NPC intracellular cholesterol transporter 2

Overview
NameNPC intracellular cholesterol transporter 2
Smed IDSMED30020662
Length (bp)690
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NPC intracellular cholesterol transporter 2 (SMED30020662) t-SNE clustered cells

Violin plots show distribution of expression levels for NPC intracellular cholesterol transporter 2 (SMED30020662) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NPC intracellular cholesterol transporter 2 (SMED30020662) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NPC intracellular cholesterol transporter 2 (SMED30020662) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020662

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30020662SMESG000023323.1 dd_Smed_v4_602_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020662SMESG000023323.1 dd_Smed_v4_602_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020662SMESG000023323.1 dd_Smed_v6_602_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Human
Match: NPC2 (NPC intracellular cholesterol transporter 2 [Source:HGNC Symbol;Acc:HGNC:14537])

HSP 1 Score: 118.627 bits (296), Expect = 2.661e-33
Identity = 56/134 (41.79%), Postives = 81/134 (60.45%), Query Frame = 3
Query:  195 STIFAKDITHFKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPIS 596
            ST    +   FKDCGS+ G IK V+V PC ++PC + +GQ+ +++++F S     S KA VH +  G+P+PFP+P PD C+     CPI+    Y Y   L +K  YPSI+L + W+LQD   + L C E P+S
Sbjct:   14 STAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKS-GINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVS 146          
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Human
Match: NPC2 (NPC intracellular cholesterol transporter 2 [Source:HGNC Symbol;Acc:HGNC:14537])

HSP 1 Score: 118.627 bits (296), Expect = 3.757e-33
Identity = 55/135 (40.74%), Postives = 81/135 (60.00%), Query Frame = 3
Query:  195 STIFAKDITHFKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
            ST    +   FKDCGS+ G IK V+V PC ++PC + +GQ+ +++++F S     S KA VH +  G+P+PFP+P PD C+     CPI+    Y Y   L +K  YPSI+L + W+LQD   + L C E P+ +
Sbjct:   14 STAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKS-GINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQI 147          
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Human
Match: NPC2 (NPC intracellular cholesterol transporter 2 [Source:HGNC Symbol;Acc:HGNC:14537])

HSP 1 Score: 118.627 bits (296), Expect = 5.735e-33
Identity = 55/135 (40.74%), Postives = 81/135 (60.00%), Query Frame = 3
Query:  195 STIFAKDITHFKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
            ST    +   FKDCGS+ G IK V+V PC ++PC + +GQ+ +++++F S     S KA VH +  G+P+PFP+P PD C+     CPI+    Y Y   L +K  YPSI+L + W+LQD   + L C E P+ +
Sbjct:   14 STAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKS-GINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQI 147          
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Human
Match: NPC2 (NPC intracellular cholesterol transporter 2 [Source:HGNC Symbol;Acc:HGNC:14537])

HSP 1 Score: 118.242 bits (295), Expect = 1.660e-32
Identity = 55/135 (40.74%), Postives = 81/135 (60.00%), Query Frame = 3
Query:  195 STIFAKDITHFKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
            ST    +   FKDCGS+ G IK V+V PC ++PC + +GQ+ +++++F S     S KA VH +  G+P+PFP+P PD C+     CPI+    Y Y   L +K  YPSI+L + W+LQD   + L C E P+ +
Sbjct:   14 STAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKS-GINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQI 147          
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Human
Match: NPC2 (NPC intracellular cholesterol transporter 2 [Source:HGNC Symbol;Acc:HGNC:14537])

HSP 1 Score: 118.627 bits (296), Expect = 1.891e-32
Identity = 55/135 (40.74%), Postives = 81/135 (60.00%), Query Frame = 3
Query:  195 STIFAKDITHFKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
            ST    +   FKDCGS+ G IK V+V PC ++PC + +GQ+ +++++F S     S KA VH +  G+P+PFP+P PD C+     CPI+    Y Y   L +K  YPSI+L + W+LQD   + L C E P+ +
Sbjct:   14 STAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKS-GINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQI 147          
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Fly
Match: Npc2a (gene:FBgn0031381 transcript:FBtr0077816)

HSP 1 Score: 99.7525 bits (247), Expect = 2.961e-26
Identity = 49/139 (35.25%), Postives = 76/139 (54.68%), Query Frame = 3
Query:  189 AISTIFAKDITHFKDCGSIKGSIKTVSVDPCNS--EPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
            A   +FA  +  F DCGS  G    V+++ C++    C ++R    + SI F   E+ T+ K  VH    GI +PFPL NPD C     KCP++    Y+Y+ +L + + YP + + ++WELQD    D++CVE P  +
Sbjct:   10 AALVVFAGAL-EFSDCGSKTGKFTRVAIEGCDTTKAECILKRNTTVSFSIDFALAEEATAVKTVVHGKVLGIEMPFPLANPDACVDSGLKCPLEKDESYRYTATLPVLRSYPKVSVLVKWELQDQDGADIICVEIPAKI 147          
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Fly
Match: Npc2g (gene:FBgn0039800 transcript:FBtr0306293)

HSP 1 Score: 51.2174 bits (121), Expect = 6.048e-8
Identity = 40/156 (25.64%), Postives = 74/156 (47.44%), Query Frame = 3
Query:  153 FRATSISFVFIFAISTIFAKDITHFKDC-GSIKG-SIKTVSVDPC----NSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALK-DGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
             +A +I+ V I   S+  + ++ +F+ C  S+   +I+ V V PC    N+  C I+R  NS +S  F    D  +  A +   K + + +P    +   C++    CP+++G    Y+  + I+  +P    T+RW L+D + +   C    I V
Sbjct:    7 LQAVAIAIVLI---SSSASAEVVNFEPCPDSVDTCTIQQVRVSPCPEALNNAACNIRRKHNSEMSFDFTPNFDADTLVASLGWAKSENVELPLLTLDSAACKYT--PCPVRSGVKQTYTTLVPIEAKFPLSPYTIRWALKDPVSQKRCCFTIDIKV 157          
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Fly
Match: Npc2g (gene:FBgn0039800 transcript:FBtr0085723)

HSP 1 Score: 51.2174 bits (121), Expect = 6.048e-8
Identity = 40/156 (25.64%), Postives = 74/156 (47.44%), Query Frame = 3
Query:  153 FRATSISFVFIFAISTIFAKDITHFKDC-GSIKG-SIKTVSVDPC----NSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALK-DGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
             +A +I+ V I   S+  + ++ +F+ C  S+   +I+ V V PC    N+  C I+R  NS +S  F    D  +  A +   K + + +P    +   C++    CP+++G    Y+  + I+  +P    T+RW L+D + +   C    I V
Sbjct:    7 LQAVAIAIVLI---SSSASAEVVNFEPCPDSVDTCTIQQVRVSPCPEALNNAACNIRRKHNSEMSFDFTPNFDADTLVASLGWAKSENVELPLLTLDSAACKYT--PCPVRSGVKQTYTTLVPIEAKFPLSPYTIRWALKDPVSQKRCCFTIDIKV 157          
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Fly
Match: Npc2b (gene:FBgn0038198 transcript:FBtr0082888)

HSP 1 Score: 49.2914 bits (116), Expect = 2.680e-7
Identity = 36/155 (23.23%), Postives = 62/155 (40.00%), Query Frame = 3
Query:  165 SISFVFIFAISTIF--AKDITHFKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFP-LPNPDLCQFLNPK-------CPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
            S+    IFA    F  + D++      S   +   VS+  C    C ++R   ++I +    + D     + +  +   +P+PFP       C  +  +       CP+K G  Y Y  S  I  +YP++ L + W L D    D  C + P  +
Sbjct:    4 SLGLFVIFAALIGFTSSTDVSQCPKSKSKALAAGDVSISNCPKSKCILKRNTEASIQMKIRPERDFQELTSDIQGIILDVPLPFPGYYGTSACPHIYDEAGEKKVGCPLKAGQVYTYKNSFKILPVYPTVSLEIHWGLGDK-HGDAACFQIPAKI 157          
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Fly
Match: Npc2b (gene:FBgn0038198 transcript:FBtr0082889)

HSP 1 Score: 49.2914 bits (116), Expect = 2.680e-7
Identity = 36/155 (23.23%), Postives = 62/155 (40.00%), Query Frame = 3
Query:  165 SISFVFIFAISTIF--AKDITHFKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFP-LPNPDLCQFLNPK-------CPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
            S+    IFA    F  + D++      S   +   VS+  C    C ++R   ++I +    + D     + +  +   +P+PFP       C  +  +       CP+K G  Y Y  S  I  +YP++ L + W L D    D  C + P  +
Sbjct:    4 SLGLFVIFAALIGFTSSTDVSQCPKSKSKALAAGDVSISNCPKSKCILKRNTEASIQMKIRPERDFQELTSDIQGIILDVPLPFPGYYGTSACPHIYDEAGEKKVGCPLKAGQVYTYKNSFKILPVYPTVSLEIHWGLGDK-HGDAACFQIPAKI 157          
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Zebrafish
Match: npc2 (Niemann-Pick disease, type C2 [Source:NCBI gene;Acc:282673])

HSP 1 Score: 111.309 bits (277), Expect = 1.362e-30
Identity = 52/151 (34.44%), Postives = 86/151 (56.95%), Query Frame = 3
Query:  147 MIFRATSISFVFIFAISTIFAKDITHFKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
            M +R   +  +   A +     D   F DCGS+ G +  V + PC+ +PC + +GQ+ T++++F S  +  + KA VH +  G+P+PFP+P  D C+    +CPI     Y Y   L +K  YP+I++ + WEL+D   KDL C++FP+ +
Sbjct:    1 MDYRVLGVVLLSFLAYT---CADPVKFVDCGSVDGKVVQVDIKPCSQQPCKLHKGQSYTVNVTFSSGVESQTSKAVVHGVLAGVPVPFPIPIDDGCKS-GIQCPIVPQKPYNYVTELPVKTEYPAIKVVVEWELRDDSSKDLFCIKFPVQI 147          
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Zebrafish
Match: npc2 (Niemann-Pick disease, type C2 [Source:NCBI gene;Acc:282673])

HSP 1 Score: 111.309 bits (277), Expect = 1.362e-30
Identity = 52/151 (34.44%), Postives = 86/151 (56.95%), Query Frame = 3
Query:  147 MIFRATSISFVFIFAISTIFAKDITHFKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
            M +R   +  +   A +     D   F DCGS+ G +  V + PC+ +PC + +GQ+ T++++F S  +  + KA VH +  G+P+PFP+P  D C+    +CPI     Y Y   L +K  YP+I++ + WEL+D   KDL C++FP+ +
Sbjct:    1 MDYRVLGVVLLSFLAYT---CADPVKFVDCGSVDGKVVQVDIKPCSQQPCKLHKGQSYTVNVTFSSGVESQTSKAVVHGVLAGVPVPFPIPIDDGCKS-GIQCPIVPQKPYNYVTELPVKTEYPAIKVVVEWELRDDSSKDLFCIKFPVQI 147          
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Zebrafish
Match: zgc:193725 (zgc:193725 [Source:ZFIN;Acc:ZDB-GENE-080723-11])

HSP 1 Score: 110.923 bits (276), Expect = 2.330e-30
Identity = 51/151 (33.77%), Postives = 87/151 (57.62%), Query Frame = 3
Query:  147 MIFRATSISFVFIFAISTIFAKDITHFKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
            M +R  ++  +   A +     D   F DCGS+ G +  V + PC+ +PC + +GQ+ T++++F+S     + KA VH + + +P+PFP+P  D C+    +CPI     Y Y   L +K  YP+I++ + WEL+D   KDL C++FP+ +
Sbjct:    1 MDYRVLAVILLSFLAYT---CADPVKFVDCGSVHGKVVQVDIKPCSQQPCQLHKGQSYTVNVTFISSVASQTSKAVVHGVVECVPVPFPIPIDDGCKS-GIQCPIVPQKPYNYVTELPVKTEYPAIKVVVEWELRDDSSKDLFCIKFPVQI 147          
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Xenopus
Match: npc2 (Niemann-Pick disease, type C2 [Source:NCBI gene;Acc:493351])

HSP 1 Score: 108.227 bits (269), Expect = 4.053e-29
Identity = 53/125 (42.40%), Postives = 72/125 (57.60%), Query Frame = 3
Query:  225 FKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
            +KDCGS  G + T+ V PC  EPC + RG   T++ +FVS  +  S  A VH +  GI +PFP+  PD C+     CPI +G  Y Y   L IK  YP I+L ++W+LQD   KDL C   P+ +
Sbjct:   30 YKDCGSQSGKLVTLDVSPCPEEPCPLVRGSTYTVNATFVSNVNSKSASAVVHGIIAGIAVPFPISEPDGCKS-GISCPINSGQTYTYVTKLPIKSEYPCIKLVVKWQLQDENNKDLFCWLIPVHI 153          
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Mouse
Match: Npc2 (NPC intracellular cholesterol transporter 2 [Source:MGI Symbol;Acc:MGI:1915213])

HSP 1 Score: 111.694 bits (278), Expect = 1.076e-30
Identity = 52/126 (41.27%), Postives = 78/126 (61.90%), Query Frame = 3
Query:  222 HFKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
            HFKDCGS  G IK V+V PC ++PC + +GQ+ +++I+F S     +  A VH + +GI +PFP+P PD C+     CPI+    Y Y   L +K  YPSI+L + W+L+D  + +L C E P+ +
Sbjct:   23 HFKDCGSKVGVIKEVNVSPCPTDPCQLHKGQSYSVNITFTSGTQSQNSTALVHGILEGIRVPFPIPEPDGCKS-GINCPIQKDKVYSYLNKLPVKNEYPSIKLVVEWKLEDDKKNNLFCWEIPVQI 147          
BLAST of NPC intracellular cholesterol transporter 2 vs. UniProt/SwissProt
Match: sp|P61917|NPC2_PANTR (NPC intracellular cholesterol transporter 2 OS=Pan troglodytes OX=9598 GN=NPC2 PE=1 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 1.804e-32
Identity = 55/135 (40.74%), Postives = 81/135 (60.00%), Query Frame = 3
Query:  195 STIFAKDITHFKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
            ST    +   FKDCGS+ G IK V+V PC ++PC + +GQ+ +++++F S     S KA VH +  G+P+PFP+P PD C+     CPI+    Y Y   L +K  YPSI+L + W+LQD   + L C E P+ +
Sbjct:   14 STAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKS-GINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQI 147          
BLAST of NPC intracellular cholesterol transporter 2 vs. UniProt/SwissProt
Match: sp|P61918|NPC2_MACFA (NPC intracellular cholesterol transporter 2 OS=Macaca fascicularis OX=9541 GN=NPC2 PE=2 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 1.804e-32
Identity = 55/135 (40.74%), Postives = 81/135 (60.00%), Query Frame = 3
Query:  195 STIFAKDITHFKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
            ST    +   FKDCGS+ G IK V+V PC ++PC + +GQ+ +++++F S     S KA VH +  G+P+PFP+P PD C+     CPI+    Y Y   L +K  YPSI+L + W+LQD   + L C E P+ +
Sbjct:   14 STAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKS-GINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQI 147          
BLAST of NPC intracellular cholesterol transporter 2 vs. UniProt/SwissProt
Match: sp|P61916|NPC2_HUMAN (NPC intracellular cholesterol transporter 2 OS=Homo sapiens OX=9606 GN=NPC2 PE=1 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 1.804e-32
Identity = 55/135 (40.74%), Postives = 81/135 (60.00%), Query Frame = 3
Query:  195 STIFAKDITHFKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
            ST    +   FKDCGS+ G IK V+V PC ++PC + +GQ+ +++++F S     S KA VH +  G+P+PFP+P PD C+     CPI+    Y Y   L +K  YPSI+L + W+LQD   + L C E P+ +
Sbjct:   14 STAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKS-GINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQI 147          
BLAST of NPC intracellular cholesterol transporter 2 vs. UniProt/SwissProt
Match: sp|P79345|NPC2_BOVIN (NPC intracellular cholesterol transporter 2 OS=Bos taurus OX=9913 GN=NPC2 PE=1 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 2.511e-32
Identity = 57/149 (38.26%), Postives = 88/149 (59.06%), Query Frame = 3
Query:  153 FRATSISFVFIFAISTIFAKDITHFKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
             R  +++F+F+   ++  A+ +  FKDCGS  G IK V+V PC ++PC + RGQ+ +++++F S     S KA VH +  GIP+PFP+P  D C+    +CPI+    Y Y   L +K  YPSI++ + WEL D   +   C + PI V
Sbjct:    1 MRFLTVAFLFLALSASALAEPV-KFKDCGSWVGVIKEVNVSPCPTQPCKLHRGQSYSVNVTFTSNTQSQSSKAVVHGIVMGIPVPFPIPESDGCK-SGIRCPIEKDKTYNYVNKLPVKNEYPSIKVVVEWELTDDKNQRFFCWQIPIEV 147          
BLAST of NPC intracellular cholesterol transporter 2 vs. UniProt/SwissProt
Match: sp|Q9Z0J0|NPC2_MOUSE (NPC intracellular cholesterol transporter 2 OS=Mus musculus OX=10090 GN=Npc2 PE=1 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 7.527e-30
Identity = 52/126 (41.27%), Postives = 78/126 (61.90%), Query Frame = 3
Query:  222 HFKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
            HFKDCGS  G IK V+V PC ++PC + +GQ+ +++I+F S     +  A VH + +GI +PFP+P PD C+     CPI+    Y Y   L +K  YPSI+L + W+L+D  + +L C E P+ +
Sbjct:   23 HFKDCGSKVGVIKEVNVSPCPTDPCQLHKGQSYSVNITFTSGTQSQNSTALVHGILEGIRVPFPIPEPDGCKS-GINCPIQKDKVYSYLNKLPVKNEYPSIKLVVEWKLEDDKKNNLFCWEIPVQI 147          
BLAST of NPC intracellular cholesterol transporter 2 vs. TrEMBL
Match: A0A3Q0KU93 (ML domain-containing protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 3.169e-38
Identity = 62/145 (42.76%), Postives = 97/145 (66.90%), Query Frame = 3
Query:  177 VFIFAISTIFAKDITH---FKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCP-IKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
            + +  ++++    I H   F+DCGS  G + +++V PC+  PC + +GQN+TI+I F ++E    G   VH +   +PIPF L N +LC+F++P CP I +   Y ++YSL++K +YPSI LT+RWELQDS  +D+VCVEFP+ +
Sbjct:    1 MIVLWLASLVLVRIVHSEPFRDCGSKFGKLYSLTVTPCDRTPCALYKGQNATITIEFTTQETVKDGHISVHGVIAHVPIPFALDNSNLCEFVSPTCPLIPSIGKYTHTYSLYVKAMYPSISLTIRWELQDSSNEDIVCVEFPVQL 145          
BLAST of NPC intracellular cholesterol transporter 2 vs. TrEMBL
Match: Q5DFZ4 (Epididymal secretory protein E1 (Niemann Pick type C2 protein homolog) OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 1.628e-37
Identity = 62/134 (46.27%), Postives = 93/134 (69.40%), Query Frame = 3
Query:  201 IFAKDITHFKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCP-IKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
            I+  D   ++DCGS  GS+ +++V PC+  PC + +GQNSTI+I F +KE   +G   VH +   +P+PF L   DLC+F++P CP I +   Y ++YSL + K+YPSI LT+RWELQDS ++D++CVEFP+ +
Sbjct:   12 IYYVDAEPYRDCGSKIGSLISLTVTPCDKVPCALYKGQNSTITIEFSTKETVKNGHISVHGIIAHVPVPFVLDKSDLCEFVSPTCPLIPSIQKYTHTYSLHVNKMYPSISLTVRWELQDSSDEDVICVEFPVQL 145          
BLAST of NPC intracellular cholesterol transporter 2 vs. TrEMBL
Match: Q5DHY8 (Epididymal secretory protein E1 (Niemann Pick type C2 protein homolog) OS=Schistosoma japonicum OX=6182 GN=EWB00_006137 PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 2.157e-37
Identity = 62/134 (46.27%), Postives = 92/134 (68.66%), Query Frame = 3
Query:  201 IFAKDITHFKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCP-IKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
            I+  D   ++DCGS  GS+ +++V PC+  PC + +GQNSTI+I F +KE   +G   VH +   +P+PF L   DLC+F++P CP I +   Y ++YSL + K+YPSI LT+RWELQDS  +D++CVEFP+ +
Sbjct:   12 IYYVDAEPYRDCGSKIGSLISLTVTPCDKVPCALYKGQNSTITIEFSTKETVKNGHISVHGIIAHVPVPFVLDKSDLCEFVSPTCPLIPSIQKYTHTYSLHVNKMYPSISLTVRWELQDSSNEDVICVEFPVQL 145          
BLAST of NPC intracellular cholesterol transporter 2 vs. TrEMBL
Match: A0A369RZZ6 (Protein NPC2-like protein OS=Trichoplax sp. H2 OX=287889 GN=TrispH2_008298 PE=4 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 6.011e-37
Identity = 62/149 (41.61%), Postives = 99/149 (66.44%), Query Frame = 3
Query:  156 RATSISFVFI-FAISTIFAKDITHFKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
            +  + SF+FI   IS+ +A D   ++DCGS  G +K++S++PC S+PC ++RG N T++I+F   E     +A V  + +G+PIPFPLPNP+ C     KCP++  + YKY   + +KKIYP++ L +RWEL++S  K +VC++ P S+
Sbjct:    3 QGMASSFLFIILVISSCYALDNVRYRDCGSQVGKVKSLSINPCTSQPCILKRGTNVTVTINFSPSESIKKIQAVVFGVLEGVPIPFPLPNPNGCSNSGVKCPLEKSAMYKYHSIIPVKKIYPAVTLIVRWELKNSAGKKVVCLDIPASI 151          
BLAST of NPC intracellular cholesterol transporter 2 vs. TrEMBL
Match: B3RMY9 (ML domain-containing protein OS=Trichoplax adhaerens OX=10228 GN=TRIADDRAFT_37155 PE=4 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 7.875e-37
Identity = 62/144 (43.06%), Postives = 97/144 (67.36%), Query Frame = 3
Query:  171 SFVFI-FAISTIFAKDITHFKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
            SF+FI   IS+ +A D   ++DCGS  G +K++S++PC S+PC ++RG N T++I+F   E     +A V  + +G+PIPFPLPNP+ C     KCP++  + YKY   + +KKIYP++ L +RWEL++S  K +VC++ P S+
Sbjct:    4 SFLFIILVISSCYALDNVRYRDCGSQVGKVKSLSINPCTSQPCILKRGTNVTVTINFSPSESIKKIQAVVFGVLEGVPIPFPLPNPNGCSNSGVKCPLEKSAMYKYHSIIPVKKIYPAVTLIVRWELKNSAGKKVVCLDIPASI 147          
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Cavefish
Match: npc2 (Niemann-Pick disease, type C2 [Source:NCBI gene;Acc:282673])

HSP 1 Score: 113.235 bits (282), Expect = 2.103e-31
Identity = 50/123 (40.65%), Postives = 80/123 (65.04%), Query Frame = 3
Query:  225 FKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPI 593
            F DCGS++G +  V + PC ++PC + +G++ T++++F S  D  + KA VH +  G+P+P+P+PN D C+    +CPI+    Y Y   L +K  YPSI+L + WEL+D   KDL C++FP+
Sbjct:   24 FADCGSVEGKVSQVDISPCPTQPCELHKGKSYTVNVTF-SNVDSQTSKALVHGVIAGVPVPYPIPNEDGCKS-GIQCPIQKQKSYSYINELPVKAEYPSIKLVVEWELRDDSSKDLFCIKFPV 144          
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Cavefish
Match: npc2 (Niemann-Pick disease, type C2 [Source:NCBI gene;Acc:282673])

HSP 1 Score: 109.768 bits (273), Expect = 2.932e-30
Identity = 47/121 (38.84%), Postives = 78/121 (64.46%), Query Frame = 3
Query:  237 GSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
            GS++G +  V + PC ++PC + +G++ T++++F S  D  + KA VH +  G+P+P+P+PN D C+    +CPI+    Y Y   L +K  YPSI+L + WEL+D   KDL C++FP+ +
Sbjct:   15 GSVEGKVSQVDISPCPTQPCELHKGKSYTVNVTFSSDVDSQTSKALVHGVIAGVPVPYPIPNEDGCKS-GIQCPIQKQKSYSYINELPVKAEYPSIKLVVEWELRDDSSKDLFCIKFPVQI 134          
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008656.1 (pep scaffold:Pmarinus_7.0:GL477843:35666:38308:1 gene:ENSPMAG00000007827.1 transcript:ENSPMAT00000008656.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.7525 bits (247), Expect = 5.839e-27
Identity = 48/121 (39.67%), Postives = 70/121 (57.85%), Query Frame = 3
Query:  237 GSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
            GS  G I  V++ PC ++PC + + +   I+++F S  +     A VH +  GIPIPFP+PN D C+     CPI     Y Y   L +K  YPSI+L ++WEL+D    DL C EFP+++
Sbjct:   21 GSQTGKISAVNIIPCPTQPCILCKDKTYNINVTFTSDTESQGSTAVVHGILAGIPIPFPIPNNDGCK-SGITCPIAKNQAYIYDVGLPVKSDYPSIKLVVKWELRDDKANDLFCFEFPVAI 140          
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006312.1 (pep scaffold:Pmarinus_7.0:GL476404:451273:452406:-1 gene:ENSPMAG00000005702.1 transcript:ENSPMAT00000006312.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.6766 bits (117), Expect = 1.346e-8
Identity = 25/82 (30.49%), Postives = 43/82 (52.44%), Query Frame = 3
Query:  357 TSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLF-IKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
             +  A VH++  G P+ F +P  D C+    + P + G   +       +K  YP+I+L  +W+L+D   KDL C +FP+ +
Sbjct:    6 NTATAVVHSIVAGFPVRFSIPQSDGCK-SGLRLPARRGPRLQLRRQGAPVKSSYPNIKLVEKWQLKDDNGKDLFCFKFPVKI 86          
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Nematostella
Match: EDO30774 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZV1])

HSP 1 Score: 125.946 bits (315), Expect = 7.851e-37
Identity = 57/127 (44.88%), Postives = 84/127 (66.14%), Query Frame = 3
Query:  225 FKDCGSIKGSIKTVSVD--PCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
            FKDC   KG  + V +D  PC ++PCT+ +G   +++I+FV      SGKA VH +  GIP+PFPLPN D+C+    KCP++ G+ Y Y  SL +K +YPS++L +RWE+QD+  KD++C E P  +
Sbjct:   20 FKDCSGGKGEGEIVELDISPCPTQPCTLHKGTTVSVNITFVPHVTLDSGKAIVHGVIAGIPVPFPLPNADVCKNSGLKCPLEPGTKYVYQSSLEVKTMYPSLKLVVRWEIQDNKNKDVLCFEIPTQI 146          
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Nematostella
Match: EDO35255 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM29])

HSP 1 Score: 104.76 bits (260), Expect = 1.677e-28
Identity = 50/141 (35.46%), Postives = 85/141 (60.28%), Query Frame = 3
Query:  177 VFIFAISTIFAKDITHFKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
            + +F +    AK +  F+DCGS KG + +V + PC+S+PC I+RG N++  I+F+  E  TS K   +A+   IP+P PLPN D C+     CP+K+G   +  +  +I + +P+  LTL+ EL+D     ++C + P+++
Sbjct:    9 ILLFLLCEARAKKV-KFQDCGSKKGELISVDLTPCSSDPCVIKRGANASGVITFIPHEVVTSSKVLAYAIFGLIPVPLPLPNSDGCKGYGLTCPLKSGKQVELVFEHYIDQTFPTGHLTLKAELKDQDSDVVICGKIPMTL 148          
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Nematostella
Match: EDO43439 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYC7])

HSP 1 Score: 84.7297 bits (208), Expect = 4.622e-21
Identity = 42/126 (33.33%), Postives = 69/126 (54.76%), Query Frame = 3
Query:  225 FKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLV-CVEFPISV 599
            ++DCGS +G I  + + PC+SEPC ++RG +   S++F+  ED    K   HA+ D +P+P P+P+ D CQ     CP+ +G    +     I+  +P   LTL+  + DS    +V C E  + +
Sbjct:   12 YRDCGSQEGEIVGMDISPCDSEPCVLKRGTSVDGSLTFIPHEDLKRAKLSAHAIIDKLPLPLPIPS-DACQGYGLSCPVDSGVKSMFKIHQAIESEFPVGNLTLKAAVTDSDTSQVVFCFEVDLEI 136          
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Medaka
Match: npc2 (NPC intracellular cholesterol transporter 2 [Source:NCBI gene;Acc:111946828])

HSP 1 Score: 116.701 bits (291), Expect = 1.065e-32
Identity = 50/125 (40.00%), Postives = 77/125 (61.60%), Query Frame = 3
Query:  225 FKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
            F DCGS  G +  V ++PC ++PC + RG + T++++F S  +  +  A VH +  G+PIPFP+P PD C+    +CPI  G  Y Y+  L +K  YP I+L + WEL+D  + DL C+ FP+ +
Sbjct:   25 FVDCGSSSGKVAMVDINPCTAQPCQLHRGDSYTVNVTFNSDVESQTSTAVVHGIIAGVPIPFPIPEPDGCKS-GIQCPIHKGQAYNYATQLPVKSEYPPIKLVVEWELKDDNKNDLFCIRFPVQI 148          
BLAST of NPC intracellular cholesterol transporter 2 vs. Planmine SMEST
Match: SMESG000023323.1 (SMESG000023323.1)

HSP 1 Score: 306.22 bits (783), Expect = 1.973e-107
Identity = 151/151 (100.00%), Postives = 151/151 (100.00%), Query Frame = 3
Query:  147 MIFRATSISFVFIFAISTIFAKDITHFKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
            MIFRATSISFVFIFAISTIFAKDITHFKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV
Sbjct:    1 MIFRATSISFVFIFAISTIFAKDITHFKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 151          
BLAST of NPC intracellular cholesterol transporter 2 vs. Planmine SMEST
Match: SMESG000031800.1 (SMESG000031800.1)

HSP 1 Score: 133.65 bits (335), Expect = 2.015e-39
Identity = 62/144 (43.06%), Postives = 94/144 (65.28%), Query Frame = 3
Query:  168 ISFVFIFAISTIFAKDITHFKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
            IS + +  IS  F +  T + DCGS KG +++V + PCN+ PC + +G   +I+I + S ED +SGK  VH       +PFPLP+ DLC+F  P CPIK+ ++  Y+ ++ I+KIYPS+R+T+ WEL D    D+VCV+FP ++
Sbjct:    4 ISLIALSVISWSFVEP-TVYLDCGSKKGQVQSVEISPCNTNPCQLVKGTKPSITIKYKSNEDVSSGKVSVHGKVGIFNVPFPLPDNDLCKFSTPNCPIKSQTNVTYTNTIEIRKIYPSLRVTITWELVDGQGNDIVCVKFPAAI 146          
BLAST of NPC intracellular cholesterol transporter 2 vs. Planmine SMEST
Match: SMESG000031788.1 (SMESG000031788.1)

HSP 1 Score: 129.413 bits (324), Expect = 7.553e-38
Identity = 60/145 (41.38%), Postives = 90/145 (62.07%), Query Frame = 3
Query:  174 FVFIFAISTIF---AKDITHFKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPISV 599
             V +FA+ TIF   +   T + DCGS  G +++V + PCN +PC +++G    ++I + + ED  SG   VH     I +PFPLP+ DLC+F +P CPI TG +  YS S+ +   YP+IRLT++WEL D    DL+C+ FP ++
Sbjct:    2 IVIVFAVFTIFNTISAAPTVYLDCGSKGGKVESVDITPCNEQPCQLKKGTTPQLTIKYKALEDTKSGTVSVHGKIGPIFVPFPLPDSDLCKFSSPACPITTGEEVTYSNSITVLSSYPAIRLTVKWELVDDQGNDLICITFPAAI 146          
BLAST of NPC intracellular cholesterol transporter 2 vs. Planmine SMEST
Match: SMESG000031796.1 (SMESG000031796.1)

HSP 1 Score: 50.8322 bits (120), Expect = 5.449e-8
Identity = 35/140 (25.00%), Postives = 62/140 (44.29%), Query Frame = 3
Query:  165 SISFVFIFAISTIFAKDITHFKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKY-SYSLFIKKIYPSIRLTLRWELQDSLEKDLVCV 581
            +I FV +F  +  FA +   F +C +    I++V VDPC+   C +       I + F +  +   GK  +           PL   +LC   + KCPI  G+D  + S   F+      +R+ ++ +  D   K++ C+
Sbjct:    5 AIYFV-LFQYALAFAPN---FFECTNNGHVIQSVEVDPCSDRQCKLLSQTEMQIKVKFTANRNINFGKVALTVTALPSIFAMPLKEDNLCLSSDSKCPIAKGADVTHTSKYTFLGGFPDGVRVIMQLKANDEKNKEIYCM 140          
BLAST of NPC intracellular cholesterol transporter 2 vs. Planmine SMEST
Match: SMESG000031795.1 (SMESG000031795.1)

HSP 1 Score: 49.6766 bits (117), Expect = 1.440e-7
Identity = 28/121 (23.14%), Postives = 54/121 (44.63%), Query Frame = 3
Query:  222 HFKDCGSIKGSIKTVSVDPCNSEPCTIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLNPKCPIKTGSDYKY-SYSLFIKKIYPSIRLTLRWELQDSLEKDLVCV 581
            +F +C      I++V VDPC+   C +       I + F++  +   GK  +           PL   +LC   + KCPI  G+D  + S   F+      +++ ++ ++ D   K++ C+
Sbjct:   20 YFFECTDSGPVIQSVEVDPCSDRQCKLLSQTEMQIKVKFIANRNINLGKVALTVTALPRIFAMPLKEDNLCLSSDSKCPIAKGADVTHTSKYTFLGGFPDGVQVNMQLKVNDEKNKEIYCM 140          
The following BLAST results are available for this feature:
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPC22.661e-3341.79NPC intracellular cholesterol transporter 2 [Sourc... [more]
NPC23.757e-3340.74NPC intracellular cholesterol transporter 2 [Sourc... [more]
NPC25.735e-3340.74NPC intracellular cholesterol transporter 2 [Sourc... [more]
NPC21.660e-3240.74NPC intracellular cholesterol transporter 2 [Sourc... [more]
NPC21.891e-3240.74NPC intracellular cholesterol transporter 2 [Sourc... [more]
back to top
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Npc2a2.961e-2635.25gene:FBgn0031381 transcript:FBtr0077816[more]
Npc2g6.048e-825.64gene:FBgn0039800 transcript:FBtr0306293[more]
Npc2g6.048e-825.64gene:FBgn0039800 transcript:FBtr0085723[more]
Npc2b2.680e-723.23gene:FBgn0038198 transcript:FBtr0082888[more]
Npc2b2.680e-723.23gene:FBgn0038198 transcript:FBtr0082889[more]
back to top
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
npc21.362e-3034.44Niemann-Pick disease, type C2 [Source:NCBI gene;Ac... [more]
npc21.362e-3034.44Niemann-Pick disease, type C2 [Source:NCBI gene;Ac... [more]
zgc:1937252.330e-3033.77zgc:193725 [Source:ZFIN;Acc:ZDB-GENE-080723-11][more]
back to top
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
npc24.053e-2942.40Niemann-Pick disease, type C2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Npc21.076e-3041.27NPC intracellular cholesterol transporter 2 [Sourc... [more]
back to top
BLAST of NPC intracellular cholesterol transporter 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P61917|NPC2_PANTR1.804e-3240.74NPC intracellular cholesterol transporter 2 OS=Pan... [more]
sp|P61918|NPC2_MACFA1.804e-3240.74NPC intracellular cholesterol transporter 2 OS=Mac... [more]
sp|P61916|NPC2_HUMAN1.804e-3240.74NPC intracellular cholesterol transporter 2 OS=Hom... [more]
sp|P79345|NPC2_BOVIN2.511e-3238.26NPC intracellular cholesterol transporter 2 OS=Bos... [more]
sp|Q9Z0J0|NPC2_MOUSE7.527e-3041.27NPC intracellular cholesterol transporter 2 OS=Mus... [more]
back to top
BLAST of NPC intracellular cholesterol transporter 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KU933.169e-3842.76ML domain-containing protein OS=Schistosoma manson... [more]
Q5DFZ41.628e-3746.27Epididymal secretory protein E1 (Niemann Pick type... [more]
Q5DHY82.157e-3746.27Epididymal secretory protein E1 (Niemann Pick type... [more]
A0A369RZZ66.011e-3741.61Protein NPC2-like protein OS=Trichoplax sp. H2 OX=... [more]
B3RMY97.875e-3743.06ML domain-containing protein OS=Trichoplax adhaere... [more]
back to top
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
npc22.103e-3140.65Niemann-Pick disease, type C2 [Source:NCBI gene;Ac... [more]
npc22.932e-3038.84Niemann-Pick disease, type C2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000008656.15.839e-2739.67pep scaffold:Pmarinus_7.0:GL477843:35666:38308:1 g... [more]
ENSPMAT00000006312.11.346e-830.49pep scaffold:Pmarinus_7.0:GL476404:451273:452406:-... [more]
back to top
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO307747.851e-3744.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352551.677e-2835.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434394.622e-2133.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NPC intracellular cholesterol transporter 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
npc21.065e-3240.00NPC intracellular cholesterol transporter 2 [Sourc... [more]
back to top
BLAST of NPC intracellular cholesterol transporter 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023323.11.973e-107100.00SMESG000023323.1[more]
SMESG000031800.12.015e-3943.06SMESG000031800.1[more]
SMESG000031788.17.553e-3841.38SMESG000031788.1[more]
SMESG000031796.15.449e-825.00SMESG000031796.1[more]
SMESG000031795.11.440e-723.14SMESG000031795.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020662 ID=SMED30020662|Name=NPC intracellular cholesterol transporter 2|organism=Schmidtea mediterranea sexual|type=transcript|length=690bp
CTCTGTTTATAATATCTAAAACGTGAACATCATGTAACATAATATGTCAT
TACAGAGGTCAATAAGGTGACCTTTGACCAAGAAACCTCGTTCGACCACT
TTCAAATATAAAGTCATTTATATCAAGATTCACATAGTTTAACAAAATGA
TATTTCGAGCAACTTCAATTTCATTCGTTTTTATCTTTGCAATTTCAACG
ATATTTGCCAAGGATATAACTCATTTCAAAGACTGTGGATCCATCAAAGG
CTCGATTAAAACCGTATCCGTAGATCCTTGTAATTCTGAACCATGCACAA
TACAAAGAGGTCAAAATTCAACGATTTCAATTAGCTTTGTGTCAAAGGAG
GATTGCACTTCAGGAAAAGCCAAAGTTCATGCATTGAAAGACGGTATTCC
TATTCCTTTTCCTCTACCAAATCCCGACCTCTGCCAATTTTTGAATCCAA
AATGCCCAATTAAAACGGGATCAGACTACAAATACAGTTATAGTTTATTT
ATTAAGAAAATATATCCATCTATTCGCCTTACACTTCGTTGGGAACTGCA
AGACAGCTTGGAAAAAGATCTTGTTTGTGTCGAATTTCCTATTTCGGTTA
TTTAACTTATTTTATTACACATTTTATTGATTTTTAACTTTGAAAAAACA
TTAATCTTTGAATAAAAATATTGAGTTTATTAAAAAAAAA
back to top

protein sequence of SMED30020662-orf-1

>SMED30020662-orf-1 ID=SMED30020662-orf-1|Name=SMED30020662-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=153bp
MIFRATSISFVFIFAISTIFAKDITHFKDCGSIKGSIKTVSVDPCNSEPC
TIQRGQNSTISISFVSKEDCTSGKAKVHALKDGIPIPFPLPNPDLCQFLN
PKCPIKTGSDYKYSYSLFIKKIYPSIRLTLRWELQDSLEKDLVCVEFPIS
VI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005615extracellular space
GO:0005764lysosome
GO:0005783endoplasmic reticulum
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0006629lipid metabolic process
GO:0006869lipid transport
GO:0008202steroid metabolic process
GO:0008203cholesterol metabolic process
GO:0030301cholesterol transport
GO:0033344cholesterol efflux
GO:0032367intracellular cholesterol transport
Vocabulary: molecular function
TermDefinition
GO:0015485cholesterol binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR039670NPC2-like
IPR033916ML_Npc2-like
IPR003172ML_dom
IPR014756Ig_E-set
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003172MD-2-related lipid-recognition domainSMARTSM00737pgtp_13coord: 27..149
e-value: 5.0E-36
score: 135.7
IPR003172MD-2-related lipid-recognition domainPFAMPF02221E1_DerP2_DerF2coord: 26..151
e-value: 5.7E-28
score: 98.0
NoneNo IPR availableGENE3DG3DSA:2.60.40.770coord: 23..152
e-value: 5.2E-45
score: 154.8
NoneNo IPR availablePANTHERPTHR11306:SF30NPC INTRACELLULAR CHOLESTEROL TRANSPORTER 2coord: 7..151
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.793
IPR039670Sterol transport protein NPC2-likePANTHERPTHR11306NIEMANN PICK TYPE C2 PROTEIN NPC2-RELATEDcoord: 7..151
IPR033916Npc2 like, ML domainCDDcd00916Npc2_likecoord: 27..149
e-value: 3.64496E-41
score: 132.047
IPR014756Immunoglobulin E-setSUPERFAMILYSSF81296E set domainscoord: 24..151