.34%), Postives = 249/385 (64.68%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIP-----------------KYSKMCID-NKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXX-----FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV IN+SGL FET +  L + P TLLG P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +++RP NVP D+F  E+ +++L    +  F  D+GY+ E+ + LP N   +++W+LFEYPE+SG A  + IVS+++ ++SI +FC+ET+P                  YS   I   ++ +F   FFI ET+C IWF+ E + R  +CP+   +  +  N++DIVA+IPY+ITL   L ++   D ++G  ++++  +  +  +     FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E D +DS   SIPDAFWW V++M TVGYGDMVP ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   33 ERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTEL-AEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 416          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Mouse
Match: Kcna2 (potassium voltage-gated channel, shaker-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:96659])

HSP 1 Score: 338.191 bits (866), Expect = 6.658e-109
Identity = 163/385 (42.34%), Postives = 249/385 (64.68%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIP-----------------KYSKMCID-NKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXX-----FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV IN+SGL FET +  L + P TLLG P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +++RP NVP D+F  E+ +++L    +  F  D+GY+ E+ + LP N   +++W+LFEYPE+SG A  + IVS+++ ++SI +FC+ET+P                  YS   I   ++ +F   FFI ET+C IWF+ E + R  +CP+   +  +  N++DIVA+IPY+ITL   L ++   D ++G  ++++  +  +  +     FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E D +DS   SIPDAFWW V++M TVGYGDMVP ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   33 ERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTEL-AEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 416          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Mouse
Match: Kcna2 (potassium voltage-gated channel, shaker-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:96659])

HSP 1 Score: 338.191 bits (866), Expect = 6.658e-109
Identity = 163/385 (42.34%), Postives = 249/385 (64.68%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIP-----------------KYSKMCID-NKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXX-----FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV IN+SGL FET +  L + P TLLG P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +++RP NVP D+F  E+ +++L    +  F  D+GY+ E+ + LP N   +++W+LFEYPE+SG A  + IVS+++ ++SI +FC+ET+P                  YS   I   ++ +F   FFI ET+C IWF+ E + R  +CP+   +  +  N++DIVA+IPY+ITL   L ++   D ++G  ++++  +  +  +     FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E D +DS   SIPDAFWW V++M TVGYGDMVP ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   33 ERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTEL-AEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 416          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Mouse
Match: Kcna1 (potassium voltage-gated channel, shaker-related subfamily, member 1 [Source:MGI Symbol;Acc:MGI:96654])

HSP 1 Score: 327.791 bits (839), Expect = 5.695e-105
Identity = 161/385 (41.82%), Postives = 249/385 (64.68%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKMCIDNKNYN-----------------FLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXX------FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV IN+SGL FET +  L + P TLLG+P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +++RP NVP D+F  E+++++L    +  F  D+G++ E+ + LP     +++W+LFEYPE+SG A  + IVS+++ ++SI  FC+ET+P+      D+K++                  F   FFI ET+C IWF+ E++ R  +CP+  ++ K+  N +DIVA+IPY+ITL   +      +G + G     L ++R+IR+      FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E +  +S  +SIPDAFWW V++M TVGYGDM P ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   37 ERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILISIVIFCLETLPELK----DDKDFTGTIHRIDNTTVIYTSNIFTDPFFIVETLCIIWFSFELVVRFFACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQ---EGNQKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEAESHFSSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 414          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Mouse
Match: Kcna1 (potassium voltage-gated channel, shaker-related subfamily, member 1 [Source:MGI Symbol;Acc:MGI:96654])

HSP 1 Score: 327.791 bits (839), Expect = 5.695e-105
Identity = 161/385 (41.82%), Postives = 249/385 (64.68%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKMCIDNKNYN-----------------FLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXX------FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV IN+SGL FET +  L + P TLLG+P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +++RP NVP D+F  E+++++L    +  F  D+G++ E+ + LP     +++W+LFEYPE+SG A  + IVS+++ ++SI  FC+ET+P+      D+K++                  F   FFI ET+C IWF+ E++ R  +CP+  ++ K+  N +DIVA+IPY+ITL   +      +G + G     L ++R+IR+      FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E +  +S  +SIPDAFWW V++M TVGYGDM P ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   37 ERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILISIVIFCLETLPELK----DDKDFTGTIHRIDNTTVIYTSNIFTDPFFIVETLCIIWFSFELVVRFFACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQ---EGNQKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEAESHFSSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 414          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. UniProt/SwissProt
Match: sp|Q09081|KCNA2_RABIT (Potassium voltage-gated channel subfamily A member 2 OS=Oryctolagus cuniculus OX=9986 GN=KCNA2 PE=1 SV=2)

HSP 1 Score: 338.191 bits (866), Expect = 4.095e-108
Identity = 161/385 (41.82%), Postives = 248/385 (64.42%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKMCID------------------NKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXX-----FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV IN+SGL FET +  L + P TLLG P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +++RP NVP D+F  E+ +++L    +  F  D+GY+ E+ + LP N   +++W+LFEYPE+SG A  + IVS+++ ++SI +FC+ET+P +     D                   ++ +F   FFI ET+C IWF+ E + R  +CP+   +  +  N++DIVA+IPY+ITL   L ++   D ++G  ++++  +  +  +     FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E D +DS   SIPDAFWW V++M TVGYGDMVP ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   33 ERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGSGMTFHTYSNSTAGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTEL-AEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 416          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. UniProt/SwissProt
Match: sp|P63142|KCNA2_RAT (Potassium voltage-gated channel subfamily A member 2 OS=Rattus norvegicus OX=10116 GN=Kcna2 PE=1 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 4.657e-108
Identity = 163/385 (42.34%), Postives = 249/385 (64.68%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIP-----------------KYSKMCID-NKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXX-----FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV IN+SGL FET +  L + P TLLG P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +++RP NVP D+F  E+ +++L    +  F  D+GY+ E+ + LP N   +++W+LFEYPE+SG A  + IVS+++ ++SI +FC+ET+P                  YS   I   ++ +F   FFI ET+C IWF+ E + R  +CP+   +  +  N++DIVA+IPY+ITL   L ++   D ++G  ++++  +  +  +     FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E D +DS   SIPDAFWW V++M TVGYGDMVP ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   33 ERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTEL-AEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 416          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. UniProt/SwissProt
Match: sp|P63141|KCNA2_MOUSE (Potassium voltage-gated channel subfamily A member 2 OS=Mus musculus OX=10090 GN=Kcna2 PE=1 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 4.657e-108
Identity = 163/385 (42.34%), Postives = 249/385 (64.68%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIP-----------------KYSKMCID-NKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXX-----FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV IN+SGL FET +  L + P TLLG P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +++RP NVP D+F  E+ +++L    +  F  D+GY+ E+ + LP N   +++W+LFEYPE+SG A  + IVS+++ ++SI +FC+ET+P                  YS   I   ++ +F   FFI ET+C IWF+ E + R  +CP+   +  +  N++DIVA+IPY+ITL   L ++   D ++G  ++++  +  +  +     FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E D +DS   SIPDAFWW V++M TVGYGDMVP ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   33 ERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTEL-AEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 416          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. UniProt/SwissProt
Match: sp|P16389|KCNA2_HUMAN (Potassium voltage-gated channel subfamily A member 2 OS=Homo sapiens OX=9606 GN=KCNA2 PE=1 SV=2)

HSP 1 Score: 336.65 bits (862), Expect = 1.546e-107
Identity = 162/385 (42.08%), Postives = 249/385 (64.68%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIP-----------------KYSKMCID-NKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXX-----FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV IN+SGL FET +  L + P TLLG P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +++RP NVP D+F  E+ +++L    +  F  D+GY+ E+ + LP N   +++W+LFEYPE+SG A  + IVS+++ ++SI +FC+ET+P                  YS   I   ++ +F   FFI ET+C IWF+ E + R  +CP+   +  +  N++DIVA+IPY+ITL   L ++   D ++G  ++++  +  +  +     FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E D ++S   SIPDAFWW V++M TVGYGDMVP ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   33 ERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGSGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTEL-AEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 416          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. UniProt/SwissProt
Match: sp|P22739|KCNA2_XENLA (Potassium voltage-gated channel subfamily A member 2 OS=Xenopus laevis OX=8355 GN=kcna2 PE=1 SV=2)

HSP 1 Score: 334.339 bits (856), Expect = 1.170e-106
Identity = 159/385 (41.30%), Postives = 247/385 (64.16%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKMCID------------------NKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXX-----FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV IN+SGL FET +  L + P TLLG P  R ++FD  RNEYFFDR+R +F+ I ++Y+ G +++RP NVP D+F  E+ +++L    +  F  D+G++ E+ + LP N   +++W+LFEYPE+SG A  + I+S+ + ++SI +FC+ET+P +     D                   K+  F   FFI ET+C IWF+ E + R ++CP+   +  +  N++DIVA+IPY+ITL   L ++   DG++G  ++++  +  +  +     FKL++HS GLQ+L  T  AS+  LG+ +  + + ++LFSS +++ E D +DS   SIPDAFWW V++M TVGYGDMVP ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   33 ERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYFYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEIFREDEGFIKEEERPLPDNEFQKQVWLLFEYPESSGPARIIAIISVTVILISIVSFCLETLPVFRDENEDMHGSGGNYYSYPNSTVRFQKSNTFTDPFFIVETLCIIWFSFEFLVRFLACPSKAVFFTNLMNIIDIVAIIPYFITLGTEL-AEKTEDGQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLNASMRELGLLIFFLFIGVILFSSAVFFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 416          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. TrEMBL
Match: A0A267H803 (BTB domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000942g2 PE=3 SV=1)

HSP 1 Score: 431.795 bits (1109), Expect = 5.147e-142
Identity = 208/362 (57.46%), Postives = 282/362 (77.90%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIKLPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKY-SKMCIDNKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXXFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RVR+NVSG+ FET +  L++HP TLLG+P  R ++FD R +EYFFDRHR  FE IF+YY+YG K+KRP NV +D+FLSE+E++++E  VI+ +  D+GY+ E + LP +P+ +KIW+LFEYPETS  A+ V I+S+L T++SI  FC+ET+ ++    C+ ++  NFL  FFI E+ CT WFT+E++ R   CP+ K ++KD KN +D  A++PYY+TL N+L + +C +G K  +SLA LRV+RLIR+FKLTKH  GLQVL+LTF+AS+ GLG+FL+A++V +LLFSSTIYY+E +VK S I SIPDAFWW VITMCTVGYGD VPK  +G +VGS CA++GVLTLA+ VPII+ENFNKF
Sbjct:  132 ERVRLNVSGMHFETRLGVLNQHPRTLLGNPQKRAKYFDRRHHEYFFDRHRPTFEAIFNYYQYGGKLKRPPNVTDDIFLSELEFYEIEREVIDAYKKDEGYISETVVLPEHPVKRKIWMLFEYPETSTPAFLVAIISVLFTVISIILFCVETLKEFKDSHCVAHELPNFLDPFFIIESACTAWFTLELVIRFAVCPSKKAFIKDIKNAVDFSAIVPYYVTLTNVLITMSC-EGAKSSASLAFLRVVRLIRVFKLTKHFDGLQVLVLTFRASIEGLGLFLVALIVCILLFSSTIYYVEAEVKGSQIESIPDAFWWAVITMCTVGYGDKVPKGPLGMVVGSVCAIAGVLTLAIPVPIITENFNKF 492          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. TrEMBL
Match: A0A267DW52 (BTB domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000942g3 PE=3 SV=1)

HSP 1 Score: 431.409 bits (1108), Expect = 7.850e-142
Identity = 208/362 (57.46%), Postives = 282/362 (77.90%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIKLPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKY-SKMCIDNKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXXFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RVR+NVSG+ FET +  L++HP TLLG+P  R ++FD R +EYFFDRHR  FE IF+YY+YG K+KRP NV +D+FLSE+E++++E  VI+ +  D+GY+ E + LP +P+ +KIW+LFEYPETS  A+ V I+S+L T++SI  FC+ET+ ++    C+ ++  NFL  FFI E+ CT WFT+E++ R   CP+ K ++KD KN +D  A++PYY+TL N+L + +C +G K  +SLA LRV+RLIR+FKLTKH  GLQVL+LTF+AS+ GLG+FL+A++V +LLFSSTIYY+E +VK S I SIPDAFWW VITMCTVGYGD VPK  +G +VGS CA++GVLTLA+ VPII+ENFNKF
Sbjct:  132 ERVRLNVSGMHFETRLGVLNQHPRTLLGNPQKRAKYFDRRHHEYFFDRHRPTFEAIFNYYQYGGKLKRPPNVTDDIFLSELEFYEIEREVIDAYKKDEGYISETVVLPEHPVKRKIWMLFEYPETSTPAFLVAIISVLFTVISIILFCVETLKEFKDSHCVAHELPNFLDPFFIIESACTAWFTLELVIRFAVCPSKKAFIKDIKNAVDFSAIVPYYVTLTNVLITMSC-EGAKSSASLAFLRVVRLIRVFKLTKHFDGLQVLVLTFRASIEGLGLFLVALIVCILLFSSTIYYVEAEVKGSQIESIPDAFWWAVITMCTVGYGDKVPKGPLGMVVGSVCAIAGVLTLAIPVPIITENFNKF 492          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. TrEMBL
Match: A0A210PGX2 (Potassium voltage-gated channel subfamily A member 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT03312 PE=3 SV=1)

HSP 1 Score: 425.631 bits (1093), Expect = 2.827e-140
Identity = 209/361 (57.89%), Postives = 279/361 (77.29%), Query Frame = 1
Query:  496 RVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIKLPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKM-CIDNKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXXFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
            R  INVSG  +E W + ++RHPTTLLG+P  R ++FD RRNE+FFDRHR  FE IF+YY YG KI+RP  VP+D+FL E++++++E  V++ +  ++GY+ EK++LP +   +KIW+L EYPETS YAY V IVS+++T++SI  FC+ET+P  S   CID +  NF+  FFI ET+CTIWFT+E++ RL SCP+  +Y KD KN++DI A++PYYI+L+N+L    C D    G+SLA LRV+RL+RIFKLTKHS GLQVLILTF+AS+ GL +FL+AM+V +LLFSS IYY E  + D+ I SIPD FWW VITMCTVGYGD VP   +G+++GS CA++GVLTLA+ VPII+ENFNKF
Sbjct:   81 RFTINVSGQYYELWATLVNRHPTTLLGNPRKRLKYFDKRRNEFFFDRHRPTFESIFNYYMYGGKIRRPEPVPDDIFLRELDFYEIEKEVVDLYKDEEGYIQEKMELPDSKWKRKIWMLMEYPETSPYAYVVAIVSVVITLLSIVLFCVETLPSLSGSDCIDGRP-NFMEPFFIMETVCTIWFTLEVVIRLFSCPSKIKYFKDFKNIVDITAIVPYYISLSNLLAPAGC-DSASSGASLAFLRVVRLVRIFKLTKHSAGLQVLILTFKASIQGLMLFLVAMVVCVLLFSSAIYYAEHGIPDAQIKSIPDGFWWAVITMCTVGYGDKVPVGPLGKLIGSVCALAGVLTLAIPVPIITENFNKF 439          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. TrEMBL
Match: A0A2H1CQP4 (K+ channel tetramerization domain protein OS=Fasciola hepatica OX=6192 GN=D915_002281 PE=3 SV=1)

HSP 1 Score: 431.024 bits (1107), Expect = 8.358e-138
Identity = 219/413 (53.03%), Postives = 293/413 (70.94%), Query Frame = 1
Query:  352 MSNTFNFTHNYRYREFLSSTSSTPGEIAPFNDVNKFNRYSVAEGHSK----SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIKLPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKM-CIDNKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXXFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
            +   F    + +   FL S    P   +P    N+F   S     +      RV +NVSGL FETW++ L+ HPTTLLG    R   +D +R EYFFDRHR +FE IF+YY+YG +IKRPA V +D+FL E+E+F++E + +  +  ++GYV E I LP N + +K+W+LFEYPETS  A+   + S++ T++SI  FC+ET+P Y++  C      NF   FFI ETICTIWFT E+I R VSCP+ K+++KD KN++D+ A++PYYITL N+L + +C +G K  +SLA LRVIRLIR+FKLTKHS+GLQVL+LTF+ S+ GL +FL+A +V +L+FSS +YY+E+D K S I SIPDAFWW VITMCTVGYGD VPK  +G+IVGS CAV+GVLTLA+ VPII+ENFNKF
Sbjct:  372 LRRAFGLDGHMKNNPFLLSGQEVPESGSPVILANEFEPSSSNNSETVCQDCQRVILNVSGLKFETWLAVLNNHPTTLLGDADKRMPFYDEQRKEYFFDRHRPSFEAIFNYYQYGGRIKRPAVVADDIFLRELEFFQIEKDALESYKKNEGYVPEVIILPENRIKRKLWLLFEYPETSPLAFCFSVTSVIFTVISIILFCVETLPVYAQTHCEPGAKPNFRDPFFIIETICTIWFTFELIIRFVSCPSHKKFIKDLKNLIDLAAIVPYYITLTNVLITFSC-EGAKSSASLAFLRVIRLIRVFKLTKHSSGLQVLVLTFKESIEGLSLFLVAFIVCILVFSSVLYYVEIDRKGSQIESIPDAFWWAVITMCTVGYGDKVPKGPLGKIVGSVCAVAGVLTLAIPVPIITENFNKF 783          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. TrEMBL
Match: A0A5J4P1R6 (BTB domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0000340 PE=3 SV=1)

HSP 1 Score: 429.869 bits (1104), Expect = 2.739e-137
Identity = 214/361 (59.28%), Postives = 279/361 (77.29%), Query Frame = 1
Query:  496 RVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIKLPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKM-CIDNKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXXFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
            RV +NVSGL FETWI+ L+ HPTTLLG+   R+  +DS RNEYFFDRHR +FE IF+YY+YG ++KRPA V +DVFLSE+E+F++E + +  +   +GYV E I LP  P  +++W+LFEYPETS  A+   + S++ TI+SI  FC+ET+P Y+   C   +  NFL  FFI ET CTIWFT E+  R +SCP+ + ++KD KN++D+ A++PYYITL N+L S +C +G K  +SLA LRVIRLIR+FKLTKHS+GLQVL+LTF+ S+ GL +FL+A +V +L+FSSTIYY+E+D K S I SIPDAFWW VITMCTVGYGD VPK  +G+IVGS CAV+GVLTLA+ VPII+ENFNKF
Sbjct:  435 RVVLNVSGLRFETWIAVLNNHPTTLLGNSIKRRPFWDSYRNEYFFDRHRPSFEAIFNYYQYGGRLKRPAVVADDVFLSEVEFFEIEADAVESYKKGEGYVPEVIVLPEKPWKRRLWLLFEYPETSLLAFCFSVASVIFTIVSIILFCVETLPIYADTHCKLEEAPNFLDPFFIIETACTIWFTFELTIRFISCPSQRSFIKDIKNLIDLAAIVPYYITLINVLISYSC-EGAKNSASLAFLRVIRLIRVFKLTKHSSGLQVLVLTFKESVEGLSLFLVAFIVCILVFSSTIYYVEIDRKGSQIESIPDAFWWAVITMCTVGYGDKVPKGPLGKIVGSVCAVAGVLTLAIPVPIITENFNKF 794          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Cavefish
Match: kcna2b (potassium voltage-gated channel subfamily A member 2 [Source:NCBI gene;Acc:103039676])

HSP 1 Score: 337.421 bits (864), Expect = 8.836e-109
Identity = 164/381 (43.04%), Postives = 248/381 (65.09%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKMCID-NKNY-------------NFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXX-----FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV IN+SGL FET +  L + P TLLG P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +++RP NV  D+F  E+ +++L    I  F  D+G++ E+ K LP N   +++W+LFEYPE+SG A  + I+S+++ ++SI +FC+ET+P +    ID  K Y              F   FFI ET+C IWF+ E + R  +CP+   +  +  N++DIVA+IPY+ITL   L +++  DG++G  ++++  +  +  +     FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E D  DS   SIPDAFWW V++M TVGYGDMVP ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   32 ERVVINISGLRFETQLKTLSQFPDTLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVTLDIFSEEIRFYELGEEAIEIFREDEGFIKEEEKPLPENEFQRQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPIFRNDDIDMRKTYPGNSNSTTSYTSTYFTDPFFILETLCIIWFSFEFLVRFFACPSKAGFFVNIMNIIDIVAIIPYFITLGTEL-AESPEDGQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEADSQFVSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 411          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Cavefish
Match: kcna1a (potassium voltage-gated channel subfamily A member 1 [Source:NCBI gene;Acc:103039047])

HSP 1 Score: 334.339 bits (856), Expect = 1.060e-107
Identity = 163/378 (43.12%), Postives = 247/378 (65.34%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSK------MCIDNKNYNF-----LSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSD-NCIDGKKGGSSXXXXXXXXXXXX----FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV IN++GL FET +  L + P TLLG+P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +++RPA+VP D+F  E+++++L    +  F  D+G++ EK + LP     ++IW+LFE+PE+SG A  + IVS+ + ++SI  FC+ET+P+  +        I N  + +        FFI ET+C IWF+ E+I R ++CP+   + KD  N +D+VA+IPY+ITL   L  D N  DGK   ++   +  +  +      FKL++HS GLQ+L LT +AS+  LG+ +  + + ++LFSS +Y+ E +  DS   SIPDAFWW V++M TVGYGDMVP ++ G++VGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   34 ERVVINIAGLRFETELKTLAQFPETLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPASVPLDMFSEEIKFYELGYEAMEKFREDEGFIREKERPLPEAEFQRQIWLLFEHPESSGPARGIAIVSVTVILVSIVIFCLETLPQLKENPEGHIQIIGNSTFYYKPSLLTDPFFIVETLCIIWFSFELIVRFLACPSKAAFFKDMMNTIDVVAIIPYFITLGTELAEDPNNKDGKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGLTLKASMRELGLLVFFLFIGVILFSSAVYFAEAEEADSYFGSIPDAFWWAVVSMTTVGYGDMVPVTIGGKVVGSLCAIAGVLTIALPVPVIVSNFNYF 411          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Cavefish
Match: kcna2a (potassium voltage-gated channel subfamily A member 2 [Source:NCBI gene;Acc:103030675])

HSP 1 Score: 331.257 bits (848), Expect = 2.175e-106
Identity = 160/390 (41.03%), Postives = 248/390 (63.59%), Query Frame = 1
Query:  475 AEGHSKSRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKMCIDNKNYN-----------------FLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXX-----FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
            AE     RV IN+SGL FET +  L + P TLLG P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +++RP NV  D+F  E+ +++L    I  F  D+G++ E+ + LP N   +++W+LFEYPE+SG A  + I+S+++ ++SI +FC+ET+P +     D +  +                 F   FFI ET+C IWF+ E + R  +CP+   +  +  N++D+VA+IPY+ITL   L ++   DG++G  ++++  +  +  +     FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E D  +S   SIPDAFWW V++M TVGYGDMVP ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   26 AEQECCERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVTLDIFSEEIRFYELGEEAIEMFREDEGFIKEEERPLPDNEFQKQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPIFRS---DEEEMHKVRTYNSNSTTSYTSTYFTDPFFILETLCIIWFSFEFLVRFFACPSKASFFVNIMNMIDVVAIIPYFITLGTEL-AEKAEDGQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEPESQFYSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 411          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Cavefish
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:NCBI gene;Acc:103031324])

HSP 1 Score: 330.872 bits (847), Expect = 8.071e-106
Identity = 168/416 (40.38%), Postives = 257/416 (61.78%), Query Frame = 1
Query:  394 EFLSSTSSTPGEIAPFNDVNKFNRYSVAEGHSKSRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSK--------------MCIDNKNYNFLSG-----FFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXX--XXFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
            E L  + + P  ++         RY    G    RV IN+SGL FET +    + P TLLG P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +I+RP NVP DVF  E+ +++L    +  F  D+G++ E+ + LPS    +++W+LFEYPE+SG A  + IVS+L+ ++SI  FC+ET+P++                + ++N    +  G     FF+ ET+C +WF+ E++ R  +CP+   + K+  N++DIVA+IPY+ITL   L ++   +G++  S   +  +  +   RIFKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E D   S  +SIPDAFWW V+TM TVGYGDM P ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   43 ELLEESGALPAHVS-------LERYEPEPG-CHERVVINISGLRFETQLKTFSQFPDTLLGDPRKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDVFSEEIRFYQLGEEAMEKFREDEGFIKEEERPLPSREFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDDREAAAAAAAAAAAVPLNNGTAPYGPGAFTDPFFVIETLCIVWFSFELLVRFFACPSKATFSKNIMNIIDIVAIIPYFITLGTEL-AERQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPASSFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 449          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Cavefish
Match: ENSAMXT00000027012.2 (potassium voltage-gated channel subfamily A member 2-like [Source:NCBI gene;Acc:103027793])

HSP 1 Score: 320.472 bits (820), Expect = 1.016e-101
Identity = 164/414 (39.61%), Postives = 247/414 (59.66%), Query Frame = 1
Query:  451 NKFNRYSVAEGHSKSRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKY--------------SKMCIDNKNYNFLSG--------------------FFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXX----FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
            N  +RY   E     RV IN+SGL FET +  L + P TLLG P  R  +FD  RNEYFFDR+R +F+ I +YY+ G +++RP NVP DVF  E+ +++L    +  F  D+G++ E+ + LP+    +++W+LFEYPE+SG A  + IVS+L+ ++SI  FC+ET+P++              + + + N   N + G                    FF+ ET+C +WF+ E++ R  +CP+   + K+  N++DIVA+IPY+ITL   L      +G    +    +  +  +      FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E D  DS   SIPDAFWW V+TM TVGYGDM P ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   63 NAVDRYE-PEHECCERVVINISGLRFETQLKTLAQFPETLLGDPRKRTAYFDPLRNEYFFDRNRPSFDAILYYYQSGGRVRRPVNVPIDVFTEEIRFYELGEEAMEKFREDEGFIKEEERALPAGEFQRQVWLLFEYPESSGPARGIAIVSVLVILVSIVIFCLETLPEFRDDDSDVTRDRVGTTPLHMLNHYPNEMHGHGNLTGGLPPILSGTPFSDPFFVVETLCIVWFSFELLVRFFACPSKATFSKNIMNIIDIVAIIPYFITLGTELAERQQGNGGGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPDSGFNSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 475          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Sea Lamprey
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:HGNC Symbol;Acc:HGNC:6221])

HSP 1 Score: 316.62 bits (810), Expect = 1.199e-101
Identity = 165/383 (43.08%), Postives = 249/383 (65.01%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKMCIDNKNYNFLSG-------------------FFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXX--XXFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             R+ INVSGL FET +  LD+ P TLLG+P+ R ++FD  RNEYFFDR+R +F+ I +YY+ G +++RP NV  DVF  E+++++L    +  F  D+G++ E+ K LPS+   +++W+LFEYPE+S  A  + IVS+L+ ++SI  FC+ET+P++     D K   FL                     FFI ETIC IWF+ E++ R  +CP+   + K   N++DIVA++PY+ITL   + + +   G++  S   +  +  +   RIFKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E D ++S+  SIPDAFWW V+TM TVGYGDM P ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   28 ERIVINVSGLRFETQLKSLDQFPDTLLGNPSKRSRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVSIDVFSEEIKFYELGNEAMAKFQEDEGFIKEEEKPLPSDEFQRQVWLLFEYPESSNPARGIAIVSVLVILISIIIFCLETLPEFR----DEKEQKFLPAKDINGTQVKIMHGSSFTDPFFIVETICIIWFSFELLVRFFACPSKPGFFKSIMNIIDIVAILPYFITLGTEM-AKHQGSGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADHQNSEFRSIPDAFWWAVVTMTTVGYGDMRPVTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 405          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Sea Lamprey
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:HGNC Symbol;Acc:HGNC:6221])

HSP 1 Score: 316.235 bits (809), Expect = 4.425e-101
Identity = 170/391 (43.48%), Postives = 251/391 (64.19%), Query Frame = 1
Query:  460 NRYSVAE--GHS-KSRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKMCIDNKNYNFLSG------------FFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLA-NMLFSDNCIDGKKGGSSXXXXXXXXXX--XXFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RY +A   GH    RV INVSGL FET +  L + P TLLG P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +++RP +VP D+F  E+ ++ L    +  +  D+GYV E  K LP N   +++W+LFEYPE+S  A A+ IVS+L+ ++SI  FC+ET+P++       K   + +G            FFI ETIC IWF+ E++ R  +CP+  E+ K+  N++DIVA++PY+ITL   M       +G++  S   +  +  +   RIFKL++HS GLQ+L  T  AS+  LG+ +  + + ++LFSS +++ EVD K ++  SIPDAFWW ++TM TVGYGDM PK++ G+IVGS CA++GVLT+++ VP+I  NFN F
Sbjct:   24 ERYELARPGGHDFCERVVINVSGLRFETQLRTLAQFPDTLLGDPQKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVSVPYDIFTEEVRFYDLGEETMLRYREDEGYVKEPEKPLPENEFQRQVWLLFEYPESSSPARAIAIVSVLVILISIIIFCLETLPEFRDDADLYKVSYYTNGTHYFYHNVFADPFFIMETICIIWFSFELMVRFCACPSKVEFGKNLMNIIDIVAIVPYFITLGTEMAEQTGSANGQQTMSLAILRVIRLVRVFRIFKLSRHSKGLQILGHTLHASMRELGLLIFFLFIGVILFSSAVFFAEVDSKKTEFQSIPDAFWWSLVTMTTVGYGDMSPKTVGGKIVGSLCAIAGVLTVSLPVPVIVSNFNYF 414          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Sea Lamprey
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:HGNC Symbol;Acc:HGNC:6221])

HSP 1 Score: 276.944 bits (707), Expect = 4.293e-87
Identity = 156/395 (39.49%), Postives = 236/395 (59.75%), Query Frame = 1
Query:  538 ISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKMCIDNKNYN------------------------------FLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXX------FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKFQSLLKLAVQQNV 1611
            +  L   P TLLG P  R ++FD  RNEYFFDR+R +F+ I +YY+   K++RP NVP D+F  E+ +++L    +  +  D+GYV E+ K LP N L +++W+LFEYPE+S  A  + IVS+L+ ++SI  F  ET+P++     D+K+ +                                  FFI ET+C +WF+ E++ R  +CP+   + K+  N +DIVA++PY+ITL   L + +   G   G     L ++R+IR+      FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS IY+ EVD  ++   SIP+AFWW ++TM TVGYGDM P +L G+IVGS CA++GVLT+A+ VP+I  NFN F      A +Q +
Sbjct:    2 LRTLAHFPDTLLGDPQKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSRGKLRRPTNVPYDIFAEEVRFYELGEETMARYREDEGYVKEEEKPLPENALQRQVWLLFEYPESSNPARVIAIVSVLVIVISIVIFVAETLPEFR----DDKDLHSGTRHDVGAGDAAVAAAGNSSGGSSGGGSGHADPFFIVETVCIVWFSFELLVRFCACPSKPGFFKNIMNTIDIVAIMPYFITLGTELAAQDT--GANNGQQTMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLRASMRELGLLIFFLFIGVILFSSAIYFAEVDDPNTHFHSIPEAFWWSLVTMTTVGYGDMFPVTLGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRGSEAEEQTL 390          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Sea Lamprey
Match: kcna1b (potassium voltage-gated channel, shaker-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-140515-1])

HSP 1 Score: 274.248 bits (700), Expect = 1.259e-86
Identity = 148/374 (39.57%), Postives = 223/374 (59.63%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIKLPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSK----------MCIDNKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXXFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKFQSL 1584
             RV INVSG  FET +  LD+ P +LLG P  R ++FD  +NEYFFDR    F+ I  YY+ G ++ +P +VP DVF  E+E+++L    +  +  +     E+  +      Q +W LFE  + S  A  + ++S + TI+SIT  C+ET+P++ K            I    YN L  FF+ ET C +WF  E+  R  +CP+   +MKD  N +DI+A++PY+IT+   +        +     L I+R++R++RIFKL++H   LQ+L LT +ASL  L +    + V++++FS  IYY+E D      +SIPDAFWW V+TM  VGYGDM P ++ G+IVG+ CA++GVLT+++ VP+I  NF  F +L
Sbjct:    1 QRVVINVSGERFETQLKTLDQFPDSLLGHPDKRARYFDPLQNEYFFDRSHVNFDAILFYYQSGGRLCKPVDVPSDVFREEVEFYELGEEAVAKYGENTLDTPEEENVHGKDFQQHVWRLFESRDGSIAAKMLSLMSFVTTILSITVMCLETLPQFRKDNQVHANRTEFSIRTSIYN-LDPFFMLETACVVWFIFELAVRFYACPSKTSFMKDFMNAIDILAIMPYFITVVLEIMQQQ---DQTRQPLLKIIRLVRVLRIFKLSRHCQDLQILGLTLKASLRELAMLSFFLFVAVVIFSGAIYYVEADDPQKHFSSIPDAFWWAVVTMTLVGYGDMWPMTVGGKIVGALCAITGVLTISLPVPVIVSNFKYFYNL 370          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Sea Lamprey
Match: kcna1b (potassium voltage-gated channel, shaker-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-140515-1])

HSP 1 Score: 274.248 bits (700), Expect = 1.479e-86
Identity = 148/374 (39.57%), Postives = 223/374 (59.63%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIKLPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSK----------MCIDNKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXXFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKFQSL 1584
             RV INVSG  FET +  LD+ P +LLG P  R ++FD  +NEYFFDR    F+ I  YY+ G ++ +P +VP DVF  E+E+++L    +  +  +     E+  +      Q +W LFE  + S  A  + ++S + TI+SIT  C+ET+P++ K            I    YN L  FF+ ET C +WF  E+  R  +CP+   +MKD  N +DI+A++PY+IT+   +        +     L I+R++R++RIFKL++H   LQ+L LT +ASL  L +    + V++++FS  IYY+E D      +SIPDAFWW V+TM  VGYGDM P ++ G+IVG+ CA++GVLT+++ VP+I  NF  F +L
Sbjct:    5 QRVVINVSGERFETQLKTLDQFPDSLLGHPDKRARYFDPLQNEYFFDRSHVNFDAILFYYQSGGRLCKPVDVPSDVFREEVEFYELGEEAVAKYGENTLDTPEEENVHGKDFQQHVWRLFESRDGSIAAKMLSLMSFVTTILSITVMCLETLPQFRKDNQVHANRTEFSIRTSIYN-LDPFFMLETACVVWFIFELAVRFYACPSKTSFMKDFMNAIDILAIMPYFITVVLEIMQQQ---DQTRQPLLKIIRLVRVLRIFKLSRHCQDLQILGLTLKASLRELAMLSFFLFVAVVIFSGAIYYVEADDPQKHFSSIPDAFWWAVVTMTLVGYGDMWPMTVGGKIVGALCAITGVLTISLPVPVIVSNFKYFYNL 374          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Nematostella
Match: SHAK4 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHB6])

HSP 1 Score: 297.745 bits (761), Expect = 1.187e-94
Identity = 170/380 (44.74%), Postives = 237/380 (62.37%), Query Frame = 1
Query:  481 GHSKSRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGF-HHDQGYVFEKIKLPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSK-------------MCIDNKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXX-XXFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
            G +  R+ INVSGL FET +  L+ +P TLLG+   R +++DS RNEYFFDR+R AF+ I  YY+ G K+ RPANVP DVF  E+ +++L  +V++     +     EK  LP N L ++IW LFE+P+TS  A  V I S+ +  +SI  FCIET+P++ K             + +DN+   F   +F  ET C IWFT E I RL+S P    +++   N++DIVA++PYYITL          D K     +  +  +  + RIFKL++HS GLQ+L  T +ASL  LG+ +  +L+ ++LFSS +YY E   K +   SIPDAFWW V+TM TVGYGDM P ++ G+IVGS CA+SGVLT+A+ VP+I  NFN F
Sbjct:   54 GEATDRILINVSGLKFETHVQTLESNPDTLLGNAVKRAKYYDSVRNEYFFDRNRPAFDAILFYYQSGGKLLRPANVPMDVFADEIRFYELGDDVLHKVEQEEGYIEEEKPILPENKLQRQIWQLFEFPDTSMPARFVAIFSVFVITLSIVTFCIETLPQFQKKEEDLYVSVNGTLVPVDNR---FDQPWFSMETACIIWFTFEYIMRLISSPQKLIFIRSFLNMIDIVAILPYYITLPMQ-------DTKASSLGVLRVIRLVRVFRIFKLSRHSRGLQILGHTLRASLRELGLLIFFLLIGVILFSSAVYYAEGGEKGTHFKSIPDAFWWAVVTMTTVGYGDMRPITVWGKIVGSLCAISGVLTIALPVPVIVSNFNYF 423          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Nematostella
Match: SHAK3 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK45])

HSP 1 Score: 267.7 bits (683), Expect = 9.441e-84
Identity = 157/379 (41.42%), Postives = 233/379 (61.48%), Query Frame = 1
Query:  496 RVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYS-KMCIDNKNYNFL-----------------SGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXXFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
            R+ INVSGL FET+ + L + P TLLGS + R+++FDS  +EYFFDR+R  FE I  +Y+   K+ RP+ VP  +F  E+ +FKL  + +     ++GY+ E  + LP + L ++IW LFEYP++S  A  + + S+ + ++SI  FCIET+P +  K   D      L                 S +   E +C  WFT+E + RL+S P    +++   NV+D++A++PYYITL         +      + L ++R++R+ RIFKL++HS GLQVL  T +AS   L + +  +L+S++LFSS +YY E +   S  +SIPDAFWW V+TM TVGYGDM P +  G++VGS CA+SGVLT+A+ VP+I  NFN F
Sbjct:    2 RIIINVSGLRFETYEATLAQFPNTLLGSESKREEYFDSDADEYFFDRNRSTFEAILFFYQSNGKLVRPSGVPFLLFKDEVIFFKLGKDNLKRLEEEEGYIEETTRVLPRHHLQRRIWELFEYPDSSMGARVLAVWSVSVILISIVVFCIETLPTFRCKTSPDGNGCPKLLPGTNSTADHPEPVEKSSAWLALEILCIAWFTLEYVVRLLSSPQKLLFVRSFLNVIDLMAILPYYITLPMKDLRITSL------AVLRVIRLVRVFRIFKLSRHSRGLQVLGHTLRASSRELAMLIFFLLISVVLFSSAVYYAEEEEAASKFSSIPDAFWWAVVTMTTVGYGDMYPVTPWGKLVGSICAISGVLTIALPVPVIVSNFNYF 374          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Nematostella
Match: SHAK6 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFM4])

HSP 1 Score: 266.929 bits (681), Expect = 1.223e-83
Identity = 151/380 (39.74%), Postives = 230/380 (60.53%), Query Frame = 1
Query:  496 RVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSK-------------MCIDNKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXX---XXXXXXXXXFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDV-KDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKFQS 1581
            R+ IN+SGL +ET+   L+R P +LLG  + R   +DS  +EYFFDR+R  FE I  YY+    + RP N+P  VF+S+++YF L    +     D      +I+ +P N   + +W LFE+P+TS  A A+ I S+ + ++SI  FC+ET+P++ +             + IDN      S FF  E+ C  WFT+E   R +  P+  +++    N++D+VA++P++ITL         +      SSLAI   +R++R+ RIFKL+++S GLQ+L  T +ASL  LG+    + V ++LFSS +YY E +  +D++  SIP +FWW +ITM TVGYGDM PK+L G++VG FCA+SGVL +A+ VP+I  NF  + S
Sbjct:    2 RITINISGLRYETFDKTLERFPESLLGCKSRRDDFYDSVNDEYFFDRNRLCFESILAYYQTCGVLIRPPNIPRKVFVSDIKYFDLGEQALRQAGDDLEITDREIRPMPKNKFQRTVWSLFEHPDTSNGARAIAIFSVAVIVLSIVLFCVETLPQFQRRPKEVLRNNITETIMIDNPKK---SVFFAIESFCIAWFTLEYFIRFLCSPDKCKFVVSVLNLIDLVAILPFFITLP--------MTEPTSVSSLAILRCVRLVRVFRIFKLSRYSRGLQILGHTLKASLRELGLLFFFLCVGVILFSSAVYYAEYNYNRDTEFLSIPHSFWWSIITMTTVGYGDMAPKTLGGKLVGCFCAISGVLAIALPVPVIVSNFAYYYS 370          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Nematostella
Match: SHAK5 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAS8])

HSP 1 Score: 264.233 bits (674), Expect = 1.659e-82
Identity = 145/383 (37.86%), Postives = 228/383 (59.53%), Query Frame = 1
Query:  496 RVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHH---DQGYVFEKIKLPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKMCIDNKN---------------------YNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXXFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIA-SIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFN 1569
            RV +NVSG  ++T++  LD+ PTTLLG P  R+++FD   NEYFFDR++Q FE I ++Y+   ++  P ++  ++ L E+E+F L    IN       D+        +P+N +  + W LFEY ++S  A  + + S+ + + SI   C+ET+P ++ + I + N                     + +L   FI       WFT+E + R +S P    +++   NV+DI+A++P+YI L  +L S    DG    + L ILR++R+ RIFKL++HS+GLQ+L LT + SL  LG+ +  + + +++FSS  YY E   KD+ +  SIPD FWW ++TM TVGYGD+VPK+L G++VGS CA+ GVL +A+ VP+I  NF+
Sbjct:    1 RVTLNVSGFRYQTYVETLDKFPTTLLGDPAKRREYFDPDLNEYFFDRNKQVFEIILYFYQSNGRLVCPPDLAPEILLEEVEFFDLGETAINAVKELLTDEEPDETPRDMPTNKIQTQFWNLFEYADSSKAARVIALFSVSIIVASIAVLCVETLPNFAILPIHDPNNTEEVRRVNKHNEGAILARRWFGYLEAAFIA------WFTLEYLVRFLSSPKKCPFVRSFLNVIDILAIVPFYIDL--ILNSVQSNDGTLSLAFLRILRLVRVFRIFKLSRHSSGLQILGLTLRKSLRELGLLIFFLFIGVVIFSSMAYYAEAGTKDTHLGRSIPDTFWWALVTMTTVGYGDLVPKTLWGKLVGSCCALCGVLAIALPVPVIVSNFD 375          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Nematostella
Match: SHAK1 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK44])

HSP 1 Score: 259.996 bits (663), Expect = 5.076e-81
Identity = 143/371 (38.54%), Postives = 221/371 (59.57%), Query Frame = 1
Query:  499 VRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK--LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKMCIDN-KNYN---------FLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXXFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
            + INVSG  FET+   L R P TLLG P  R +  ++++ EYFFDRHR AF+ I +YY+ G  + RP +VP  VF++E+ ++ L    +     D G   E  +  LP N  L+ +W   EYPE S  A  + I S+++ ++S+  FC+ET+P++    +   KN           +   +F   T   +WFT E I RL+  P   +++    N++D+++++PYY+ LA          G    S L ++RV+R+ R+FKL++HS GLQ+L  T +AS+N L + +  + + +++F+S +YY E  + DS   SIP +FWW V+TM TVGYGD+ P+S  G+IVG+ CA+SGVLT+A+ VP+I  NF  F
Sbjct:    3 IVINVSGKRFETYEETLARFPDTLLGCPARRAKFLNNKKGEYFFDRHRSAFDAILYYYQAGGSLIRPEHVPPHVFINEVIFYDLPEEALQSVQLDAGIADEPEEKVLPKNQYLRYVWETLEYPEYSKLAKFLAIFSVVVIVLSLIIFCVETLPEFMPQEVTKPKNATADWKPPKDPYEETWFQLNTFVIVWFTAEYILRLICSPEKLKFLLAALNIIDLLSILPYYVQLA-------LDSGSSSISVLRVVRVVRVFRVFKLSRHSRGLQILGNTLRASMNELMMLMFFLFIGVMIFASCVYYAEGGI-DSPFRSIPHSFWWAVVTMTTVGYGDISPESFWGKIVGALCAISGVLTIALPVPVIVSNFENF 365          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Medaka
Match: ENSORLT00000025729.2 (shaker-related potassium channel tsha2 [Source:NCBI gene;Acc:101167693])

HSP 1 Score: 337.421 bits (864), Expect = 4.412e-109
Identity = 161/377 (42.71%), Postives = 251/377 (66.58%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKMCIDNKNYNFLSG-------------FFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXX--XFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV IN+SGL FET +  L + P TLLG P  R + FD  RNEYFFDR+R +F+ I +YY+ G +++RP NVP D+F+ E+++++L   VI  F  D+G++ E+ + LP +   +++W+LFEYPE+SG A  + IVS+L+ ++SI  FC+ET+P++ +   D +   +++G             FFI ET+C IWF+ E++ R ++CP+   + K+  N +DIVA++PY+ITL  +  +++  +G++  S   +  +  +    IFKL++HS GLQ+L  T QAS+  LG+ +  + + ++LFSS +Y+ E D   S  +SIPDAFWW V++M TVGYGDM P ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   36 ERVVINISGLRFETQLKTLAQFPATLLGDPRKRMRFFDPLRNEYFFDRNRPSFDAIVYYYQSGGRLRRPVNVPVDIFMEEIKFYELGEEVIENFKEDEGFIKEEERPLPEHEFQRQVWLLFEYPESSGAARGIAIVSVLVILISIVIFCLETLPEFREDARDLEAQPYVNGTASADRANPFTDPFFIVETLCIIWFSFELLVRFLACPSKPAFFKNIMNTIDIVAIMPYFITLG-LELAEHQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAETDDPHSGFSSIPDAFWWAVVSMTTVGYGDMCPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 411          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Medaka
Match: ENSORLT00000004658.2 (pep primary_assembly:ASM223467v1:6:13425755:13435070:-1 gene:ENSORLG00000003738.2 transcript:ENSORLT00000004658.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 336.65 bits (862), Expect = 5.322e-109
Identity = 162/381 (42.52%), Postives = 253/381 (66.40%), Query Frame = 1
Query:  475 AEGHSKSRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKMCIDNKNYN-----------FLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXX--XFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
            A+     R+ IN+SGL FET +  L R PTTLLG P  R + +D  RNEYFFDR+R +F+ I +YY+ G +++RP +VP D+FL E+++++LE  VI  F  D+G   E+ + LPSN   +++W+LFEYPE+SG A  + IVS+++ ++SI  FC+ET+P++  +  +  N+            F   FF+ ET+C +WF+ E + R +SCP+   + K+  N++D+VA+ PY+ITL  M  +++    ++  S   +  +  +    IFKL++HS GLQ+L  T +ASL  LG+ +  +++ ++LFSS++Y+ EV+  +S+ +SIPDAFWW V+TM TVGYGDM P ++ G+ VGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   27 ADQECSERLVINISGLRFETQLKTLSRFPTTLLGDPRKRIRFYDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVSVPVDIFLEELKFYELEEEVIELFKDDEGLPREEERPLPSNEFQRQVWLLFEYPESSGPARMIAIVSVMVILISIVIFCLETLPEFKDVPPEPDNHANGSAHGKEPSPFTDPFFMVETLCIVWFSFEFMMRFLSCPSKPVFFKNIMNLIDVVAIAPYFITLG-MDLAEHQGSSQQAASLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLRASLRELGLLIFFLIIGVVLFSSSVYFAEVEDPNSEFSSIPDAFWWAVVTMTTVGYGDMCPTTIGGKFVGSLCAIAGVLTIALPVPVIVSNFNYF 406          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Medaka
Match: ENSORLT00000010657.2 (potassium voltage-gated channel subfamily A member 2 [Source:NCBI gene;Acc:101157775])

HSP 1 Score: 337.035 bits (863), Expect = 1.289e-108
Identity = 166/414 (40.10%), Postives = 259/414 (62.56%), Query Frame = 1
Query:  400 LSSTSSTPGEIAPFNDVNKFNRYSVAEGHSK-SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKY---------------SKMCIDNKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXX-----FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
            ++  +S P + A  +     ++Y     H    RV IN+SGL FET +  L + P TLLG P  R ++FD  RNEYFFDRHR +F+ I +YY+ G +++RP NV  D+F  E+ +++L    +  F  D+G++ E+ + LP N   +++W+LFEYPE+SG A  + I+S+++ ++SI +FC+ET+P +               S    D+  Y F   FFI ET+C IWF+ E + R  +CP+   +  +  N++DIVA+IPY+ITL   L ++   DG+ G  ++++  +  +  +     FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E D K S  +SIP+AFWW V++M TVGYGDMVP ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:    1 MTVATSDPMDEAAAHPCQPNDQYGPETDHDCCERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRHRPSFDAILYYYQSGGRLRRPVNVTLDIFSEEIRFYELGEEAMEIFREDEGFIREEERPLPENEFQRQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPVFRNEEDPYSSYQVMSNSTTTFDSSTY-FTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFGNIMNIIDIVAIIPYFITLGTEL-AERPEDGQSGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEKQSQFSSIPEAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 412          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Medaka
Match: kcna1b (potassium voltage-gated channel subfamily A member 1-like [Source:NCBI gene;Acc:101167438])

HSP 1 Score: 333.183 bits (853), Expect = 4.597e-107
Identity = 166/380 (43.68%), Postives = 249/380 (65.53%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKMCIDN-----------KNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSD-NCIDGKKGGSSXXXXXXXXXXXX------FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV IN+SGL FET +  L + P TLLG+P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +++RP NVP D+F  E+++++L    +  F  D+G++ E+ + LP     ++IW+LFE+PE+SG A  + IVS+++ ++SI  FC+ET+P+  +   D            K   F   FF+ ET+C IWF+ E+I R  +CP+   + K+  N +DIVA+IPY+ITL   L  D +  +GK GG     L ++R+IR+      FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E + K+S   SIPDAFWW V++M TVGYGDM P ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   36 ERVVINISGLRFETQLKTLAQFPETLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGAEAMEKFREDEGFIREEERPLPEKEFQRQIWLLFEHPESSGPARGIAIVSVMVILISIVIFCLETLPELKEDPNDRIQVVGNGTIYYKANFFTDPFFVVETLCIIWFSFELIVRFFACPSKAAFFKNMMNSIDIVAIIPYFITLGTELADDQDNKEGKAGGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEDKESFFTSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 415          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Medaka
Match: kcna2a (potassium voltage-gated channel, shaker-related subfamily, member 2a [Source:ZFIN;Acc:ZDB-GENE-131113-1])

HSP 1 Score: 330.872 bits (847), Expect = 1.413e-106
Identity = 161/386 (41.71%), Postives = 247/386 (63.99%), Query Frame = 1
Query:  493 SRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIP-----------KYSKMCIDNKNYNFLS--------GFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXX-----FKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
             RV IN+SGL FET +  L + P TLLG P  R ++FD  RNEYFFDR+R +F+ I +YY+ G +++RP NV  D+F  E+ +++L    I  F  D+G++ E+ + LP N   +++W+LFEYPE+SG A  + I+S+++ ++SI +FC+ET+P            ++K+     N   +S         FFI ET+C IWF+ E + R  +CP+   +  +  N++DIVA+IPY+ITL   L +D   DG+ G  ++++  +  +  +     FKL++HS GLQ+L  T +AS+  LG+ +  + + ++LFSS +Y+ E D  +S   SIPDAFWW V++M TVGYGDMVP ++ G+IVGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   29 ERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVTLDIFSEEIRFYELGEEAIEMFREDEGFIKEEERPLPDNEFQRQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPIFRNDEDDMHKSHAKVFSPETNTTIISYTSTYFTDPFFILETLCIIWFSFEFLVRFFACPSKAGFFGNIMNIIDIVAIIPYFITLGTEL-ADRPEDGQPGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEPESQFESIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF 413          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Planmine SMEST
Match: SMESG000006565.1 (SMESG000006565.1)

HSP 1 Score: 823.157 bits (2125), Expect = 0.000e+0
Identity = 409/410 (99.76%), Postives = 409/410 (99.76%), Query Frame = 1
Query:  352 MSNTFNFTHNYRYREFLSSTSSTPGEIAPFNDVNKFNRYSVAEGHSKSRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIKLPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKMCIDNKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXXFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKFQS 1581
            MSNTFNFTHNYRYREFLSSTSSTPGEIAPFNDVNKFNRYSVAEGHSKSRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIKLPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKMCIDNKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSLAILRVIRLIRIFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF S
Sbjct:    1 MSNTFNFTHNYRYREFLSSTSSTPGEIAPFNDVNKFNRYSVAEGHSKSRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIKLPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKMCIDNKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSLAILRVIRLIRIFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKFYS 410          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Planmine SMEST
Match: SMESG000013562.1 (SMESG000013562.1)

HSP 1 Score: 436.802 bits (1122), Expect = 6.912e-148
Identity = 212/365 (58.08%), Postives = 286/365 (78.36%), Query Frame = 1
Query:  490 KSRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIKLPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKM-CIDNKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXXFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKFQS 1581
            K +V IN+SGL FETW   L+ HPTTLLG P+ R  ++D +R EYFFDR+R AFE IF+YY+ G KIKRP NVP+++FL+E++++++E +VI+ +  D+G+  E I+LP+N + + IW+LFE+PETS  A+ V ++S+  T++SI  FC+ET P ++K  C+     NFL  FFI ET+CT WFTIE+  R +SCP+  +++KD KN++D+ A+IPYY+TL N+L + +C DG K  +SLA LRVIRLIR+FKLTKHS GLQVL+LTF+AS+ GLG+FL+A+ VS++LFSSTIYY EV   DS I SIPDAFWW +ITMCTVGYGD VP+ ++G++VGS CAVSGVLTLA+ VPII+ENFNKF S
Sbjct:   99 KEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIELPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVSGAAPNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDC-DGAKKSASLAFLRVIRLIRVFKLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYS 462          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Planmine SMEST
Match: SMESG000014198.1 (SMESG000014198.1)

HSP 1 Score: 405.216 bits (1040), Expect = 2.170e-136
Identity = 201/371 (54.18%), Postives = 271/371 (73.05%), Query Frame = 1
Query:  472 VAEGHSKSRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIKLPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKM-CIDNKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXXFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKFQS 1581
            +  G      +INVSG+ FE     L  HPTTLLG     K +FD R NEYFFDRHR  FE IF YY+Y   +KRP +VP+D+FL E+++F++E  V+  +  ++G+V E   LP     QK+W+LFEYPETS  AY +G++S++ T++SI  FC+ET+P + +  C+D    NFL  FF+ ET CT WF++E I RLV CP+   ++KD KN +DI+A++PYY+TL N+L+S +C  G K  +SLA LRVI+LIRIFKLTKHS+GLQVL+ TF+AS+  LG+F++A+ + ++LFSS +YY+E   +DSDI SIP AFWW +ITMCTVGYGD VP+  +G+IVGSFCAV+GVLTLA+ VPII+ENFNKF S
Sbjct:   37 LVNGPGAQTTKINVSGMKFEIPTYKLKYHPTTLLGDSHKCKSYFDKRFNEYFFDRHRPTFEAIFVYYQYSCDLKRPFDVPDDIFLEELKFFQIEKEVVMKYKLEEGHVEETFVLPKGKYQQKLWILFEYPETSLLAYTIGLISMIFTLISIILFCVETLPVFKETHCVDGSAPNFLDSFFLIETFCTAWFSLEFIVRLVVCPSKNAHIKDLKNTVDIIAILPYYVTLVNVLYSFSC-SGAKNSASLAFLRVIKLIRIFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYS 406          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Planmine SMEST
Match: SMESG000014206.1 (SMESG000014206.1)

HSP 1 Score: 401.364 bits (1030), Expect = 6.921e-135
Identity = 200/371 (53.91%), Postives = 270/371 (72.78%), Query Frame = 1
Query:  472 VAEGHSKSRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIKLPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKM-CIDNKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXXXXFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKFQS 1581
            +  G      +INVSG+ FE     L  HPTTLLG     K +FD R NEYFFDRHR  FE IF YY+Y   +KRP +V +D+FL E+++F++E  V+  +  ++G+V E   LP     QK+W+LFEYPETS  AY +G++S++ T++SI  FC+ET+P + +  C+D    NFL  FF+ ET CT WF++E I RLV CP+   ++KD KN +DI+A++PYY+TL N+L+S +C  G K  +SLA LRVI+LIRIFKLTKHS+GLQVL+ TF+AS+  LG+F++A+ + ++LFSS +YY+E   +DSDI SIP AFWW +ITMCTVGYGD VP+  +G+IVGSFCAV+GVLTLA+ VPII+ENFNKF S
Sbjct:   37 LVNGPGAQTTKINVSGMKFEIPTYKLKYHPTTLLGDSHKCKSYFDKRFNEYFFDRHRPTFEAIFVYYQYSCDLKRPFDVLDDIFLEELKFFQIEKEVVMKYKLEEGHVEETFVLPKGKYQQKLWILFEYPETSLLAYTIGLISMIFTLISIILFCVETLPVFKETHCVDGSAPNFLDSFFLIETFCTAWFSLEFIVRLVVCPSKNAHIKDLKNTVDIIAILPYYVTLVNVLYSFSC-SGAKNSASLAFLRVIKLIRIFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYS 406          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Planmine SMEST
Match: SMESG000020672.1 (SMESG000020672.1)

HSP 1 Score: 347.821 bits (891), Expect = 1.623e-112
Identity = 179/417 (42.93%), Postives = 255/417 (61.15%), Query Frame = 1
Query:  379 NYRYREFLSSTSSTPGEIAPFNDVNKFNRYSVAEGHSKSRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIK-LPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKMCIDNKNY----------------NFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSXXXXXXXXXX-XXFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKF 1575
            +YR   F  S    P E  P++ V +   Y +       RV IN+SGL FET +  L + P TLLG+   R Q+FD  RNEYFFDR+R +F+ I +YY+ G +++RP NVP DVF  E+++++L    I  +  D+GY+ E IK LP NP  +K+W+LFEYPE+S  A  V I S+ + I+SI  FCIET+P +    I N  +                 F   FFI ET+C IWFT E++ R  S P    + K   N++DIVA+IPY+ITL  ++  D+    +    ++  +  +  + RIFKL++HS GLQ+L  T +AS+  LG+ +  +L+S++LFSS +Y+ E D   S   SIPDAFWW V+TM TVGYGDM P ++ G++VGS CA++GVLT+A+ VP+I  NFN F
Sbjct:   29 DYRSHTFNQSMPKYPDEETPYDKVGENAEYDI------ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAICSVFVIILSIVIFCIETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIADDSRSQNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASVRELGLLVFFLLISVILFSSAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYF 439          
The following BLAST results are available for this feature:
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNA23.218e-10842.08potassium voltage-gated channel subfamily A member... [more]
KCNA23.218e-10842.08potassium voltage-gated channel subfamily A member... [more]
KCNA23.218e-10842.08potassium voltage-gated channel subfamily A member... [more]
KCNA23.218e-10842.08potassium voltage-gated channel subfamily A member... [more]
KCNA23.218e-10842.08potassium voltage-gated channel subfamily A member... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shk-16.843e-8438.24Potassium voltage-gated channel protein shk-1 [So... [more]
shk-16.843e-8438.24Potassium voltage-gated channel protein shk-1 [So... [more]
shk-11.012e-8338.24Potassium voltage-gated channel protein shk-1 [So... [more]
shk-13.194e-8338.24Potassium voltage-gated channel protein shk-1 [So... [more]
shk-11.048e-8239.16Potassium voltage-gated channel protein shk-1 [So... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sh2.650e-10542.01gene:FBgn0003380 transcript:FBtr0089660[more]
Sh3.174e-10542.27gene:FBgn0003380 transcript:FBtr0089657[more]
Sh3.742e-10542.27gene:FBgn0003380 transcript:FBtr0302903[more]
Sh3.742e-10542.27gene:FBgn0003380 transcript:FBtr0089661[more]
Sh3.742e-10542.27gene:FBgn0003380 transcript:FBtr0302902[more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcna2b3.641e-10942.78potassium voltage-gated channel, shaker-related su... [more]
kcna1a4.214e-10843.42potassium voltage-gated channel, shaker-related su... [more]
kcna1a4.214e-10843.42potassium voltage-gated channel, shaker-related su... [more]
kcna2a8.978e-10641.73potassium voltage-gated channel, shaker-related su... [more]
kcna2a8.978e-10641.73potassium voltage-gated channel, shaker-related su... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNA26.654e-10941.82potassium channel, voltage gated shaker related su... [more]
KCNA53.838e-10840.95potassium channel, voltage gated shaker related su... [more]
KCNA33.939e-10743.04potassium voltage-gated channel subfamily A member... [more]
KCNA14.290e-10744.53potassium channel, voltage gated shaker related su... [more]
ENSXETT00000049277.11.986e-10543.52potassium channel, voltage gated shaker related su... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcna26.658e-10942.34potassium voltage-gated channel, shaker-related su... [more]
Kcna26.658e-10942.34potassium voltage-gated channel, shaker-related su... [more]
Kcna26.658e-10942.34potassium voltage-gated channel, shaker-related su... [more]
Kcna15.695e-10541.82potassium voltage-gated channel, shaker-related su... [more]
Kcna15.695e-10541.82potassium voltage-gated channel, shaker-related su... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q09081|KCNA2_RABIT4.095e-10841.82Potassium voltage-gated channel subfamily A member... [more]
sp|P63142|KCNA2_RAT4.657e-10842.34Potassium voltage-gated channel subfamily A member... [more]
sp|P63141|KCNA2_MOUSE4.657e-10842.34Potassium voltage-gated channel subfamily A member... [more]
sp|P16389|KCNA2_HUMAN1.546e-10742.08Potassium voltage-gated channel subfamily A member... [more]
sp|P22739|KCNA2_XENLA1.170e-10641.30Potassium voltage-gated channel subfamily A member... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H8035.147e-14257.46BTB domain-containing protein OS=Macrostomum ligna... [more]
A0A267DW527.850e-14257.46BTB domain-containing protein OS=Macrostomum ligna... [more]
A0A210PGX22.827e-14057.89Potassium voltage-gated channel subfamily A member... [more]
A0A2H1CQP48.358e-13853.03K+ channel tetramerization domain protein OS=Fasci... [more]
A0A5J4P1R62.739e-13759.28BTB domain-containing protein OS=Paragonimus weste... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcna2b8.836e-10943.04potassium voltage-gated channel subfamily A member... [more]
kcna1a1.060e-10743.12potassium voltage-gated channel subfamily A member... [more]
kcna2a2.175e-10641.03potassium voltage-gated channel subfamily A member... [more]
KCNA38.071e-10640.38potassium voltage-gated channel subfamily A member... [more]
ENSAMXT00000027012.21.016e-10139.61potassium voltage-gated channel subfamily A member... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNA31.199e-10143.08potassium voltage-gated channel subfamily A member... [more]
KCNA34.425e-10143.48potassium voltage-gated channel subfamily A member... [more]
KCNA34.293e-8739.49potassium voltage-gated channel subfamily A member... [more]
kcna1b1.259e-8639.57potassium voltage-gated channel, shaker-related su... [more]
kcna1b1.479e-8639.57potassium voltage-gated channel, shaker-related su... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
SHAK41.187e-9444.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAK39.441e-8441.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAK61.223e-8339.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAK51.659e-8237.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAK15.076e-8138.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000025729.24.412e-10942.71shaker-related potassium channel tsha2 [Source:NCB... [more]
ENSORLT00000004658.25.322e-10942.52pep primary_assembly:ASM223467v1:6:13425755:134350... [more]
ENSORLT00000010657.21.289e-10840.10potassium voltage-gated channel subfamily A member... [more]
kcna1b4.597e-10743.68potassium voltage-gated channel subfamily A member... [more]
kcna2a1.413e-10641.71potassium voltage-gated channel, shaker-related su... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006565.10.000e+099.76SMESG000006565.1[more]
SMESG000013562.16.912e-14858.08SMESG000013562.1[more]
SMESG000014198.12.170e-13654.18SMESG000014198.1[more]
SMESG000014206.16.921e-13553.91SMESG000014206.1[more]
SMESG000020672.11.623e-11242.93SMESG000020672.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020664 ID=SMED30020664|Name=Potassium voltage-gated channel subfamily A member 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1892bp
CAAGAATTTTAAATAGTTTCCAATGTCTCAATTTTTAAGAAATCTGATTA
TTTTTCTCTAAAAATCACCAAATCATCAAAAGATATTTCCAAATAAATTC
TGACAGTGAATTTCTTCGATTTTGTCAAGGATTAAAATTTTGGAAATAAA
ATTCCAAGAATTTTTTCCACAAAAAAAAATTTTCTTTGCACAGATTTCTC
GAAAACAATTTTCAATGTCAATCAGAGAAAATCAATGAGTAAAATTCGCG
GCACATTTGAGCATAAACAAACACACAAACAAATTCCATTTCCCCATGTT
TTCACAATTAATAATGGATTAATTTGAAGTGGATTGTGAAGTCTTTTACT
TATGAGTAATACTTTTAATTTTACTCACAACTACCGTTACAGGGAATTTC
TCTCGTCAACTTCTTCGACTCCTGGAGAAATTGCTCCGTTTAATGACGTG
AATAAGTTTAACAGATACTCTGTTGCTGAAGGCCACTCGAAATCACGGGT
TAGGATCAATGTTAGCGGTTTGATTTTCGAGACTTGGATATCGGATTTAG
ATCGTCATCCAACGACTCTTCTTGGAAGTCCGACTCTTCGGAAACAACAC
TTTGATTCTCGGAGAAATGAATATTTTTTTGACAGACATCGACAAGCGTT
TGAAGGAATTTTTCATTATTATAAATATGGAGATAAAATCAAACGTCCAG
CCAATGTTCCGGAAGATGTGTTTCTTAGTGAAATGGAATATTTCAAACTC
GAACCCAACGTCATAAATGGATTTCATCATGATCAGGGCTACGTTTTTGA
AAAGATTAAGCTCCCTTCTAATCCTCTGTTACAAAAAATTTGGGTATTAT
TCGAATATCCCGAAACGTCTGGATATGCCTATGCAGTGGGAATTGTTTCC
CTTCTCCTAACAATAATGTCTATAACTGCCTTTTGCATTGAAACAATACC
GAAGTACTCAAAAATGTGCATTGATAATAAGAACTATAACTTTTTAAGTG
GGTTTTTTATATGCGAAACGATTTGTACGATTTGGTTTACGATTGAGATG
ATTGGTCGGCTGGTTTCTTGCCCGAATTTGAAAGAATATATGAAAGACTG
TAAAAATGTCATGGATATAGTGGCATTAATTCCGTATTACATTACTCTTG
CCAACATGTTATTTTCTGACAATTGTATCGATGGTAAAAAAGGAGGTTCA
TCTTTGGCGATTCTTAGAGTGATTCGATTAATAAGAATATTCAAGTTAAC
AAAACATAGCACCGGTTTACAAGTATTAATTCTTACATTTCAAGCGAGCC
TCAATGGTCTGGGAATCTTTCTTCTAGCCATGCTCGTTTCCATGTTGCTT
TTCTCATCAACAATATATTATCTTGAAGTAGACGTCAAAGACTCCGATAT
CGCCAGTATTCCTGATGCATTCTGGTGGTGCGTAATCACAATGTGTACCG
TTGGTTATGGTGACATGGTTCCAAAGAGTTTAATGGGCAGAATTGTTGGA
AGTTTTTGCGCTGTTTCCGGTGTCCTAACGCTAGCTATGGCAGTTCCGAT
TATATCAGAAAATTTTAATAAATTTCAATCGCTTCTAAAGTTAGCCGTTC
AACAGAATGTGCTGACGTGCTGCGGTTCATTAATGAATGGTGTGGTTCGC
TTCCTGCTAGTGGTTAAGCGGTCGACACCTCAGGAGGTGTAATTTCATAA
TGGTATAACAATCGTCTTAATTTTAATTGGTTTAAATTTGAACAAATTGA
ATTTGAGATTTCCTTTTTAAAAAATTCAAAAAATTTAGTGTAAAAAGCAT
TAGTAAAATTTCCATACAAGTGGCGGTAACCTTTTCGTATTGACTCATGG
TAATAAACAATAACTTGTAATTATAGTTTTATCGAGTGAAAC
back to top

protein sequence of SMED30020664-orf-1

>SMED30020664-orf-1 ID=SMED30020664-orf-1|Name=SMED30020664-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=447bp
MSNTFNFTHNYRYREFLSSTSSTPGEIAPFNDVNKFNRYSVAEGHSKSRV
RINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAF
EGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFE
KIKLPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIP
KYSKMCIDNKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDC
KNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSLAILRVIRLIRIFKLT
KHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDI
ASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPI
ISENFNKFQSLLKLAVQQNVLTCCGSLMNGVVRFLLVVKRSTPQEV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000419prepharyngeal region
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR003968K_chnl_volt-dep_Kv
IPR003972K_chnl_volt-dep_Kv1
IPR028325VG_K_chnl
IPR000210BTB/POZ_dom
IPR027359Volt_channel_dom_sf
IPR003131T1-type_BTB
IPR005821Ion_trans_dom
IPR011333SKP1/BTB/POZ_sf
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0051260protein homooligomerization
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0006810transport
GO:0034765regulation of ion transmembrane transport
GO:0071805potassium ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0008076voltage-gated potassium channel complex
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005249voltage-gated potassium channel activity
GO:0005515protein binding
GO:0005216ion channel activity
GO:0005244voltage-gated ion channel activity
GO:0005267potassium channel activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003968Potassium channel, voltage dependent, KvPRINTSPR01491KVCHANNELcoord: 90..100
score: 68.71
coord: 319..333
score: 19.67
coord: 390..401
score: 60.62
coord: 295..303
score: 69.91
NoneNo IPR availablePRINTSPR00169KCHANNELcoord: 90..109
score: 50.15
coord: 246..266
score: 40.84
coord: 319..342
score: 30.88
coord: 379..405
score: 54.22
coord: 220..243
score: 41.58
coord: 350..372
score: 66.2
coord: 170..198
score: 38.11
coord: 290..316
score: 52.42
NoneNo IPR availableGENE3DG3DSA:3.30.710.10coord: 40..139
e-value: 5.8E-32
score: 111.7
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 303..408
e-value: 5.1E-29
score: 102.2
NoneNo IPR availablePANTHERPTHR11537:SF113POTASSIUM VOLTAGE-GATED CHANNEL PROTEIN SHAKERcoord: 47..408
NoneNo IPR availableCDDcd18407BTB_POZ_KCNA6coord: 49..173
e-value: 9.26186E-40
score: 136.281
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 176..406
NoneNo IPR availableTMHMMTMhelixcoord: 253..272
NoneNo IPR availableTMHMMTMhelixcoord: 174..196
NoneNo IPR availableTMHMMTMhelixcoord: 319..341
NoneNo IPR availableTMHMMTMhelixcoord: 216..238
NoneNo IPR availableTMHMMTMhelixcoord: 356..373
NoneNo IPR availableTMHMMTMhelixcoord: 380..402
IPR003972Potassium channel, voltage dependent, Kv1PRINTSPR01496SHAKERCHANELcoord: 91..101
score: 62.97
coord: 77..88
score: 41.87
coord: 190..201
score: 58.54
coord: 167..183
score: 61.98
IPR000210BTB/POZ domainSMARTSM00225BTB_4coord: 48..148
e-value: 2.2E-4
score: 30.6
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 149..302
e-value: 2.1E-40
score: 139.9
IPR003131Potassium channel tetramerisation-type BTB domainPFAMPF02214BTB_2coord: 50..139
e-value: 2.4E-23
score: 82.3
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 180..407
e-value: 8.0E-38
score: 130.1
IPR028325Voltage-gated potassium channelPANTHERPTHR11537VOLTAGE-GATED POTASSIUM CHANNELcoord: 47..408
IPR011333SKP1/BTB/POZ domain superfamilySUPERFAMILYSSF54695POZ domaincoord: 49..141