Metabotropic glutamate receptor

Overview
NameMetabotropic glutamate receptor
Smed IDSMED30020660
Length (bp)1769
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Metabotropic glutamate receptor (SMED30020660) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Metabotropic glutamate receptor (SMED30020660) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020660

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30020660SMESG000024379.1 SmedASXL_033773SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30020660SMESG000024379.1 dd_Smed_v6_27213_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30020660SMESG000024379.1 dd_Smed_v6_91452_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30020660SMESG000024379.1 dd_Smed_v6_96186_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30020660SMESG000024379.1 Contig29699newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30020660SMESG000024379.1 Contig29699uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Metabotropic glutamate receptor vs. Ensembl Human
Match: GRM3 (glutamate metabotropic receptor 3 [Source:HGNC Symbol;Acc:HGNC:4595])

HSP 1 Score: 258.84 bits (660), Expect = 2.025e-75
Identity = 147/378 (38.89%), Postives = 227/378 (60.05%), Query Frame = 1
Query:  106 DGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMD-PAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELN 1236
            DG  RY + NFQ +  G Y ++ +G +    L +D   + + +NS  +P S C+  C  ++     PG   CWICI C+ Y+ L    T C+ C  GQ P  + TGC ++ + Y+      A+G +    +G  C   VV +FIK  N+P+V+AS REL +ILLFG+ + + MT     KP+   C++ +  +G SF++CYSALL KTN I RIF   +   +R   ISP SQ+ +C  ++L+QIV++S+WL ++ P    +   E+ E  ++   +K SS LI L + +IL+++CTVY F TR  PE +NE+K IGF MY+TC++WL F+P ++ T+    ++  T+C+S+ LS  V L CLF PK++IILF+ + N
Sbjct:  461 DGMGRYNVFNFQNVG-GKYSYLKVGHWAET-LSLDVNSIHWSRNS--VPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYLADEFT-CMDCGSGQWPTADLTGCYDLPEDYIRWEDAWAIGPVTIACLGFMCTCMVVTVFIKHNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPVICALRRLGLGSSFAICYSALLTKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWLILEAPGTRRYTLAEKRETVILKCNVKDSSMLISLTYDVILVILCTVYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIILFQPQKN 833          
BLAST of Metabotropic glutamate receptor vs. Ensembl Human
Match: GRM7 (glutamate metabotropic receptor 7 [Source:HGNC Symbol;Acc:HGNC:4599])

HSP 1 Score: 231.491 bits (589), Expect = 9.438e-67
Identity = 152/418 (36.36%), Postives = 233/418 (55.74%), Query Frame = 1
Query:   70 SGMNFSFWKPGYDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHY-------PERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLT---HLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMNSLRIGTKSS 1293
            +G    F K G D P RY I  +Q       G+  IG++  ++L ++   +++ K    IP S CT  C+  QR K   G   CW C  C  Y       T C  C   Q P++N+TGC +I    LE +SP A+  +    +GI     V+  FI++ ++PIVRAS RELS++LL GI +C+++T ++  KP    CS  +  +GL   + Y+ALL KTNRI RIF +G+++V     ISP SQ+++   ++ +Q++ + +W  +DP   I  Y       PE+    L C+ I     +  L + ++L++ CTVY   TR +PE +NE+K IGF MY+TC+VWL FIP +F TA+     +++  TL +S++LSA V L  L+ PK+YII+F  ELN ++  +     +   T SS
Sbjct:  216 AGTPVMFNKNG-DAPGRYDIFQYQTTNTSNPGYRLIGQW-TDELQLNIEDMQWGKGVREIPASVCTLPCKPGQRKKTQKGTPCCWTCEPCDGYQYQFDEMT-CQHCPYDQRPNENRTGCQDIPIIKLEWHSPWAVIPVFLAMLGIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMIAKPDVAVCSFRRVFLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLAITSSLISVQLLGVFIWFGVDPPNIIIDYDEHKTMNPEQARGVLKCD-ITDLQIICSLGYSILLMVTCTVYAIKTRGVPENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLSASVALGMLYMPKVYIIIFHPELNVQKRKRSFKAVVTAATMSS 629          
BLAST of Metabotropic glutamate receptor vs. Ensembl Human
Match: GRM7 (glutamate metabotropic receptor 7 [Source:HGNC Symbol;Acc:HGNC:4599])

HSP 1 Score: 231.876 bits (590), Expect = 1.631e-65
Identity = 152/418 (36.36%), Postives = 233/418 (55.74%), Query Frame = 1
Query:   70 SGMNFSFWKPGYDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHY-------PERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLT---HLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMNSLRIGTKSS 1293
            +G    F K G D P RY I  +Q       G+  IG++  ++L ++   +++ K    IP S CT  C+  QR K   G   CW C  C  Y       T C  C   Q P++N+TGC +I    LE +SP A+  +    +GI     V+  FI++ ++PIVRAS RELS++LL GI +C+++T ++  KP    CS  +  +GL   + Y+ALL KTNRI RIF +G+++V     ISP SQ+++   ++ +Q++ + +W  +DP   I  Y       PE+    L C+ I     +  L + ++L++ CTVY   TR +PE +NE+K IGF MY+TC+VWL FIP +F TA+     +++  TL +S++LSA V L  L+ PK+YII+F  ELN ++  +     +   T SS
Sbjct:  461 AGTPVMFNKNG-DAPGRYDIFQYQTTNTSNPGYRLIGQW-TDELQLNIEDMQWGKGVREIPASVCTLPCKPGQRKKTQKGTPCCWTCEPCDGYQYQFDEMT-CQHCPYDQRPNENRTGCQDIPIIKLEWHSPWAVIPVFLAMLGIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMIAKPDVAVCSFRRVFLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLAITSSLISVQLLGVFIWFGVDPPNIIIDYDEHKTMNPEQARGVLKCD-ITDLQIICSLGYSILLMVTCTVYAIKTRGVPENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLSASVALGMLYMPKVYIIIFHPELNVQKRKRSFKAVVTAATMSS 874          
BLAST of Metabotropic glutamate receptor vs. Ensembl Human
Match: GRM7 (glutamate metabotropic receptor 7 [Source:HGNC Symbol;Acc:HGNC:4599])

HSP 1 Score: 231.876 bits (590), Expect = 1.801e-65
Identity = 152/418 (36.36%), Postives = 233/418 (55.74%), Query Frame = 1
Query:   70 SGMNFSFWKPGYDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHY-------PERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLT---HLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMNSLRIGTKSS 1293
            +G    F K G D P RY I  +Q       G+  IG++  ++L ++   +++ K    IP S CT  C+  QR K   G   CW C  C  Y       T C  C   Q P++N+TGC +I    LE +SP A+  +    +GI     V+  FI++ ++PIVRAS RELS++LL GI +C+++T ++  KP    CS  +  +GL   + Y+ALL KTNRI RIF +G+++V     ISP SQ+++   ++ +Q++ + +W  +DP   I  Y       PE+    L C+ I     +  L + ++L++ CTVY   TR +PE +NE+K IGF MY+TC+VWL FIP +F TA+     +++  TL +S++LSA V L  L+ PK+YII+F  ELN ++  +     +   T SS
Sbjct:  461 AGTPVMFNKNG-DAPGRYDIFQYQTTNTSNPGYRLIGQW-TDELQLNIEDMQWGKGVREIPASVCTLPCKPGQRKKTQKGTPCCWTCEPCDGYQYQFDEMT-CQHCPYDQRPNENRTGCQDIPIIKLEWHSPWAVIPVFLAMLGIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMIAKPDVAVCSFRRVFLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLAITSSLISVQLLGVFIWFGVDPPNIIIDYDEHKTMNPEQARGVLKCD-ITDLQIICSLGYSILLMVTCTVYAIKTRGVPENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLSASVALGMLYMPKVYIIIFHPELNVQKRKRSFKAVVTAATMSS 874          
BLAST of Metabotropic glutamate receptor vs. Ensembl Human
Match: GRM7 (glutamate metabotropic receptor 7 [Source:HGNC Symbol;Acc:HGNC:4599])

HSP 1 Score: 231.876 bits (590), Expect = 1.964e-65
Identity = 152/418 (36.36%), Postives = 233/418 (55.74%), Query Frame = 1
Query:   70 SGMNFSFWKPGYDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHY-------PERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLT---HLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMNSLRIGTKSS 1293
            +G    F K G D P RY I  +Q       G+  IG++  ++L ++   +++ K    IP S CT  C+  QR K   G   CW C  C  Y       T C  C   Q P++N+TGC +I    LE +SP A+  +    +GI     V+  FI++ ++PIVRAS RELS++LL GI +C+++T ++  KP    CS  +  +GL   + Y+ALL KTNRI RIF +G+++V     ISP SQ+++   ++ +Q++ + +W  +DP   I  Y       PE+    L C+ I     +  L + ++L++ CTVY   TR +PE +NE+K IGF MY+TC+VWL FIP +F TA+     +++  TL +S++LSA V L  L+ PK+YII+F  ELN ++  +     +   T SS
Sbjct:  461 AGTPVMFNKNG-DAPGRYDIFQYQTTNTSNPGYRLIGQW-TDELQLNIEDMQWGKGVREIPASVCTLPCKPGQRKKTQKGTPCCWTCEPCDGYQYQFDEMT-CQHCPYDQRPNENRTGCQDIPIIKLEWHSPWAVIPVFLAMLGIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMIAKPDVAVCSFRRVFLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLAITSSLISVQLLGVFIWFGVDPPNIIIDYDEHKTMNPEQARGVLKCD-ITDLQIICSLGYSILLMVTCTVYAIKTRGVPENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLSASVALGMLYMPKVYIIIFHPELNVQKRKRSFKAVVTAATMSS 874          
BLAST of Metabotropic glutamate receptor vs. Ensembl Celegans
Match: mgl-1 (Probable metabotropic glutamate receptor mgl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09630])

HSP 1 Score: 238.039 bits (606), Expect = 2.082e-68
Identity = 152/420 (36.19%), Postives = 236/420 (56.19%), Query Frame = 1
Query:   58 FICLSGMNFSFWKPGYDGPPRYKILNFQ-------------KIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQS---YLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTR-QGMKPMMN 1266
            F  + G  F F  P  DGP  Y IL ++             +  P  Y  ++IG +  N L I  + L +  + T  P+S C+  C+   R +       CW C +C+ Y+ L   +T C+ CE G  P K++ GC +++ S   Y+   S  +L   +    GI     V+++++ +  +P+V+AS RELS+ILL  ++MC+ MT +L +KP+   C+I++  IG +FS  YSA+ VKTNRI RIF     + +R   ISP+SQ+ M  ++  +Q++   +WL + P    HHYP R +  L CN +    FL  L +   LI++CT Y   TR +PE +NE+K IGF+MY+TCVVWL +I  +F T     ++ ++LC+SI +SA V L C+F PK++IILF++  N R Q  + M+N
Sbjct:  399 FTDIVGKRFRF-SPQGDGPASYTILTYKPKSMDKKRRMTDDESSPSDY--VEIGHWSENNLTIYEKNLWWDPDHT--PVSVCSLPCKIGFRKQLIKDEQCCWACSKCEDYEYLIN-ETHCVGCEQGWWPTKDRKGCFDLSLSQLKYMRWRSMYSLVPTILAVFGIIATLFVIVVYVIYNETPVVKASGRELSYILLISMIMCYCMTFVLLSKPSAIVCAIKRTGIGFAFSCLYSAMFVKTNRIFRIFSTR--SAQRPRFISPISQVVMTAMLAGVQLIGSLIWLSVVPPGWRHHYPTRDQVVLTCN-VPDHHFLYSLAYDGFLIVLCTTYAVKTRKVPENFNETKFIGFSMYTTCVVWLSWIFFFFGTGSDFQIQTSSLCISISMSANVALACIFSPKLWIILFEKHKNVRKQEGESMLN 809          
BLAST of Metabotropic glutamate receptor vs. Ensembl Celegans
Match: mgl-1 (Probable metabotropic glutamate receptor mgl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09630])

HSP 1 Score: 238.039 bits (606), Expect = 2.082e-68
Identity = 152/420 (36.19%), Postives = 236/420 (56.19%), Query Frame = 1
Query:   58 FICLSGMNFSFWKPGYDGPPRYKILNFQ-------------KIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQS---YLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTR-QGMKPMMN 1266
            F  + G  F F  P  DGP  Y IL ++             +  P  Y  ++IG +  N L I  + L +  + T  P+S C+  C+   R +       CW C +C+ Y+ L   +T C+ CE G  P K++ GC +++ S   Y+   S  +L   +    GI     V+++++ +  +P+V+AS RELS+ILL  ++MC+ MT +L +KP+   C+I++  IG +FS  YSA+ VKTNRI RIF     + +R   ISP+SQ+ M  ++  +Q++   +WL + P    HHYP R +  L CN +    FL  L +   LI++CT Y   TR +PE +NE+K IGF+MY+TCVVWL +I  +F T     ++ ++LC+SI +SA V L C+F PK++IILF++  N R Q  + M+N
Sbjct:  399 FTDIVGKRFRF-SPQGDGPASYTILTYKPKSMDKKRRMTDDESSPSDY--VEIGHWSENNLTIYEKNLWWDPDHT--PVSVCSLPCKIGFRKQLIKDEQCCWACSKCEDYEYLIN-ETHCVGCEQGWWPTKDRKGCFDLSLSQLKYMRWRSMYSLVPTILAVFGIIATLFVIVVYVIYNETPVVKASGRELSYILLISMIMCYCMTFVLLSKPSAIVCAIKRTGIGFAFSCLYSAMFVKTNRIFRIFSTR--SAQRPRFISPISQVVMTAMLAGVQLIGSLIWLSVVPPGWRHHYPTRDQVVLTCN-VPDHHFLYSLAYDGFLIVLCTTYAVKTRKVPENFNETKFIGFSMYTTCVVWLSWIFFFFGTGSDFQIQTSSLCISISMSANVALACIFSPKLWIILFEKHKNVRKQEGESMLN 809          
BLAST of Metabotropic glutamate receptor vs. Ensembl Celegans
Match: mgl-1 (Probable metabotropic glutamate receptor mgl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09630])

HSP 1 Score: 238.039 bits (606), Expect = 5.292e-68
Identity = 152/420 (36.19%), Postives = 236/420 (56.19%), Query Frame = 1
Query:   58 FICLSGMNFSFWKPGYDGPPRYKILNFQ-------------KIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQS---YLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTR-QGMKPMMN 1266
            F  + G  F F  P  DGP  Y IL ++             +  P  Y  ++IG +  N L I  + L +  + T  P+S C+  C+   R +       CW C +C+ Y+ L   +T C+ CE G  P K++ GC +++ S   Y+   S  +L   +    GI     V+++++ +  +P+V+AS RELS+ILL  ++MC+ MT +L +KP+   C+I++  IG +FS  YSA+ VKTNRI RIF     + +R   ISP+SQ+ M  ++  +Q++   +WL + P    HHYP R +  L CN +    FL  L +   LI++CT Y   TR +PE +NE+K IGF+MY+TCVVWL +I  +F T     ++ ++LC+SI +SA V L C+F PK++IILF++  N R Q  + M+N
Sbjct:  474 FTDIVGKRFRF-SPQGDGPASYTILTYKPKSMDKKRRMTDDESSPSDY--VEIGHWSENNLTIYEKNLWWDPDHT--PVSVCSLPCKIGFRKQLIKDEQCCWACSKCEDYEYLIN-ETHCVGCEQGWWPTKDRKGCFDLSLSQLKYMRWRSMYSLVPTILAVFGIIATLFVIVVYVIYNETPVVKASGRELSYILLISMIMCYCMTFVLLSKPSAIVCAIKRTGIGFAFSCLYSAMFVKTNRIFRIFSTR--SAQRPRFISPISQVVMTAMLAGVQLIGSLIWLSVVPPGWRHHYPTRDQVVLTCN-VPDHHFLYSLAYDGFLIVLCTTYAVKTRKVPENFNETKFIGFSMYTTCVVWLSWIFFFFGTGSDFQIQTSSLCISISMSANVALACIFSPKLWIILFEKHKNVRKQEGESMLN 884          
BLAST of Metabotropic glutamate receptor vs. Ensembl Celegans
Match: mgl-1 (Probable metabotropic glutamate receptor mgl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09630])

HSP 1 Score: 237.269 bits (604), Expect = 9.848e-68
Identity = 152/420 (36.19%), Postives = 236/420 (56.19%), Query Frame = 1
Query:   58 FICLSGMNFSFWKPGYDGPPRYKILNFQ-------------KIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQS---YLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTR-QGMKPMMN 1266
            F  + G  F F  P  DGP  Y IL ++             +  P  Y  ++IG +  N L I  + L +  + T  P+S C+  C+   R +       CW C +C+ Y+ L   +T C+ CE G  P K++ GC +++ S   Y+   S  +L   +    GI     V+++++ +  +P+V+AS RELS+ILL  ++MC+ MT +L +KP+   C+I++  IG +FS  YSA+ VKTNRI RIF     + +R   ISP+SQ+ M  ++  +Q++   +WL + P    HHYP R +  L CN +    FL  L +   LI++CT Y   TR +PE +NE+K IGF+MY+TCVVWL +I  +F T     ++ ++LC+SI +SA V L C+F PK++IILF++  N R Q  + M+N
Sbjct:  485 FTDIVGKRFRF-SPQGDGPASYTILTYKPKSMDKKRRMTDDESSPSDY--VEIGHWSENNLTIYEKNLWWDPDHT--PVSVCSLPCKIGFRKQLIKDEQCCWACSKCEDYEYLIN-ETHCVGCEQGWWPTKDRKGCFDLSLSQLKYMRWRSMYSLVPTILAVFGIIATLFVIVVYVIYNETPVVKASGRELSYILLISMIMCYCMTFVLLSKPSAIVCAIKRTGIGFAFSCLYSAMFVKTNRIFRIFSTR--SAQRPRFISPISQVVMTAMLAGVQLIGSLIWLSVVPPGWRHHYPTRDQVVLTCN-VPDHHFLYSLAYDGFLIVLCTTYAVKTRKVPENFNETKFIGFSMYTTCVVWLSWIFFFFGTGSDFQIQTSSLCISISMSANVALACIFSPKLWIILFEKHKNVRKQEGESMLN 895          
BLAST of Metabotropic glutamate receptor vs. Ensembl Celegans
Match: mgl-1 (Probable metabotropic glutamate receptor mgl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09630])

HSP 1 Score: 237.269 bits (604), Expect = 1.129e-67
Identity = 152/420 (36.19%), Postives = 236/420 (56.19%), Query Frame = 1
Query:   58 FICLSGMNFSFWKPGYDGPPRYKILNFQ-------------KIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQS---YLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTR-QGMKPMMN 1266
            F  + G  F F  P  DGP  Y IL ++             +  P  Y  ++IG +  N L I  + L +  + T  P+S C+  C+   R +       CW C +C+ Y+ L   +T C+ CE G  P K++ GC +++ S   Y+   S  +L   +    GI     V+++++ +  +P+V+AS RELS+ILL  ++MC+ MT +L +KP+   C+I++  IG +FS  YSA+ VKTNRI RIF     + +R   ISP+SQ+ M  ++  +Q++   +WL + P    HHYP R +  L CN +    FL  L +   LI++CT Y   TR +PE +NE+K IGF+MY+TCVVWL +I  +F T     ++ ++LC+SI +SA V L C+F PK++IILF++  N R Q  + M+N
Sbjct:  488 FTDIVGKRFRF-SPQGDGPASYTILTYKPKSMDKKRRMTDDESSPSDY--VEIGHWSENNLTIYEKNLWWDPDHT--PVSVCSLPCKIGFRKQLIKDEQCCWACSKCEDYEYLIN-ETHCVGCEQGWWPTKDRKGCFDLSLSQLKYMRWRSMYSLVPTILAVFGIIATLFVIVVYVIYNETPVVKASGRELSYILLISMIMCYCMTFVLLSKPSAIVCAIKRTGIGFAFSCLYSAMFVKTNRIFRIFSTR--SAQRPRFISPISQVVMTAMLAGVQLIGSLIWLSVVPPGWRHHYPTRDQVVLTCN-VPDHHFLYSLAYDGFLIVLCTTYAVKTRKVPENFNETKFIGFSMYTTCVVWLSWIFFFFGTGSDFQIQTSSLCISISMSANVALACIFSPKLWIILFEKHKNVRKQEGESMLN 898          
BLAST of Metabotropic glutamate receptor vs. Ensembl Fly
Match: mtt (gene:FBgn0050361 transcript:FBtr0088756)

HSP 1 Score: 330.872 bits (847), Expect = 1.270e-103
Identity = 178/401 (44.39%), Postives = 259/401 (64.59%), Query Frame = 1
Query:   58 FICLSGMNFSFWKPGYDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILN-KLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKP 1257
            F  LSG  F F   G DGP RY I++F++ + G Y W+ +G++   +L ++  +++F++ S   P S C+  C   Q  K+  G   CW C  C  Y I +   +T C  C++G +PD +K  C  I + YL P S  A+G + F++ GI     V+ +F++  ++PIVRAS RELS+ILL GI MC+ +T  L  KPT+  C+I++F +G  F+V Y+ALL KTNRI RIF+ G+++ KR   ISP SQ+ +C  +V +QI+I  +W+ + P+ A+HHYP R +N L+C+    +S++I   +P+ LI++CTVY  LTR IPE +NESKHIGF MY+TCV+WL F+P YF TA    LR+ ++ V+I LSA VT+ CLF PK+YIIL + E N RQ M P
Sbjct:  162 FEGLSGDEFRFDGNG-DGPARYNIIHFKQSQAGQYHWVKVGEYTEGELRLNMTEVKFKRLSPKPPESVCSLPCLVGQAKKYVEGESCCWHCFNCTTYQIRHPDDETHCKLCKLGTLPDAHKQYCRPIPEIYLRPESAWAIGAMAFSATGILVTLFVMGVFVRHNDTPIVRASGRELSYILLAGIFMCYGVTFALVLKPTNIVCAIQRFGVGFCFTVVYAALLTKTNRIARIFKAGKQSAKRPSFISPKSQLVICACLVSVQILINGVWMVIAPSHAMHHYPTREDNLLVCDSYIDASYMIAFSYPIFLIVICTVYAVLTRKIPEAFNESKHIGFTMYTTCVIWLAFVPLYFGTANHVPLRITSMSVTISLSASVTIACLFSPKLYIILIRPERNVRQSMMP 561          
BLAST of Metabotropic glutamate receptor vs. Ensembl Fly
Match: mtt (gene:FBgn0050361 transcript:FBtr0273326)

HSP 1 Score: 332.028 bits (850), Expect = 2.238e-101
Identity = 178/401 (44.39%), Postives = 259/401 (64.59%), Query Frame = 1
Query:   58 FICLSGMNFSFWKPGYDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILN-KLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKP 1257
            F  LSG  F F   G DGP RY I++F++ + G Y W+ +G++   +L ++  +++F++ S   P S C+  C   Q  K+  G   CW C  C  Y I +   +T C  C++G +PD +K  C  I + YL P S  A+G + F++ GI     V+ +F++  ++PIVRAS RELS+ILL GI MC+ +T  L  KPT+  C+I++F +G  F+V Y+ALL KTNRI RIF+ G+++ KR   ISP SQ+ +C  +V +QI+I  +W+ + P+ A+HHYP R +N L+C+    +S++I   +P+ LI++CTVY  LTR IPE +NESKHIGF MY+TCV+WL F+P YF TA    LR+ ++ V+I LSA VT+ CLF PK+YIIL + E N RQ M P
Sbjct:  477 FEGLSGDEFRFDGNG-DGPARYNIIHFKQSQAGQYHWVKVGEYTEGELRLNMTEVKFKRLSPKPPESVCSLPCLVGQAKKYVEGESCCWHCFNCTTYQIRHPDDETHCKLCKLGTLPDAHKQYCRPIPEIYLRPESAWAIGAMAFSATGILVTLFVMGVFVRHNDTPIVRASGRELSYILLAGIFMCYGVTFALVLKPTNIVCAIQRFGVGFCFTVVYAALLTKTNRIARIFKAGKQSAKRPSFISPKSQLVICACLVSVQILINGVWMVIAPSHAMHHYPTREDNLLVCDSYIDASYMIAFSYPIFLIVICTVYAVLTRKIPEAFNESKHIGFTMYTTCVIWLAFVPLYFGTANHVPLRITSMSVTISLSASVTIACLFSPKLYIILIRPERNVRQSMMP 876          
BLAST of Metabotropic glutamate receptor vs. Ensembl Fly
Match: mtt (gene:FBgn0050361 transcript:FBtr0273327)

HSP 1 Score: 331.643 bits (849), Expect = 2.159e-100
Identity = 178/401 (44.39%), Postives = 259/401 (64.59%), Query Frame = 1
Query:   58 FICLSGMNFSFWKPGYDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILN-KLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKP 1257
            F  LSG  F F   G DGP RY I++F++ + G Y W+ +G++   +L ++  +++F++ S   P S C+  C   Q  K+  G   CW C  C  Y I +   +T C  C++G +PD +K  C  I + YL P S  A+G + F++ GI     V+ +F++  ++PIVRAS RELS+ILL GI MC+ +T  L  KPT+  C+I++F +G  F+V Y+ALL KTNRI RIF+ G+++ KR   ISP SQ+ +C  +V +QI+I  +W+ + P+ A+HHYP R +N L+C+    +S++I   +P+ LI++CTVY  LTR IPE +NESKHIGF MY+TCV+WL F+P YF TA    LR+ ++ V+I LSA VT+ CLF PK+YIIL + E N RQ M P
Sbjct:  630 FEGLSGDEFRFDGNG-DGPARYNIIHFKQSQAGQYHWVKVGEYTEGELRLNMTEVKFKRLSPKPPESVCSLPCLVGQAKKYVEGESCCWHCFNCTTYQIRHPDDETHCKLCKLGTLPDAHKQYCRPIPEIYLRPESAWAIGAMAFSATGILVTLFVMGVFVRHNDTPIVRASGRELSYILLAGIFMCYGVTFALVLKPTNIVCAIQRFGVGFCFTVVYAALLTKTNRIARIFKAGKQSAKRPSFISPKSQLVICACLVSVQILINGVWMVIAPSHAMHHYPTREDNLLVCDSYIDASYMIAFSYPIFLIVICTVYAVLTRKIPEAFNESKHIGFTMYTTCVIWLAFVPLYFGTANHVPLRITSMSVTISLSASVTIACLFSPKLYIILIRPERNVRQSMMP 1029          
BLAST of Metabotropic glutamate receptor vs. Ensembl Fly
Match: mtt (gene:FBgn0050361 transcript:FBtr0273325)

HSP 1 Score: 331.643 bits (849), Expect = 8.060e-100
Identity = 178/401 (44.39%), Postives = 259/401 (64.59%), Query Frame = 1
Query:   58 FICLSGMNFSFWKPGYDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILN-KLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKP 1257
            F  LSG  F F   G DGP RY I++F++ + G Y W+ +G++   +L ++  +++F++ S   P S C+  C   Q  K+  G   CW C  C  Y I +   +T C  C++G +PD +K  C  I + YL P S  A+G + F++ GI     V+ +F++  ++PIVRAS RELS+ILL GI MC+ +T  L  KPT+  C+I++F +G  F+V Y+ALL KTNRI RIF+ G+++ KR   ISP SQ+ +C  +V +QI+I  +W+ + P+ A+HHYP R +N L+C+    +S++I   +P+ LI++CTVY  LTR IPE +NESKHIGF MY+TCV+WL F+P YF TA    LR+ ++ V+I LSA VT+ CLF PK+YIIL + E N RQ M P
Sbjct:  797 FEGLSGDEFRFDGNG-DGPARYNIIHFKQSQAGQYHWVKVGEYTEGELRLNMTEVKFKRLSPKPPESVCSLPCLVGQAKKYVEGESCCWHCFNCTTYQIRHPDDETHCKLCKLGTLPDAHKQYCRPIPEIYLRPESAWAIGAMAFSATGILVTLFVMGVFVRHNDTPIVRASGRELSYILLAGIFMCYGVTFALVLKPTNIVCAIQRFGVGFCFTVVYAALLTKTNRIARIFKAGKQSAKRPSFISPKSQLVICACLVSVQILINGVWMVIAPSHAMHHYPTREDNLLVCDSYIDASYMIAFSYPIFLIVICTVYAVLTRKIPEAFNESKHIGFTMYTTCVIWLAFVPLYFGTANHVPLRITSMSVTISLSASVTIACLFSPKLYIILIRPERNVRQSMMP 1196          
BLAST of Metabotropic glutamate receptor vs. Ensembl Fly
Match: mtt (gene:FBgn0050361 transcript:FBtr0330608)

HSP 1 Score: 331.643 bits (849), Expect = 1.273e-99
Identity = 178/401 (44.39%), Postives = 259/401 (64.59%), Query Frame = 1
Query:   58 FICLSGMNFSFWKPGYDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILN-KLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKP 1257
            F  LSG  F F   G DGP RY I++F++ + G Y W+ +G++   +L ++  +++F++ S   P S C+  C   Q  K+  G   CW C  C  Y I +   +T C  C++G +PD +K  C  I + YL P S  A+G + F++ GI     V+ +F++  ++PIVRAS RELS+ILL GI MC+ +T  L  KPT+  C+I++F +G  F+V Y+ALL KTNRI RIF+ G+++ KR   ISP SQ+ +C  +V +QI+I  +W+ + P+ A+HHYP R +N L+C+    +S++I   +P+ LI++CTVY  LTR IPE +NESKHIGF MY+TCV+WL F+P YF TA    LR+ ++ V+I LSA VT+ CLF PK+YIIL + E N RQ M P
Sbjct:  797 FEGLSGDEFRFDGNG-DGPARYNIIHFKQSQAGQYHWVKVGEYTEGELRLNMTEVKFKRLSPKPPESVCSLPCLVGQAKKYVEGESCCWHCFNCTTYQIRHPDDETHCKLCKLGTLPDAHKQYCRPIPEIYLRPESAWAIGAMAFSATGILVTLFVMGVFVRHNDTPIVRASGRELSYILLAGIFMCYGVTFALVLKPTNIVCAIQRFGVGFCFTVVYAALLTKTNRIARIFKAGKQSAKRPSFISPKSQLVICACLVSVQILINGVWMVIAPSHAMHHYPTREDNLLVCDSYIDASYMIAFSYPIFLIVICTVYAVLTRKIPEAFNESKHIGFTMYTTCVIWLAFVPLYFGTANHVPLRITSMSVTISLSASVTIACLFSPKLYIILIRPERNVRQSMMP 1196          
BLAST of Metabotropic glutamate receptor vs. Ensembl Zebrafish
Match: grm2b (glutamate receptor, metabotropic 2b [Source:ZFIN;Acc:ZDB-GENE-060201-5])

HSP 1 Score: 243.817 bits (621), Expect = 2.487e-70
Identity = 146/372 (39.25%), Postives = 219/372 (58.87%), Query Frame = 1
Query:  250 PISSCTPKCQSDQRIKFHPGICSCWICIRCQKYD-ILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMD-PAKAIHHYPERIE-NQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMNSLRIGTKSSNYQSLTKSHESQYFNDSIVLS 1356
            P S C+  CQ ++     PG   CWICI CQ +  +LN+    C+ C  GQ P  N TGC  + + Y+  +   A+G +    +G+ C   V  +F++  ++P+V+AS RELS+ILLFG+++C+ MT I   KP+ F C++ +  +G SF+VCYSALL KTNRI RIF   R + +R   ISP SQ+++C  ++  Q+++  +WL ++ P       P+R +   L CN +  SS L+ L +  ILI++CT Y F TR  PE +NE+K IGF MY+TC++WL F P ++ TA    ++  T+C+S+ LS  V L CLF PKI+IILF+ + N        + SLR   K + + S   +  S Y   S + S
Sbjct:  498 PTSQCSDPCQPNEAKSMQPGDVCCWICIPCQPHQFLLNEFT--CVDCGFGQWPLANLTGCYELPEEYIHWSDAWAVGPVTIACLGMLCTLAVAGLFLRSNDTPVVKASGRELSYILLFGVLLCYAMTFIYIAKPSAFVCALRRLGLGTSFAVCYSALLTKTNRIARIFGGARDSAQRPRFISPASQVAICAALISAQLLVALVWLLVEAPGVRKEVGPDRRDVVTLKCNSLD-SSMLVSLSYNCILIILCTFYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFQPIFYVTASDYRVQTTTMCISVSLSGSVVLGCLFAPKIHIILFQPQKN--------VTSLR--AKDNRFSSAVTAPSSTYSQGSHIDS 856          
BLAST of Metabotropic glutamate receptor vs. Ensembl Zebrafish
Match: grm2b (glutamate receptor, metabotropic 2b [Source:ZFIN;Acc:ZDB-GENE-060201-5])

HSP 1 Score: 243.817 bits (621), Expect = 3.292e-70
Identity = 144/360 (40.00%), Postives = 214/360 (59.44%), Query Frame = 1
Query:  250 PISSCTPKCQSDQRIKFHPGICSCWICIRCQKYD-ILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMD-PAKAIHHYPERIE-NQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELN-TRQGMKPMMNSLRIGTKSSNYQSLTKS 1317
            P S C+  CQ ++     PG   CWICI CQ +  +LN+    C+ C  GQ P  N TGC  + + Y+  +   A+G +    +G+ C   V  +F++  ++P+V+AS RELS+ILLFG+++C+ MT I   KP+ F C++ +  +G SF+VCYSALL KTNRI RIF   R + +R   ISP SQ+++C  ++  Q+++  +WL ++ P       P+R +   L CN +  SS L+ L +  ILI++CT Y F TR  PE +NE+K IGF MY+TC++WL F P ++ TA    ++  T+C+S+ LS  V L CLF PKI+IILF+ + N T    K    S  +   SS Y   + S
Sbjct:  498 PTSQCSDPCQPNEAKSMQPGDVCCWICIPCQPHQFLLNEFT--CVDCGFGQWPLANLTGCYELPEEYIHWSDAWAVGPVTIACLGMLCTLAVAGLFLRSNDTPVVKASGRELSYILLFGVLLCYAMTFIYIAKPSAFVCALRRLGLGTSFAVCYSALLTKTNRIARIFGGARDSAQRPRFISPASQVAICAALISAQLLVALVWLLVEAPGVRKEVGPDRRDVVTLKCNSLD-SSMLVSLSYNCILIILCTFYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFQPIFYVTASDYRVQTTTMCISVSLSGSVVLGCLFAPKIHIILFQPQKNVTSLRAKDNRFSSAVTAPSSTYSQASAS 854          
BLAST of Metabotropic glutamate receptor vs. Ensembl Zebrafish
Match: grm2b (glutamate receptor, metabotropic 2b [Source:ZFIN;Acc:ZDB-GENE-060201-5])

HSP 1 Score: 243.817 bits (621), Expect = 3.292e-70
Identity = 144/360 (40.00%), Postives = 214/360 (59.44%), Query Frame = 1
Query:  250 PISSCTPKCQSDQRIKFHPGICSCWICIRCQKYD-ILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMD-PAKAIHHYPERIE-NQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELN-TRQGMKPMMNSLRIGTKSSNYQSLTKS 1317
            P S C+  CQ ++     PG   CWICI CQ +  +LN+    C+ C  GQ P  N TGC  + + Y+  +   A+G +    +G+ C   V  +F++  ++P+V+AS RELS+ILLFG+++C+ MT I   KP+ F C++ +  +G SF+VCYSALL KTNRI RIF   R + +R   ISP SQ+++C  ++  Q+++  +WL ++ P       P+R +   L CN +  SS L+ L +  ILI++CT Y F TR  PE +NE+K IGF MY+TC++WL F P ++ TA    ++  T+C+S+ LS  V L CLF PKI+IILF+ + N T    K    S  +   SS Y   + S
Sbjct:  498 PTSQCSDPCQPNEAKSMQPGDVCCWICIPCQPHQFLLNEFT--CVDCGFGQWPLANLTGCYELPEEYIHWSDAWAVGPVTIACLGMLCTLAVAGLFLRSNDTPVVKASGRELSYILLFGVLLCYAMTFIYIAKPSAFVCALRRLGLGTSFAVCYSALLTKTNRIARIFGGARDSAQRPRFISPASQVAICAALISAQLLVALVWLLVEAPGVRKEVGPDRRDVVTLKCNSLD-SSMLVSLSYNCILIILCTFYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFQPIFYVTASDYRVQTTTMCISVSLSGSVVLGCLFAPKIHIILFQPQKNVTSLRAKDNRFSSAVTAPSSTYSQASAS 854          
BLAST of Metabotropic glutamate receptor vs. Ensembl Zebrafish
Match: grm2b (glutamate receptor, metabotropic 2b [Source:ZFIN;Acc:ZDB-GENE-060201-5])

HSP 1 Score: 243.817 bits (621), Expect = 3.292e-70
Identity = 144/360 (40.00%), Postives = 214/360 (59.44%), Query Frame = 1
Query:  250 PISSCTPKCQSDQRIKFHPGICSCWICIRCQKYD-ILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMD-PAKAIHHYPERIE-NQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELN-TRQGMKPMMNSLRIGTKSSNYQSLTKS 1317
            P S C+  CQ ++     PG   CWICI CQ +  +LN+    C+ C  GQ P  N TGC  + + Y+  +   A+G +    +G+ C   V  +F++  ++P+V+AS RELS+ILLFG+++C+ MT I   KP+ F C++ +  +G SF+VCYSALL KTNRI RIF   R + +R   ISP SQ+++C  ++  Q+++  +WL ++ P       P+R +   L CN +  SS L+ L +  ILI++CT Y F TR  PE +NE+K IGF MY+TC++WL F P ++ TA    ++  T+C+S+ LS  V L CLF PKI+IILF+ + N T    K    S  +   SS Y   + S
Sbjct:  498 PTSQCSDPCQPNEAKSMQPGDVCCWICIPCQPHQFLLNEFT--CVDCGFGQWPLANLTGCYELPEEYIHWSDAWAVGPVTIACLGMLCTLAVAGLFLRSNDTPVVKASGRELSYILLFGVLLCYAMTFIYIAKPSAFVCALRRLGLGTSFAVCYSALLTKTNRIARIFGGARDSAQRPRFISPASQVAICAALISAQLLVALVWLLVEAPGVRKEVGPDRRDVVTLKCNSLD-SSMLVSLSYNCILIILCTFYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFQPIFYVTASDYRVQTTTMCISVSLSGSVVLGCLFAPKIHIILFQPQKNVTSLRAKDNRFSSAVTAPSSTYSQASAS 854          
BLAST of Metabotropic glutamate receptor vs. Ensembl Zebrafish
Match: grm2a (glutamate receptor, metabotropic 2a [Source:ZFIN;Acc:ZDB-GENE-030131-8097])

HSP 1 Score: 239.965 bits (611), Expect = 3.355e-70
Identity = 154/417 (36.93%), Postives = 237/417 (56.83%), Query Frame = 1
Query:  106 DGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMD-PAKAIHHYPERIE-NQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMNSLRIGTKSSNYQSLTKSHESQYFNDSIV 1350
            D   RY I ++ K +   Y +  +G +  + L ++   + +   S A+P S C+  C+ ++     PG   CWICI CQ Y  L    T C  C  GQ P  N TGC ++ + Y+      A+G +    +G+ C   V+ +F+K   +P+V+AS RELS+ILL G+++C+ MT I  +KP+   C++ +  +G SF+VCYSALL KTNRI RIF   +   +R   ISP SQ+++C  ++  Q++++ +WL ++ P       PER +   L CN  K SS L+ L +  +LI++CT Y F TR  PE +NE+K IGF MY+TC++WL F P ++ TA    ++  T+C+S+ LS  V L CLF PKI+IILF+ + N        + +LR+ T   +  +   S  SQ    +IV
Sbjct:  254 DSLGRYNIFHYHK-ENDEYVYRKVGYWAQD-LTLNTTLIPWE--SQAVPTSQCSDPCRKNEIKSMQPGDVCCWICIPCQPYQYLLDEFT-CADCSFGQWPLDNLTGCYDLPEEYIHWEDAWAIGPVSIACLGMLCTLFVIGLFLKNNETPVVKASGRELSYILLLGVLLCYFMTFIYISKPSAVVCTLRRLGLGTSFAVCYSALLTKTNRIARIFNGVKDGAQRPRFISPASQVAICAALISCQLLVVVVWLLVEAPGVRKEVSPERRDVVTLKCN-SKDSSMLMSLTYNCVLIILCTFYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFQPIFYVTASDYRVQTTTMCISVSLSGSVVLGCLFAPKIHIILFQPQKN--------VTTLRVATTRFSVTTGPGSSFSQASASNIV 656          
BLAST of Metabotropic glutamate receptor vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:Xenbase;Acc:XB-GENE-998114])

HSP 1 Score: 249.98 bits (637), Expect = 2.299e-73
Identity = 151/406 (37.19%), Postives = 235/406 (57.88%), Query Frame = 1
Query:  106 DGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMD-PAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMNSLRIGTKSSNYQSLTKSH 1320
            DG   Y + NFQ    G Y ++ IG++    L +D   +++ K  + +P S C+  C  ++     PG   CWICI C+KY+ L    T C+ C  G+ P  + T C ++ + Y++     A+G +    +G  C   V  +FIK  ++P+V+AS REL +ILL G+ MC+ MT     KP+   C++ +  +G SF VCYSALL KTNRI RIF   +   +R   ISP SQ+ +C  ++ +QIV++S+WL ++ P    +  PE+ E  ++   +K SS LI L + ++L+++CTVY F TR  PE +NE+K IGF MY+TC++WL F+P ++ T+    ++  T+C+S+ LS  V L CLF PK++IILF+ + N       +      GT ++  Q  T SH
Sbjct:  316 DGIGLYNVFNFQ-YHNGKYSYLKIGQWAET-LSLDVDIIQWSK--SLVPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEKYEYLADEFT-CIDCGEGRWPTADLTSCFDLPEDYIKWEDAWAIGPVTIACLGFVCTCLVGGVFIKNNSTPLVKASGRELCYILLIGVFMCYCMTFFFIAKPSPVICTLRRLGLGTSFVVCYSALLTKTNRIARIFSGVKDGAQRPKFISPKSQVVICLSLISVQIVVVSVWLMLEFPGTRRYTLPEKRETVILKCNVKDSSMLISLTYDVVLVILCTVYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIILFQPQKNVVTHRLHLNRFSVSGTATTYSQCNTDSH 716          
BLAST of Metabotropic glutamate receptor vs. Ensembl Xenopus
Match: GRM2 (glutamate receptor, metabotropic 2 [Source:NCBI gene;Acc:100380092])

HSP 1 Score: 234.572 bits (597), Expect = 8.809e-67
Identity = 153/409 (37.41%), Postives = 237/409 (57.95%), Query Frame = 1
Query:  106 DGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDP--AKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMNSLRIGTKSSNYQSLTKSHES 1326
            DG  RY I NFQ    G Y +  +G +   +L ++   + + K  +A+P+S C+  C+ ++     PG   CWICI CQ Y+ L    T C  C +G  P+ + TGC  + Q Y+      A+G +  + +G+     V+ +F++  N+PIV+AS REL +ILL G+++C+ MT I  +KP+   C++ +  +G SF++CYSALL KTNRI RIF   R  V+R   ISP SQ+ +C +++  Q++++ +WL  +P   +      +R    L CN   GS  LI L + ++L+L+CT+Y F TR  PE +NE+K IGF MY+TC++WL F+P Y+ T+    ++  TLCVS+ LS  V L CLF PK++II+F+ + N        + S RI T   +      +H S
Sbjct:  448 DGIGRYNIFNFQNTG-GRYHYQKVG-YWAEELTLNTSLIPWAK--SAVPVSQCSDPCKKNEVKSMQPGDVCCWICISCQPYEFLVDEFT-CKDCGLGYWPNLDLTGCYELPQEYIRWGDAWAVGPVCLSCLGLLSTLFVIGVFVQNNNTPIVKASGRELCYILLCGVLLCYAMTFIFISKPSTSVCTLRRLGLGTSFAICYSALLTKTNRIARIFSGARDGVQRPRFISPASQVGICLVLISCQLLVVLIWLLFEPPGTRKDTAPDKRYIVTLKCNSGDGS-MLISLSYNVLLVLLCTLYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFLPIYYVTSSDYRVQTTTLCVSVSLSGSVVLGCLFTPKLHIIIFQPQKN--------VTSHRIATNRFSATGPGGTHGS 842          
BLAST of Metabotropic glutamate receptor vs. Ensembl Xenopus
Match: GRM5 (glutamate receptor, metabotropic 5 [Source:NCBI gene;Acc:100485273])

HSP 1 Score: 226.868 bits (577), Expect = 1.094e-63
Identity = 144/400 (36.00%), Postives = 227/400 (56.75%), Query Frame = 1
Query:   58 FICLSGMNFSFWKPGYDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSC-WICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTV--KRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQG 1248
            F  +SG   +F + G D P RY+I+NF+K+    Y +I++G ++N +L +D  ++   KN   +  S C+  C   Q      G  SC W C  C+  +I+    T C  C++G  P  + TGC  I   +L  + P  +  ++F+ +G+     V+ IFI + ++P+V++SSREL +I+L GI + ++ T  L  KP    C +++  IGLS ++ YSAL+ KTNRI RI    ++ +  K+   +S  +Q+ + F+++ IQ+ I+     M+P   I  YP   E  LICN       +  L +  +LIL CT Y F TRN+P  +NE+K+I F MY+TC++WL F+P YF     ++ ++ T+C S+ LSA V L C+F PK+YIIL K E N R  
Sbjct:  452 FTGVSGDMITFDENG-DSPGRYEIMNFKKMGKDYYDYINVGSWDNGELKMDDDEIWSNKN--LVIRSVCSDPCAKGQIKVIRKGEVSCCWTCTPCKDNEIVFDEYT-CKACDLGSWPTDDLTGCDPIPVEFLRWSDPEPIAAVVFSCLGLLATMFVMAIFILYRDTPVVKSSSRELCYIILAGICLGYLCTFSLIAKPQQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFVLICIQLGIIVALFIMEPPDVIFDYPSIREVYLICN-TNNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFG----SNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSA 842          
BLAST of Metabotropic glutamate receptor vs. Ensembl Xenopus
Match: GRM5 (glutamate receptor, metabotropic 5 [Source:NCBI gene;Acc:100485273])

HSP 1 Score: 227.254 bits (578), Expect = 2.520e-63
Identity = 144/400 (36.00%), Postives = 227/400 (56.75%), Query Frame = 1
Query:   58 FICLSGMNFSFWKPGYDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSC-WICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTV--KRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQG 1248
            F  +SG   +F + G D P RY+I+NF+K+    Y +I++G ++N +L +D  ++   KN   +  S C+  C   Q      G  SC W C  C+  +I+    T C  C++G  P  + TGC  I   +L  + P  +  ++F+ +G+     V+ IFI + ++P+V++SSREL +I+L GI + ++ T  L  KP    C +++  IGLS ++ YSAL+ KTNRI RI    ++ +  K+   +S  +Q+ + F+++ IQ+ I+     M+P   I  YP   E  LICN       +  L +  +LIL CT Y F TRN+P  +NE+K+I F MY+TC++WL F+P YF     ++ ++ T+C S+ LSA V L C+F PK+YIIL K E N R  
Sbjct:  452 FTGVSGDMITFDENG-DSPGRYEIMNFKKMGKDYYDYINVGSWDNGELKMDDDEIWSNKN--LVIRSVCSDPCAKGQIKVIRKGEVSCCWTCTPCKDNEIVFDEYT-CKACDLGSWPTDDLTGCDPIPVEFLRWSDPEPIAAVVFSCLGLLATMFVMAIFILYRDTPVVKSSSRELCYIILAGICLGYLCTFSLIAKPQQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFVLICIQLGIIVALFIMEPPDVIFDYPSIREVYLICN-TNNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFG----SNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSA 842          
BLAST of Metabotropic glutamate receptor vs. Ensembl Xenopus
Match: GRM5 (glutamate receptor, metabotropic 5 [Source:NCBI gene;Acc:100485273])

HSP 1 Score: 227.254 bits (578), Expect = 2.757e-63
Identity = 144/400 (36.00%), Postives = 227/400 (56.75%), Query Frame = 1
Query:   58 FICLSGMNFSFWKPGYDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSC-WICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTV--KRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQG 1248
            F  +SG   +F + G D P RY+I+NF+K+    Y +I++G ++N +L +D  ++   KN   +  S C+  C   Q      G  SC W C  C+  +I+    T C  C++G  P  + TGC  I   +L  + P  +  ++F+ +G+     V+ IFI + ++P+V++SSREL +I+L GI + ++ T  L  KP    C +++  IGLS ++ YSAL+ KTNRI RI    ++ +  K+   +S  +Q+ + F+++ IQ+ I+     M+P   I  YP   E  LICN       +  L +  +LIL CT Y F TRN+P  +NE+K+I F MY+TC++WL F+P YF     ++ ++ T+C S+ LSA V L C+F PK+YIIL K E N R  
Sbjct:  452 FTGVSGDMITFDENG-DSPGRYEIMNFKKMGKDYYDYINVGSWDNGELKMDDDEIWSNKN--LVIRSVCSDPCAKGQIKVIRKGEVSCCWTCTPCKDNEIVFDEYT-CKACDLGSWPTDDLTGCDPIPVEFLRWSDPEPIAAVVFSCLGLLATMFVMAIFILYRDTPVVKSSSRELCYIILAGICLGYLCTFSLIAKPQQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFVLICIQLGIIVALFIMEPPDVIFDYPSIREVYLICN-TNNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFG----SNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSA 842          
BLAST of Metabotropic glutamate receptor vs. Ensembl Mouse
Match: Grm3 (glutamate receptor, metabotropic 3 [Source:MGI Symbol;Acc:MGI:1351340])

HSP 1 Score: 261.151 bits (666), Expect = 1.596e-76
Identity = 146/378 (38.62%), Postives = 229/378 (60.58%), Query Frame = 1
Query:  106 DGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMD-PAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELN 1236
            DG  RY + NFQ I  G Y ++ +G +    L++D   + + +NS  +P S C+  C  ++     PG   CWICI C+ Y+ L    T C+ C  GQ P  + +GC N+ + Y+      A+G +    +G  C   V+ +FIK  N+P+V+AS REL +ILLFG+ + + MT     KP+   C++ +  +G SF++CYSALL KTN I RIF   +   +R   ISP SQ+ +C  ++L+QIV++S+WL ++ P    +  PE+ E  ++   +K SS LI L + ++L+++CTVY F TR  PE +NE+K IGF MY+TC++WL F+P ++ T+    ++  T+C+S+ LS  V L CLF PK++I+LF+ + N
Sbjct:  461 DGMGRYNVFNFQHIG-GKYSYLKVGHWAET-LYLDVDSIHWSRNS--VPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYLVDEFT-CMDCGPGQWPTADLSGCYNLPEDYIRWEDAWAIGPVTIACLGFMCTCIVITVFIKHNNTPLVKASGRELCYILLFGVSLSYCMTFFFIAKPSPVICALRRLGLGTSFAICYSALLTKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWLILETPGTRRYTLPEKRETVILKCNVKDSSMLISLTYDVVLVILCTVYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIVLFQPQKN 833          
BLAST of Metabotropic glutamate receptor vs. Ensembl Mouse
Match: Grm7 (glutamate receptor, metabotropic 7 [Source:MGI Symbol;Acc:MGI:1351344])

HSP 1 Score: 231.876 bits (590), Expect = 1.130e-65
Identity = 153/418 (36.60%), Postives = 233/418 (55.74%), Query Frame = 1
Query:   70 SGMNFSFWKPGYDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHY-------PERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLT---HLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMNSLRIGTKSS 1293
            +G    F K G D P RY I  +Q       G+  IG++  ++L ++   +++ K    IP S CT  C+  QR K   G   CW C  C  Y       T C  C   Q P++N+TGC NI    LE +SP A+  +    +GI     V+  FI++ ++PIVRAS RELS++LL GI +C+++T ++  KP    CS  +  +GL   + Y+ALL KTNRI RIF +G+++V     ISP SQ+++   ++ +Q++ + +W  +DP   I  Y       PE+    L C+ I     +  L + ++L++ CTVY   TR +PE +NE+K IGF MY+TC+VWL FIP +F TA+     +++  TL +S++LSA V L  L+ PK+YII+F  ELN ++  +     +   T SS
Sbjct:  461 AGTPVMFNKNG-DAPGRYDIFQYQTTNTTNPGYRLIGQW-TDELQLNIEDMQWGKGVREIPPSVCTLPCKPGQRKKTQKGTPCCWTCEPCDGYQYQFDEMT-CQHCPYDQRPNENRTGCQNIPIIKLEWHSPWAVIPVFLAMLGIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMIAKPDVAVCSFRRVFLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLAITSSLISVQLLGVFIWFGVDPPNIIIDYDEHKTMNPEQARGVLKCD-ITDLQIICSLGYSILLMVTCTVYAIKTRGVPENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLSASVALGMLYMPKVYIIIFHPELNVQKRKRSFKAVVTAATMSS 874          
BLAST of Metabotropic glutamate receptor vs. Ensembl Mouse
Match: Grm7 (glutamate receptor, metabotropic 7 [Source:MGI Symbol;Acc:MGI:1351344])

HSP 1 Score: 231.876 bits (590), Expect = 1.389e-65
Identity = 153/418 (36.60%), Postives = 233/418 (55.74%), Query Frame = 1
Query:   70 SGMNFSFWKPGYDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHY-------PERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLT---HLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMNSLRIGTKSS 1293
            +G    F K G D P RY I  +Q       G+  IG++  ++L ++   +++ K    IP S CT  C+  QR K   G   CW C  C  Y       T C  C   Q P++N+TGC NI    LE +SP A+  +    +GI     V+  FI++ ++PIVRAS RELS++LL GI +C+++T ++  KP    CS  +  +GL   + Y+ALL KTNRI RIF +G+++V     ISP SQ+++   ++ +Q++ + +W  +DP   I  Y       PE+    L C+ I     +  L + ++L++ CTVY   TR +PE +NE+K IGF MY+TC+VWL FIP +F TA+     +++  TL +S++LSA V L  L+ PK+YII+F  ELN ++  +     +   T SS
Sbjct:  461 AGTPVMFNKNG-DAPGRYDIFQYQTTNTTNPGYRLIGQW-TDELQLNIEDMQWGKGVREIPPSVCTLPCKPGQRKKTQKGTPCCWTCEPCDGYQYQFDEMT-CQHCPYDQRPNENRTGCQNIPIIKLEWHSPWAVIPVFLAMLGIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMIAKPDVAVCSFRRVFLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLAITSSLISVQLLGVFIWFGVDPPNIIIDYDEHKTMNPEQARGVLKCD-ITDLQIICSLGYSILLMVTCTVYAIKTRGVPENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLSASVALGMLYMPKVYIIIFHPELNVQKRKRSFKAVVTAATMSS 874          
BLAST of Metabotropic glutamate receptor vs. Ensembl Mouse
Match: Grm5 (glutamate receptor, metabotropic 5 [Source:MGI Symbol;Acc:MGI:1351342])

HSP 1 Score: 226.868 bits (577), Expect = 3.287e-63
Identity = 144/404 (35.64%), Postives = 230/404 (56.93%), Query Frame = 1
Query:   58 FICLSGMNFSFWKPGYDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSC-WICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTV--KRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPM----ILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQG 1248
            F  +SG    F + G D P RY+I+NF+++    + +I++G ++N +L +D  ++  +KN+  I  S C+  C+  Q      G  SC W C  C++ + +    T C  C++G  P  + TGC  I   YL    P  +  ++F  +G+     V +IFI + ++P+V++SSREL +I+L GI + ++ T  L  KP    C +++  IGLS ++ YSAL+ KTNRI RI    ++ +  K+   +S  +Q+ + F+++ IQ+ I+     M+P   +H YP   E  LICN        +G+  P+    +LIL CT Y F TRN+P  +NE+K+I F MY+TC++WL F+P YF     ++ ++ T+C S+ LSA V L C+F PK+YIIL K E N R  
Sbjct:  445 FTGVSGDMILFDENG-DSPGRYEIMNFKEMGKDYFDYINVGSWDNGELKMDDDEVWSKKNN--IIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKENEYVFDEYT-CKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVIFIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMHDYPSIREVYLICNTTN-----LGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFG----SNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSA 835          
BLAST of Metabotropic glutamate receptor vs. Ensembl Mouse
Match: Grm5 (glutamate receptor, metabotropic 5 [Source:MGI Symbol;Acc:MGI:1351342])

HSP 1 Score: 226.868 bits (577), Expect = 3.287e-63
Identity = 144/404 (35.64%), Postives = 230/404 (56.93%), Query Frame = 1
Query:   58 FICLSGMNFSFWKPGYDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSC-WICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTV--KRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPM----ILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQG 1248
            F  +SG    F + G D P RY+I+NF+++    + +I++G ++N +L +D  ++  +KN+  I  S C+  C+  Q      G  SC W C  C++ + +    T C  C++G  P  + TGC  I   YL    P  +  ++F  +G+     V +IFI + ++P+V++SSREL +I+L GI + ++ T  L  KP    C +++  IGLS ++ YSAL+ KTNRI RI    ++ +  K+   +S  +Q+ + F+++ IQ+ I+     M+P   +H YP   E  LICN        +G+  P+    +LIL CT Y F TRN+P  +NE+K+I F MY+TC++WL F+P YF     ++ ++ T+C S+ LSA V L C+F PK+YIIL K E N R  
Sbjct:  445 FTGVSGDMILFDENG-DSPGRYEIMNFKEMGKDYFDYINVGSWDNGELKMDDDEVWSKKNN--IIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKENEYVFDEYT-CKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVIFIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMHDYPSIREVYLICNTTN-----LGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFG----SNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSA 835          
BLAST of Metabotropic glutamate receptor vs. UniProt/SwissProt
Match: sp|Q9QYS2|GRM3_MOUSE (Metabotropic glutamate receptor 3 OS=Mus musculus OX=10090 GN=Grm3 PE=1 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 1.116e-75
Identity = 146/378 (38.62%), Postives = 229/378 (60.58%), Query Frame = 1
Query:  106 DGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMD-PAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELN 1236
            DG  RY + NFQ I  G Y ++ +G +    L++D   + + +NS  +P S C+  C  ++     PG   CWICI C+ Y+ L    T C+ C  GQ P  + +GC N+ + Y+      A+G +    +G  C   V+ +FIK  N+P+V+AS REL +ILLFG+ + + MT     KP+   C++ +  +G SF++CYSALL KTN I RIF   +   +R   ISP SQ+ +C  ++L+QIV++S+WL ++ P    +  PE+ E  ++   +K SS LI L + ++L+++CTVY F TR  PE +NE+K IGF MY+TC++WL F+P ++ T+    ++  T+C+S+ LS  V L CLF PK++I+LF+ + N
Sbjct:  461 DGMGRYNVFNFQHIG-GKYSYLKVGHWAET-LYLDVDSIHWSRNS--VPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYLVDEFT-CMDCGPGQWPTADLSGCYNLPEDYIRWEDAWAIGPVTIACLGFMCTCIVITVFIKHNNTPLVKASGRELCYILLFGVSLSYCMTFFFIAKPSPVICALRRLGLGTSFAICYSALLTKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWLILETPGTRRYTLPEKRETVILKCNVKDSSMLISLTYDVVLVILCTVYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIVLFQPQKN 833          
BLAST of Metabotropic glutamate receptor vs. UniProt/SwissProt
Match: sp|Q14832|GRM3_HUMAN (Metabotropic glutamate receptor 3 OS=Homo sapiens OX=9606 GN=GRM3 PE=1 SV=2)

HSP 1 Score: 258.84 bits (660), Expect = 9.726e-75
Identity = 147/378 (38.89%), Postives = 227/378 (60.05%), Query Frame = 1
Query:  106 DGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMD-PAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELN 1236
            DG  RY + NFQ +  G Y ++ +G +    L +D   + + +NS  +P S C+  C  ++     PG   CWICI C+ Y+ L    T C+ C  GQ P  + TGC ++ + Y+      A+G +    +G  C   VV +FIK  N+P+V+AS REL +ILLFG+ + + MT     KP+   C++ +  +G SF++CYSALL KTN I RIF   +   +R   ISP SQ+ +C  ++L+QIV++S+WL ++ P    +   E+ E  ++   +K SS LI L + +IL+++CTVY F TR  PE +NE+K IGF MY+TC++WL F+P ++ T+    ++  T+C+S+ LS  V L CLF PK++IILF+ + N
Sbjct:  461 DGMGRYNVFNFQNVG-GKYSYLKVGHWAET-LSLDVNSIHWSRNS--VPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYLADEFT-CMDCGSGQWPTADLTGCYDLPEDYIRWEDAWAIGPVTIACLGFMCTCMVVTVFIKHNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPVICALRRLGLGSSFAICYSALLTKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWLILEAPGTRRYTLAEKRETVILKCNVKDSSMLISLTYDVILVILCTVYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIILFQPQKN 833          
BLAST of Metabotropic glutamate receptor vs. UniProt/SwissProt
Match: sp|Q1ZZH1|GRM3_MACFA (Metabotropic glutamate receptor 3 OS=Macaca fascicularis OX=9541 GN=GRM3 PE=2 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 1.789e-74
Identity = 146/378 (38.62%), Postives = 227/378 (60.05%), Query Frame = 1
Query:  106 DGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMD-PAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELN 1236
            DG  RY + NFQ +  G Y ++ +G +    L +D   + + +NS  +P S C+  C  ++     PG   CWICI C+ Y+ L    T C+ C  GQ P  + TGC ++ + Y+      A+G +    +G  C   V+ +FIK  N+P+V+AS REL +ILLFG+ + + MT     KP+   C++ +  +G SF++CYSALL KTN I RIF   +   +R   ISP SQ+ +C  ++L+QIV++S+WL ++ P    +   E+ E  ++   +K SS LI L + +IL+++CTVY F TR  PE +NE+K IGF MY+TC++WL F+P ++ T+    ++  T+C+S+ LS  V L CLF PK++IILF+ + N
Sbjct:  461 DGMGRYNVFNFQNVG-GKYSYLKVGHWAET-LSLDVNSIHWSRNS--VPTSQCSDPCAPNEMKNMQPGDVCCWICIPCESYEYLADEFT-CMDCGPGQWPTADLTGCYDLPEDYIRWEDAWAIGPVTIACLGFMCTCMVITVFIKHNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPVICALRRLGLGSSFAICYSALLTKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWLILEAPGTRRYTLAEKRETVILKCNVKDSSMLISLTYDVILVILCTVYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIILFQPQKN 833          
BLAST of Metabotropic glutamate receptor vs. UniProt/SwissProt
Match: sp|P31422|GRM3_RAT (Metabotropic glutamate receptor 3 OS=Rattus norvegicus OX=10116 GN=Grm3 PE=1 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 4.884e-74
Identity = 144/378 (38.10%), Postives = 228/378 (60.32%), Query Frame = 1
Query:  106 DGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMD-PAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELN 1236
            DG  RY + N Q+   G Y ++ +G +    L +D   + + +NS  +P S C+  C  ++     PG   CWICI C+ Y+ L    T C+ C  GQ P  + +GC N+ + Y++     A+G +    +G  C   V+ +FIK  N+P+V+AS REL +ILLFG+ + + MT     KP+   C++ +  +G SF++CYSALL KTN I RIF   +   +R   ISP SQ+ +C  ++L+QIV++S+WL ++ P    +  PE+ E  ++   +K SS LI L + ++L+++CTVY F TR  PE +NE+K IGF MY+TC++WL F+P ++ T+    ++  T+C+S+ LS  V L CLF PK++I+LF+ + N
Sbjct:  461 DGMGRYNVFNLQQTG-GKYSYLKVGHWAET-LSLDVDSIHWSRNS--VPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYLVDEFT-CMDCGPGQWPTADLSGCYNLPEDYIKWEDAWAIGPVTIACLGFLCTCIVITVFIKHNNTPLVKASGRELCYILLFGVSLSYCMTFFFIAKPSPVICALRRLGLGTSFAICYSALLTKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWLILETPGTRRYTLPEKRETVILKCNVKDSSMLISLTYDVVLVILCTVYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIVLFQPQKN 833          
BLAST of Metabotropic glutamate receptor vs. UniProt/SwissProt
Match: sp|Q5RAL3|GRM3_PONAB (Metabotropic glutamate receptor 3 OS=Pongo abelii OX=9601 GN=GRM3 PE=2 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 8.532e-74
Identity = 146/378 (38.62%), Postives = 226/378 (59.79%), Query Frame = 1
Query:  106 DGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMD-PAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELN 1236
            DG  RY + NFQ +  G Y ++ +G +    L +D   + + +NS  +P S C+  C  ++     PG   CWICI C+ Y+ L    T C+ C  GQ P  + TGC ++ + Y+       +G +    +G  C   VV +FIK  N+P+V+AS REL +ILLFG+ + + MT     KP+   C++ +  +G SF++CYSALL KTN I RIF   +   +R   ISP SQ+ +C  ++L+QIV++S+WL ++ P    +   E+ E  ++   +K SS LI L + +IL+++CTVY F TR  PE +NE+K IGF MY+TC++WL F+P ++ T+    ++  T+C+S+ LS  V L CLF PK++IILF+ + N
Sbjct:  461 DGMGRYNVFNFQNVG-GKYSYLKVGHWAET-LSLDVDSIHWSRNS--VPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYLADEFT-CMDCGPGQWPTADLTGCYDLPEDYIRWEDAWVIGPVTIACLGFMCTCMVVTVFIKHNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPVICALRRLGLGSSFAICYSALLTKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWLILEAPGTRRYTLAEKRETVILKCNVKDSSMLISLTYDVILVILCTVYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIILFQPQKN 833          
BLAST of Metabotropic glutamate receptor vs. TrEMBL
Match: A0A193KUL0 (GCR106 OS=Schmidtea mediterranea OX=79327 GN=gcr106 PE=2 SV=1)

HSP 1 Score: 442.195 bits (1136), Expect = 3.119e-141
Identity = 233/415 (56.14%), Postives = 300/415 (72.29%), Query Frame = 1
Query:   58 FICLSGMNFSFWKPGYDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMNSLRIGTKSSNYQ 1302
            F  LSG+   F    +DG PRY+ILNF K   G+Y W++IG + N +L ID  KL+FR +S+ IPISSCTPKC  DQR K HPGIC+CWICI+CQ+Y+I    +T C  C +GQ PD+N+T C+ + Q YL    P+++G+++F+ + +  A T   IF+ +  +PIV+ASSRELSFILL GI++CFV++++LCT PT   CS +KF IG SFS+CYSALLVK NRIERIFR+GR+  ++L  IS  SQI +C  IV IQI+IL   LY   +  + H+P R E  LIC++I G+S +I + HPMILIL+CTVY FLTRNIPE +NESKHIGF MYSTCVVWLGFIPCY ATA + HLR+ATLCVSI++SA+V L CLFGPK+Y ILFK + N R+G       LRI  K+   Q
Sbjct:  414 FTSLSGLEMEFTPITFDGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKG-------LRINIKNEQNQ 821          
BLAST of Metabotropic glutamate receptor vs. TrEMBL
Match: A0A0A9XNL6 (Metabotropic glutamate receptor 7 OS=Lygus hesperus OX=30085 GN=GRM7_1 PE=3 SV=1)

HSP 1 Score: 355.525 bits (911), Expect = 1.922e-112
Identity = 184/414 (44.44%), Postives = 275/414 (66.43%), Query Frame = 1
Query:   58 FICLSGMNFSFWKPGYDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILN-KLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMNSLRIGTKSSN 1296
            F  LSG  F F   G DGP RY +++F++I P  + W+ +G++    LW++  +++F+  ++ +P S C+  C+  Q   +  G   CW C  C +Y I N K +T+C+ C +G IPD N   C++I + YLEPNS  A+G + F+S GI     +  +F++  ++P+V+A+ REL+++LL GI++CF+MT +L  KPTD  C+ ++F  G  F+V Y+ALL KTNRI RIF   +RT KR   I+P SQ+ +C  ++ IQ+++  +W+ + P KAIHHYP R +N L+C+    +S++I   +P++LILVCTVY  LTRNIPE +NESKHIGF MY+TCV+WL F+P YF+T     +R+ ++CV+I LSA VT+FCLF PK+YIIL + E N RQ M P  N  + G KS++
Sbjct:   68 FTGLSGDKFHFDNNG-DGPARYNVIHFKQIAPKNFSWVWVGEYVEGVLWMNMSEIQFKLGTSVLPESMCSLPCERGQAKTYVEGESCCWHCFNCTQYQIRNPKDETQCIICPLGTIPDPNHEVCLDIPEVYLEPNSLWAIGAMSFSSTGIFITLLIFAVFLRNNDTPVVKAAGRELTYVLLTGILLCFLMTFVLVLKPTDVVCAFQRFGAGFCFTVVYAALLTKTNRISRIFNASKRTAKRPSFITPRSQLIICSGLIFIQVLVTLIWMLVSPPKAIHHYPTRDDNLLVCSSYVDASYMIAFGYPILLILVCTVYAVLTRNIPEAFNESKHIGFTMYTTCVIWLAFVPLYFSTVNHIPMRITSMCVAISLSACVTIFCLFSPKLYIILIRPERNVRQSMMP--NYRQCGNKSNS 478          
BLAST of Metabotropic glutamate receptor vs. TrEMBL
Match: A0A0L7R3U0 (Metabotropic glutamate receptor 8 (Fragment) OS=Habropoda laboriosa OX=597456 GN=WH47_00525 PE=3 SV=1)

HSP 1 Score: 354.755 bits (909), Expect = 5.976e-109
Identity = 187/413 (45.28%), Postives = 267/413 (64.65%), Query Frame = 1
Query:   58 FICLSGMNFSFWKPGYDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILN-KLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMNSLRIGTKSS 1293
            F  LSG  F F K G DGP RY I++F++I+PG Y W+ +GK+   +L ++R +++F+      P S C+  C+  Q  K+  G   CW C  C +Y I + K +T+C+ C  G +PD+  + C +I + +L P S  A+G + F++ GI     V  +F+K  ++P+VRAS RELS++LL GI++C+++T  L  +PTD  C I++F  G  F+V Y+ALL KTNRI RIF   + + KR   ISP SQ+ +C  +V  QI+I  +W+ +DPAKA+HHYP R +N L+CN    +S++I   +P++LI+VCTVY  LTR IPE +NESKHIGF MY+TCV+WL F+P YF T     LR+ ++ V+I LSA VT+ CLF PK+YIIL + E N RQ M P   S    TKSS
Sbjct:  283 FEGLSGDKFKFDKNG-DGPARYNIIHFKQIEPGKYKWVRVGKYLEGELRLNRSEIQFKLGHPQPPESVCSLPCEVGQAKKYVEGERCCWHCFNCTQYQIRDPKDETQCIACRQGTVPDETHSTCRDIPEEFLRPESGWAIGAMAFSATGIFITMFVCGVFLKHNDTPVVRASGRELSYVLLSGILLCYLVTFALVLRPTDIVCGIQRFAAGFCFTVVYAALLTKTNRISRIFNASKHSAKRPSFISPRSQLIICSGLVFAQILINGVWMVIDPAKAMHHYPTREDNLLVCNSYIDASYMIAFAYPILLIVVCTVYAVLTRKIPEAFNESKHIGFTMYTTCVIWLAFVPLYFGTGNNVALRITSMSVTISLSASVTIACLFSPKLYIILIRPERNVRQSMMPARYST---TKSS 691          
BLAST of Metabotropic glutamate receptor vs. TrEMBL
Match: A0A2A3E9Y4 (Metabotropic glutamate receptor OS=Apis cerana cerana OX=94128 GN=APICC_08403 PE=3 SV=1)

HSP 1 Score: 354.755 bits (909), Expect = 1.557e-108
Identity = 186/413 (45.04%), Postives = 267/413 (64.65%), Query Frame = 1
Query:   58 FICLSGMNFSFWKPGYDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILN-KLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMNSLRIGTKSS 1293
            F  LSG  F F K G DGP RY I++F++I+PG Y W+ +GK+ + +L ++   ++F+      P S C+P C+  Q  K+  G   CW C  C +Y I + K  T+C+ C  G +PD+  + C +I + +L P S  A+G + F++ GI     V  +F+K  ++P+VRAS RELS++LL GI++C+++T  L  +PTD  C I++F  G  F+V Y+ALL KTNRI RIF   + + KR   ISP SQ+ +C  +V +QI++  +W+ +DPAKA+HHYP R +N L+CN    +S++I   +P++LI+VCTVY  LTR IPE +NESKHIGF MY+TCV+WL F+P YF T     LR+ ++ V+I LSA VT+ CLF PK+YIIL + E N RQ M P   S    TKSS
Sbjct:  327 FEGLSGDKFKFDKNG-DGPARYNIIHFKQIEPGKYEWVRVGKYLSGELRLNMSAIQFKLGHPEPPESVCSPPCEVGQAKKYVAGEQCCWHCFNCTQYQIRDHKDVTQCISCRQGTVPDETHSACRDIPEEFLRPESGWAIGAMSFSATGILITLFVCGVFLKHNDTPVVRASGRELSYVLLSGILLCYLVTFALVLRPTDIVCGIQRFAAGFCFTVVYAALLTKTNRISRIFNASKHSAKRPSFISPRSQLIICSGLVFVQILVNGVWMIIDPAKAMHHYPTREDNLLVCNSYIDASYMIAFAYPIMLIVVCTVYAVLTRKIPEAFNESKHIGFTMYTTCVIWLAFVPLYFGTGNNVALRITSMSVTISLSASVTIACLFSPKLYIILIRPERNVRQSMMPTRYST---TKSS 735          
BLAST of Metabotropic glutamate receptor vs. TrEMBL
Match: T1IGY4 (G_PROTEIN_RECEP_F3_4 domain-containing protein OS=Strigamia maritima OX=126957 PE=3 SV=1)

HSP 1 Score: 353.984 bits (907), Expect = 1.913e-108
Identity = 187/403 (46.40%), Postives = 263/403 (65.26%), Query Frame = 1
Query:   58 FICLSGMNFSFWKPGYDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMN 1266
            F  LSG  F F + G DGP RY I++F++I P ++ W+ +G++ + QL ++   ++F  N   +P S C+  C   Q  K+  G   CW C  C +Y IL K +  C  C +G +PD +   C++I ++YL P S IA+G + F+++GI     ++ IFI+  ++P+V+AS RELS++LL GI +C+ MT +L  +PTDF C ++KF +G  F+V YSALL KTNRI RI +  RRT +R   ISP SQ+ +C  +V IQI +   WL++ P KAIHH+P R  NQL+C     +S++I   +P+ILI+VCTVY  LTR IPE +NESKHIGF MY+TC++WL F+P YF+TA    LR+ TL VSI LSA V+L CLF PK+YII+   E N RQ   PMM 
Sbjct:  345 FTGLSGDEFHFTEHG-DGPARYNIIHFKQISPSVFQWVRVGEYNDGQLLLNMSAIQFNLNEPGVPQSVCSLPCLKGQAKKYVEGEICCWHCFNCSQYQIL-KSEVSCQDCPLGTLPDYDHLRCLDIPEAYLRPTSEIAIGAMCFSTLGILLTLWILTIFIRHNSTPVVKASGRELSYVLLSGIFLCYAMTFVLVLRPTDFVCGVQKFGMGFCFAVVYSALLTKTNRILRIVKSSRRTARRPSFISPRSQLVICSGLVGIQIGVNCAWLFVCPPKAIHHHPHREANQLVCATAVNASYMIAFTYPIILIIVCTVYAVLTRKIPEAFNESKHIGFTMYTTCIIWLAFVPIYFSTAHNVPLRIITLSVSISLSATVSLACLFTPKLYIIILHPERNVRQ---PMMQ 742          
BLAST of Metabotropic glutamate receptor vs. Ensembl Cavefish
Match: grm2a (metabotropic glutamate receptor 2 [Source:NCBI gene;Acc:103035135])

HSP 1 Score: 243.432 bits (620), Expect = 4.932e-70
Identity = 151/395 (38.23%), Postives = 229/395 (57.97%), Query Frame = 1
Query:  106 DGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMD-PAKAIHHYPERIE-NQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMNSLRIGT 1284
            D   RY I ++ K   G Y +  +G +    L ++   + + +    +P S C+  C+ ++     PG   CWICI CQ Y  L    T C  C  GQ P+ N TGC N+ + Y+      A+G +    +GI C   V+ +F+K   +P+V+AS RELS+ILL G+++C+ +T I  TKP+   C++ +  +G SF+VCYSALL KTNRI RIF   +   +R   ISP SQ+++C  ++  Q++++ +WL ++ P       PER +  +L CN  K SS L+ L +  ILI++CT Y F TR  PE +NE+K IGF MY+TC++WL F P ++ TA    ++  T+C+S+ LS  V L CLF PKI+IILF+ + N        + +LR+ T
Sbjct:  468 DSLGRYNIFHYHKEDDG-YVYRKVGYWAQT-LDLNTSLIPWDQ---MVPTSQCSDPCRKNEIKSMQPGDVCCWICIPCQPYQYLLDEFT-CADCSFGQWPNANLTGCYNLPEEYIHWEDAWAIGPVTIACLGILCTLFVIGLFLKNNETPVVKASGRELSYILLLGVLLCYCITFIYITKPSAVVCTLRRLGLGTSFAVCYSALLTKTNRIARIFNGVKDGAQRPRFISPASQVAICAALISFQLLVVVVWLLVEAPGVRKEVSPERRDIVRLKCN-SKDSSMLMSLTYNCILIILCTFYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFQPIFYVTASDYRVQTTTMCISVSLSGSVVLGCLFAPKIHIILFQPQKN--------VTTLRVAT 847          
BLAST of Metabotropic glutamate receptor vs. Ensembl Cavefish
Match: grm2b (metabotropic glutamate receptor 2-like [Source:NCBI gene;Acc:103030591])

HSP 1 Score: 242.662 bits (618), Expect = 6.104e-70
Identity = 146/361 (40.44%), Postives = 212/361 (58.73%), Query Frame = 1
Query:  244 AIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMD-PAKAIHHYPERIE-NQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMN-SLRIGTKSSNYQSLTKS 1317
            AIP S C+  CQ ++     PG   CWICI CQ +  L    T C  C  G+ P  N TGC  + + Y+  +   A+G +    +G+ C   V  +F++  ++P+V+AS RELS+ILLFG+++C+ MT I   KP+   C++ +  +G SF+VCYSALL KTNRI RIF   R + +R   ISP SQ+++C +++  Q+++  +WL ++ P       PER +   L CN +  SS L+ L +  ILI++CT Y F TR  PE +NE+K IGF MY+TC++WL F P ++ TA    ++  T+C+S+ LS  V L CLF PKI+IILF+ + N     K     S  I   SS Y   T S
Sbjct:  486 AIPTSQCSDPCQPNEAKSMQPGDVCCWICIPCQAHQFLLDEFT-CEDCGFGEWPLTNLTGCYELPEEYIHWSDAWAVGPVTIACLGMLCTMAVAGVFLRNNDTPVVKASGRELSYILLFGVLLCYAMTFIYIAKPSAVVCALRRLGLGTSFAVCYSALLTKTNRIARIFGGARDSAQRPRFISPASQMAICAVLISAQLLVALVWLLVEAPGVRKELSPERRDVVTLKCNSLD-SSMLVSLTYNCILIILCTFYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFQPIFYVTASDYRVQTTTMCISVSLSGSVVLGCLFAPKIHIILFQPQKNVTSLRKNDNRFSTAITAPSSTYSQGTSS 844          
BLAST of Metabotropic glutamate receptor vs. Ensembl Cavefish
Match: grm2b (metabotropic glutamate receptor 2-like [Source:NCBI gene;Acc:103030591])

HSP 1 Score: 241.891 bits (616), Expect = 1.557e-69
Identity = 138/333 (41.44%), Postives = 204/333 (61.26%), Query Frame = 1
Query:  244 AIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMD-PAKAIHHYPERIE-NQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELN 1236
            AIP S C+  CQ ++     PG   CWICI CQ +  L    T C  C  G+ P  N TGC  + + Y+  +   A+G +    +G+ C   V  +F++  ++P+V+AS RELS+ILLFG+++C+ MT I   KP+   C++ +  +G SF+VCYSALL KTNRI RIF   R + +R   ISP SQ+++C +++  Q+++  +WL ++ P       PER +   L CN +  SS L+ L +  ILI++CT Y F TR  PE +NE+K IGF MY+TC++WL F P ++ TA    ++  T+C+S+ LS  V L CLF PKI+IILF+ + N
Sbjct:  511 AIPTSQCSDPCQPNEAKSMQPGDVCCWICIPCQAHQFLLDEFT-CEDCGFGEWPLTNLTGCYELPEEYIHWSDAWAVGPVTIACLGMLCTMAVAGVFLRNNDTPVVKASGRELSYILLFGVLLCYAMTFIYIAKPSAVVCALRRLGLGTSFAVCYSALLTKTNRIARIFGGARDSAQRPRFISPASQMAICAVLISAQLLVALVWLLVEAPGVRKELSPERRDVVTLKCNSLD-SSMLVSLTYNCILIILCTFYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFQPIFYVTASDYRVQTTTMCISVSLSGSVVLGCLFAPKIHIILFQPQKN 841          
BLAST of Metabotropic glutamate receptor vs. Ensembl Cavefish
Match: grm3 (metabotropic glutamate receptor 3 [Source:NCBI gene;Acc:103035018])

HSP 1 Score: 238.039 bits (606), Expect = 2.962e-68
Identity = 136/404 (33.66%), Postives = 227/404 (56.19%), Query Frame = 1
Query:  106 DGPPRYKILNFQKIKPG--LYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXX-XXXXXXTVKRLFCISPLSQISMCFX-XXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMNSLRIGTKSSNYQS 1305
            DG  RY I N+Q++ PG   + +I +G++    L ++   + + +    +P S C+  C  ++  K   G   CWIC  C+ Y+ L    T C PC +GQ P  + +GC ++ + Y+      A+G +    +G  C + V  +FI+  ++P+V+AS REL +ILL G++M + MT I   KP+   C++ +  +G SF+VCYSALL KTNRI RI         +R   ISP SQ+ +C   I +  +++    L   P       PE+ +  ++   ++ SS L+ L + ++L+++CTVY F TR  PE +NE+K IGF MY+TC++WL F+P ++ T+    ++  T+C+S+ LS  V L C+F PK++II+F+ + N     +  +N   +   ++ Y S
Sbjct:  442 DGLGRYNIFNYQRL-PGSDKFTYIQVGEWAET-LSLNEFLIGWPRGG-GLPTSQCSDPCAPNEMKKMQAGEYCCWICTACEPYEYLPDEFT-CAPCALGQWPRDDLSGCYDLPEDYIMWEDAWAIGPISIACVGFVCTSLVFTVFIRHNDTPLVKASGRELCYILLLGVLMSYSMTFIFIAKPSPAVCALRRLGLGTSFAVCYSALLTKTNRIARIFSGVKDGGAQRPRFISPSSQVFICLSFISVQLLLVSVWLLLEVPGTRRFTLPEKRQTVILKCNVRDSSMLLSLSYDVVLVVLCTVYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCMFAPKVHIIMFQPQKNV-TSHRLNLNRFSVSGPATTYAS 840          
BLAST of Metabotropic glutamate receptor vs. Ensembl Cavefish
Match: grm3 (metabotropic glutamate receptor 3 [Source:NCBI gene;Acc:103035018])

HSP 1 Score: 238.039 bits (606), Expect = 4.067e-68
Identity = 136/404 (33.66%), Postives = 227/404 (56.19%), Query Frame = 1
Query:  106 DGPPRYKILNFQKIKPGL--YGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXX-XXXXXXTVKRLFCISPLSQISMCFX-XXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMNSLRIGTKSSNYQS 1305
            DG  RY I N+Q++ PG   + +I +G++    L ++   + + +    +P S C+  C  ++  K   G   CWIC  C+ Y+ L    T C PC +GQ P  + +GC ++ + Y+      A+G +    +G  C + V  +FI+  ++P+V+AS REL +ILL G++M + MT I   KP+   C++ +  +G SF+VCYSALL KTNRI RI         +R   ISP SQ+ +C   I +  +++    L   P       PE+ +  ++   ++ SS L+ L + ++L+++CTVY F TR  PE +NE+K IGF MY+TC++WL F+P ++ T+    ++  T+C+S+ LS  V L C+F PK++II+F+ + N     +  +N   +   ++ Y S
Sbjct:  463 DGLGRYNIFNYQRL-PGSDKFTYIQVGEWAET-LSLNEFLIGWPRGG-GLPTSQCSDPCAPNEMKKMQAGEYCCWICTACEPYEYLPDEFT-CAPCALGQWPRDDLSGCYDLPEDYIMWEDAWAIGPISIACVGFVCTSLVFTVFIRHNDTPLVKASGRELCYILLLGVLMSYSMTFIFIAKPSPAVCALRRLGLGTSFAVCYSALLTKTNRIARIFSGVKDGGAQRPRFISPSSQVFICLSFISVQLLLVSVWLLLEVPGTRRFTLPEKRQTVILKCNVRDSSMLLSLSYDVVLVVLCTVYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCMFAPKVHIIMFQPQKNV-TSHRLNLNRFSVSGPATTYAS 861          
BLAST of Metabotropic glutamate receptor vs. Ensembl Sea Lamprey
Match: grm3 (glutamate receptor, metabotropic 3 [Source:ZFIN;Acc:ZDB-GENE-061009-13])

HSP 1 Score: 209.534 bits (532), Expect = 1.081e-58
Identity = 141/398 (35.43%), Postives = 220/398 (55.28%), Query Frame = 1
Query:  106 DGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXX-XXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMD-PAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMNSLRIGTKSS 1293
            DG  +Y I  FQK   G Y +  +G +    L +   ++ + K+S  IP+S C+  C  ++      G   CW+CI CQ Y+ L    T C+ C  G+ P  +   C ++ + Y++     AL  +  + +G+ C  TV+I FI   N+PIV+AS REL + LL G+ MC+  T     K T   C++ +  +  SF VCYSALL KTNRI R+          R   +SPL+Q+ +C  ++LIQ+ ++++WL ++ P       P++ E  ++   ++ S+ LI L   + L++VCTVY F  R   + +NE+K I F MY+TC++WL F+P ++ T+    ++  T+CVS+ LS  V L CLF PK+ IILF+   N  +  KP   SL  GT +S
Sbjct:  455 DGLAKYNIFIFQK-SNGKYSYTKVGHWSQG-LVLQANEIHWAKSS--IPVSQCSDPCAPNEMKSTQRGDSCCWVCISCQPYEYLYDEFT-CMDCGPGRWPSADLRDCYDLPEEYIKWEDAWALVPIAISCIGLICTVTVLITFIVHGNTPIVKASGRELCYALLAGVSMCYSTTFAFVAKATVLVCALRRLVLAASFVVCYSALLTKTNRISRMFNSAREGGSSRPKFVSPLAQMVICLTLILIQLSVVAIWLIVENPGLRRFTIPDKREVVILKCSVQDSNMLISLVCNVCLVMVCTVYAFKNRKCHDSFNEAKFIAFTMYTTCIIWLAFVPIFYVTSGDYRVQTTTICVSVSLSGSVVLGCLFAPKVNIILFQPHKNVERPPKPTTISLAAGTATS 847          
BLAST of Metabotropic glutamate receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003019.1 (pep scaffold:Pmarinus_7.0:GL478098:6745:34806:-1 gene:ENSPMAG00000002755.1 transcript:ENSPMAT00000003019.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 198.364 bits (503), Expect = 7.848e-58
Identity = 126/340 (37.06%), Postives = 198/340 (58.24%), Query Frame = 1
Query:  250 PISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHY-----PERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTH---LRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQ 1245
            P S C+ +C+  +R +   G+  CW C RC+ Y  L+K  T C  C     PD N T C       LE +SP A   L    +GI   + V   F +F ++PIVRAS RELS+ LL GI +C+V+T ++   P+   C++ +  +GL   + Y+ALL KTNRI RIF +G+++V     ISP SQ+ + F ++ +Q++ + +W   +P +   +      P      L C+ I   + +  L + ++L++ CTVY   TR +PEG+NE+K IGF MY+TC++WL FIP +F T++  +   ++  TL +++ LSA V+L  LF PK+YI+L + ELN ++
Sbjct:   17 PASECSVQCEPGERRRQLKGVPCCWTCERCEGYTYLHKDFT-CKLCPYHLRPDANHTACHPFPTVKLEWHSPWAAVPLFVAVLGILATSFVAATFARFNDTPIVRASGRELSYTLLTGIFLCYVVTFLMIAAPSVALCTLRRLFLGLGMCISYAALLTKTNRIHRIFEQGKKSVAPPRFISPASQLVIAFSLISVQLLGVFVWFGANPPQVFINEQRTLDPMEAHWVLQCD-ISDLALICSLGYSILLMVTCTVYAIKTRGVPEGFNEAKPIGFTMYTTCIIWLIFIPIFFGTSQSVNKLGIQTTTLTIAMSLSASVSLGMLFCPKVYIVLLRPELNVQK 354          
BLAST of Metabotropic glutamate receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007590.1 (pep scaffold:Pmarinus_7.0:GL478498:6932:63706:-1 gene:ENSPMAG00000006812.1 transcript:ENSPMAT00000007590.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 191.045 bits (484), Expect = 2.170e-52
Identity = 128/361 (35.46%), Postives = 199/361 (55.12%), Query Frame = 1
Query:   70 SGMNFSFWKPGYDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKY----DILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQ-------LICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAK 1119
            +G    F K G D P RY I  +        G+  IG++ N+ L ++   L++      +P S C+  C S +R K   G+  CW C RC+ Y    D  N     C  C     P+ N+TGC  I    LE +SP A+  +    +G+   A V++ F+++ ++PIVRAS RELS++LL GI +C+  T ++  +P+   CS  +  +GL   V Y+ALL KTNRI RIF +G+R+V     ISP SQ+ + F ++ +Q++ + +W  + P   +  Y E+   +       L C+ I   + +  L + ++L++ CTVY   TR +PE +NE+K IGF MY+TC+VWL FIP +F TA+
Sbjct:  459 AGTPVMFNKDG-DAPGRYDIFQYHLHNTSTPGYNVIGEWVNH-LQLNISALQWTAGRRELPYSICSMPCASGERKKKVKGVPCCWNCERCEGYYFQLDEFN-----CHLCPYNMRPNVNRTGCDAIPIVKLEWHSPFAVVPVFLAILGLLTTAFVIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYATTFLMIAEPSLAVCSFRRIFLGLGMCVSYAALLTKTNRIYRIFEQGKRSVTAPRLISPASQLVITFSLIAVQLLGVCIWFGLTPPHTVIDYEEQRSQEAELARGMLKCD-ISDLALICSLGYSILLMVTCTVYAIKTRGVPENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQ 811          
BLAST of Metabotropic glutamate receptor vs. Ensembl Sea Lamprey
Match: casr (calcium-sensing receptor [Source:ZFIN;Acc:ZDB-GENE-050119-8])

HSP 1 Score: 126.331 bits (316), Expect = 1.213e-30
Identity = 112/410 (27.32%), Postives = 191/410 (46.59%), Query Frame = 1
Query:  109 GPPR--YKILNFQKI-KPGLYGWIDIGKFEN-----NQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPG--ICSCWICIRCQKYDILNKLKTE-CLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXX---XXTVKR---------LFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLI---CNFIKGSSFLIG--LCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMK 1254
            G PR  Y ++N+Q+  K G    +++G ++       +L  +  K   +  S  IP S CT  C    R     G  +C C+ CI C + +  N+     CL C     P  N T C+   + YL    P  + +     +G     +V  +F+K   + IV+A++ ELS++L F +  CF+ ++    KP+   C + +   G+SF +C S +LVKT+R+ ++F      R  V++         L  +  L Q+ +C              +++  A       +  +N +I   C+  +GS   +G  + +  +L  VC ++ F  R +PE +NE+K I F+M    +VWL FIP Y ++        A   ++I +S+   L C+F  K YIIL K E NT + ++
Sbjct:  461 GDPRGGYSLVNWQQSPKDGSVQLVEVGSYDGRKPSGQRLLCNGSKQISKGYSREIPTSVCTQPCAPGTRKGILEGEQVC-CFECISCAEGEYNNESDANSCLGCPEDSWPSANHTMCVPKREEYLSWREPFGVCLAFVGCLGAVLTLSVAAVFVKHRGTAIVKATNVELSYLLFFSLFCCFLSSLFFIGKPSTVACKLRQPTFGISFVLCVSCVLVKTHRVLQVFESQIPGRGGVRKLLGLDHQLLLVFLFTLVQVVIC-------------AVWLYTAPPTFEEDDTFKNDVIYLSCD--EGSQLALGFVIGYTCLLAGVCFLFAFRARKLPENFNEAKFITFSMLVFFIVWLSFIPAYVSSQG--KFVAAVEVIAILVSSFGLLSCIFFHKCYIILLKPERNTPEEVR 852          
BLAST of Metabotropic glutamate receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004832.1 (pep scaffold:Pmarinus_7.0:GL494148:1537:3056:-1 gene:ENSPMAG00000004396.1 transcript:ENSPMAT00000004832.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.612 bits (270), Expect = 7.174e-28
Identity = 53/126 (42.06%), Postives = 75/126 (59.52%), Query Frame = 1
Query:  871 PAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQG 1248
            P + +  YP   E  LICN     + +  L    +LI+ CT Y F TRN+PE +NE+K+I F MY+TC++WL F+P YF     +  ++ T C+ + LS+ V L C+F PK+YIIL K E N R  
Sbjct:    1 PPQVVFDYPSLREVNLICN-TSNLAMVAPLGFNGLLIMSCTYYAFKTRNVPENFNEAKYIAFTMYTTCIIWLAFVPIYFG----SKYKIVTTCLCVSLSSTVVLGCMFLPKVYIILAKPERNVRSA 121          
BLAST of Metabotropic glutamate receptor vs. Ensembl Nematostella
Match: EDO35253 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM25])

HSP 1 Score: 196.438 bits (498), Expect = 4.446e-54
Identity = 127/387 (32.82%), Postives = 205/387 (52.97%), Query Frame = 1
Query:  106 DGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWID----RRKLRFRK-----NSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQIS-MCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELN 1236
            D    Y +  F + + G Y +I +  ++    ++D       L         N + +  SSC   C      K       CW C+ C K + +  L T C  C   + PD  +TGC+ +   YL  +  I   +  F ++GI C   V +IFI F  +P+V+AS REL+  LL G+ +C+V  I+L  +P+ F C +++F +G +  VCY+ALL+KTNRI RIF +  R+ K    I+P SQ+  +  ++ +  ++      Y  P K    +P + +    CN I+    ++ + + ++LIL+CT+Y F TR  P  +NE+++IGFAMY+TCV+WL F+P         +  L TL +++ L+A   L C+FGPK+YI+LF+   N
Sbjct:  419 DATGMYDVFTFNQTESG-YNYIKVATWDGGLHFVDPALQAGGLDLGGEGVLLNPSGVQ-SSCGEPCARGYYRKLRRDKACCWTCLPCGKDEYVKDL-TGCGRCTELERPDPTRTGCVLLPLRYLSDSWSIM--VTCFATVGIICVLGVSVIFIMFSETPLVKASGRELTATLLIGLFLCYVEGIMLILRPSVFVCGLQRFGVGFAPCVCYAALLIKTNRIARIFAKSERSTKPPDFINPASQLLILAAVVGVEVVLAGVGLGYWSP-KQTEKFPTKSDILSTCN-IQDYDLVVAMSYNVLLILLCTIYAFRTRKTPANFNEARYIGFAMYTTCVIWLAFLPVQIGVNDKDYKTL-TLSINVTLNATTLLLCVFGPKVYIVLFRPTRN 797          
BLAST of Metabotropic glutamate receptor vs. Ensembl Nematostella
Match: EDO47627 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLL8])

HSP 1 Score: 172.17 bits (435), Expect = 1.816e-45
Identity = 121/385 (31.43%), Postives = 199/385 (51.69%), Query Frame = 1
Query:  106 DGPPRYKILNFQKIKPGLYGWIDIGKFEN---------NQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICS---CWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATV--VIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIIL 1218
            DG   Y I+NF+K+  G Y ++ +G +               ID  ++ ++      P S C+  C   Q     P I +   CW C+ C+    ++     CL C  G  PD N T C  +   Y  P +     I+ F  + +   +T+   + F+K  ++ +++AS RELS IL    + C++  I   T+PTDF C + +F   +S + CY+ +L++TNRI RIF   +++V R    SP+SQ+  C  I+ +Q++I  +W   DP +A+  Y +  E  L+   +  +S  + LC+ + L+LV TVY F TRN P  +NE+K+IG  MY +C VW+ F+PCY   A  +  +     V++   A VTL  L  P++Y+++
Sbjct:  490 DG--NYSIVNFRKVD-GKYTYLKVGSWGGVLKPDDSIEGDATIDESRISWKPRWNIAPDSYCSSPCSIRQITA--PAIANPTCCWQCVDCKHKQYISN--DTCLSCPDGHTPDANLTSCYKLPVVYATPFNGNTAQIVTFVVVLLGSISTICTGVFFLKNKDNRVIKASGRELSAILFIATLCCYLSAISYMTRPTDFLCGMRRFSGSVSLTACYAPVLLRTNRIHRIFTAAQKSVTRPSFTSPMSQVMFCLGIIAVQVLITCVWFLSDPPRAVMSYYD--ERTLLECGMSDTSVAMNLCYNIFLMLVATVYAFKTRNFPRNFNEAKYIGITMYISCAVWIIFLPCYLNAAN-SIWKSTMKAVALVAIATVTLLGLLVPRMYLVI 864          
BLAST of Metabotropic glutamate receptor vs. Ensembl Nematostella
Match: EDO31767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWZ2])

HSP 1 Score: 167.933 bits (424), Expect = 4.897e-44
Identity = 121/404 (29.95%), Postives = 198/404 (49.01%), Query Frame = 1
Query:  106 DGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLR--FRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFC-------ISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMNSLRIGTKS 1290
            D   +Y +L +++       ++ +G +   +L ++  ++   +  +S AI  S C   C+     +     C CW C  C     +      C+ C+ G  PD +   C  +   YL+  +P    +     +G+     V+ +FIKF ++P++ A+ RE+S +L  G++MC+ +  ++   P    C I +F  G+SF + Y++LLVKTNR           + R+F        ISP SQ+ +  LI+   + I  L  Y  P K  + + E+  N L C+  K  + +  LC+ ++LIL+CT Y F TR  P  +NE+K IGF MY+TCV+W+ F+P YF            +C S   SA   L  +F PK+YI++FK E N +   +     LR  TKS
Sbjct:  473 DTSGKYDVLQYRRDGEDDGRYVRVGSWIEGELKLNTSEITEWYVSDSNAIE-SHCGKPCKPGYIRRMTKAKC-CWSCEWCSLGSFV--YNNTCIRCKEGYQPDTSYQDCTLLPVKYLD--TPWKAVVATAAGVGVVVTMFVIGVFIKFKDTPLIMAAGREVSTLLFTGMIMCYALAFVMVVPPNTTLCGIRRFGTGISFCLLYTSLLVKTNR-----------IARIFSGTKSPSFISPKSQLFITLLIISPVLTITLLEFYFHPPKIKYTHLEKY-NLLSCS-NKEIAVITKLCYNVLLILLCTYYAFRTRKTPLNFNEAKFIGFCMYTTCVIWIAFLPLYFGAGG--GFEGLAVCFSAVFSATTILVFIFAPKVYIVIFKPEKNLKSNSR-----LRSRTKS 850          
BLAST of Metabotropic glutamate receptor vs. Ensembl Nematostella
Match: EDO42815 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0D3])

HSP 1 Score: 158.303 bits (399), Expect = 8.201e-41
Identity = 101/377 (26.79%), Postives = 187/377 (49.60%), Query Frame = 1
Query:  124 KILNFQKIKPGLYGWIDIG--KFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTE-CLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQ 1245
            K L      P  + ++ IG   +   QL + +  + +   S   P S C+  C   +       +  CW C++C +  I N   T  C+PC+ G   D   + C+ + + YL+    +++ +L  +S+GI   A V ++FI++  + +V+AS+RE SF++L  I+  F++TI+   +PT   C    FC     +   S +L KTNR+  IF+  +  V  +        I   FL ++     L+  +   P   +H++   +   + C     +  ++ L +  +L  + T   +  R++PE +NES++IGF+M++ CV+W  FIP +  T     ++   LC+++ ++ +VTL C+F  ++ IILF  E N  +
Sbjct:  490 KSLQPDHTSPHGHSFVTIGYWSWTTRQLQLSKNNITWNNGSRHTPFSRCSAPCAKGE-YPVQGSVPCCWTCVKCPRGSIKNSTGTGGCVPCDKGYTSDAGNSECLKLPEIYLQLEGTMSVVVLTCSSVGIILTAVVFVVFIRYGGTAVVKASAREFSFMMLLMIVFMFLLTILYIGRPTQTMCKARPFCFAFIMTFWTSLMLTKTNRLLLIFKNKKVAVGEVALGIRCQLILALFLTLISMATTLAWVMSFPPNVTLHYFDTHV--TVDCGGESHTLLILLLGYTAVLAAITTFLSYKARHLPENFNESRYIGFSMFTFCVIWCCFIPLFLTTDPA--MKYTCLCLALCVTGLVTLVCMFSNRLRIILFHPERNRTE 861          
BLAST of Metabotropic glutamate receptor vs. Ensembl Nematostella
Match: EDO41315 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4N3])

HSP 1 Score: 154.451 bits (389), Expect = 1.258e-39
Identity = 125/396 (31.57%), Postives = 186/396 (46.97%), Query Frame = 1
Query:   58 FICLSGMNFSFWKPGYDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYD-ILNKLKTECLPCEMGQIPD--KNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELN 1236
            F+  +G    F   G D    Y ++ F+K   G Y  + IG       W D+ ++R       +  S        +  +        CW C  C+    ++N+  T CL C +G  P+   ++  C+ I   Y   N   A+  + F   GI     VV +  K   +PIV+A  REL+++LL  I++CF  T I+  +PT   C    F   L F++ Y+A+ +KTN         R   KR   + P SQ+ +   +V +Q + L L   +    A H YP      L C+      F +   +  ILI++CTVY F TR IP  +NE+K I FAMYS+CV+WL F+  YF    L   R   L +SI L A V L  L+GPK+YI++F+   N
Sbjct:  391 FVGATGEKVHFDANG-DVEGIYDVMRFEK-SSGTYRNVIIGT------WKDKLRMRNEHKFEIVKSSCSDECSSDEVMLPVRGKEACCWSCEPCKGNSYVINR--TTCLTCPLGSWPNHSADRKQCLQIELQYFGKNLMYAVPAMGFAGTGIFITIFVVYLLAKHDKTPIVKACGRELAYLLLVSILLCFSDTFIVVLRPTRIICIARFFLSSLGFTISYAAIFIKTN-RISRIFNRRNVAKRPILVLPSSQLVLVLGVVCVQALFLVLLTLLRTPTARHFYPTVDTVYLSCS-TSDLDFGLSQVYNFILIIMCTVYAFKTRKIPSNFNEAKLIAFAMYSSCVIWLAFLAVYFMQRSLVE-RPLILSISISLIAYVLLGSLYGPKVYILIFRPHRN 773          
BLAST of Metabotropic glutamate receptor vs. Ensembl Medaka
Match: grm2b (metabotropic glutamate receptor 2-like [Source:NCBI gene;Acc:101174659])

HSP 1 Score: 243.432 bits (620), Expect = 3.602e-70
Identity = 148/383 (38.64%), Postives = 220/383 (57.44%), Query Frame = 1
Query:  106 DGPPRYKILNFQKIKPGLYGWIDIGKFEN----NQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMD-PAKAIHHYPERIE-NQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELN 1236
            DG  RY I ++ K + G + +  +G ++     N   I  R L         P S C+  C+ ++     PG   CWICI CQ Y  L    T C  C  GQ P  N TGC  + + Y+      A+G +  + +GI C  TVV +F+K   +P+V+AS REL++ILL G++MC+ +T I   KP+   C++ +  +G SF+VCYSALL KTNRI RIF   +   +R   ISP SQ+++C  ++  Q+++  +WL ++ P       P+R     L CN  + +S L+ L +  ILI++CTVY F TR  PE +NE+K IGF MY+TC++WL F P ++ TA    ++  T+C+S+ LS  V L CLF PK++IILF+ + N
Sbjct:  442 DGISRYNIFHYHK-EDGKFTYRKVGYWDQILTLNTSLIPWRGL-------VPPTSQCSDPCRKNEVKSMQPGDVCCWICIPCQPYQYLQDEFT-CADCSFGQWPLANLTGCYELPEEYIRWEDAWAIGPVAISCLGIMCTLTVVGLFLKHNETPVVKASGRELTYILLLGVLMCYSITFIYIAKPSTTVCTLRRLGLGTSFAVCYSALLTKTNRIARIFSGVKDGAQRPRFISPASQVAICGALISCQLLVAVIWLLVEVPGVRKEVTPDRRNVVTLKCN-SRDTSMLMSLTYNCILIILCTVYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFQPIFYVTASDYRVQTTTMCISVSLSGSVVLGCLFAPKVHIILFQPQKN 814          
BLAST of Metabotropic glutamate receptor vs. Ensembl Medaka
Match: grm2b (metabotropic glutamate receptor 2-like [Source:NCBI gene;Acc:101174659])

HSP 1 Score: 243.047 bits (619), Expect = 7.441e-70
Identity = 148/383 (38.64%), Postives = 220/383 (57.44%), Query Frame = 1
Query:  106 DGPPRYKILNFQKIKPGLYGWIDIGKFEN----NQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMD-PAKAIHHYPERIE-NQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELN 1236
            DG  RY I ++ K + G + +  +G ++     N   I  R L         P S C+  C+ ++     PG   CWICI CQ Y  L    T C  C  GQ P  N TGC  + + Y+      A+G +  + +GI C  TVV +F+K   +P+V+AS REL++ILL G++MC+ +T I   KP+   C++ +  +G SF+VCYSALL KTNRI RIF   +   +R   ISP SQ+++C  ++  Q+++  +WL ++ P       P+R     L CN  + +S L+ L +  ILI++CTVY F TR  PE +NE+K IGF MY+TC++WL F P ++ TA    ++  T+C+S+ LS  V L CLF PK++IILF+ + N
Sbjct:  465 DGISRYNIFHYHK-EDGKFTYRKVGYWDQILTLNTSLIPWRGL-------VPPTSQCSDPCRKNEVKSMQPGDVCCWICIPCQPYQYLQDEFT-CADCSFGQWPLANLTGCYELPEEYIRWEDAWAIGPVAISCLGIMCTLTVVGLFLKHNETPVVKASGRELTYILLLGVLMCYSITFIYIAKPSTTVCTLRRLGLGTSFAVCYSALLTKTNRIARIFSGVKDGAQRPRFISPASQVAICGALISCQLLVAVIWLLVEVPGVRKEVTPDRRNVVTLKCN-SRDTSMLMSLTYNCILIILCTVYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFQPIFYVTASDYRVQTTTMCISVSLSGSVVLGCLFAPKVHIILFQPQKN 837          
BLAST of Metabotropic glutamate receptor vs. Ensembl Medaka
Match: grm2a (glutamate metabotropic receptor 2 [Source:NCBI gene;Acc:101169193])

HSP 1 Score: 240.35 bits (612), Expect = 4.198e-69
Identity = 149/386 (38.60%), Postives = 221/386 (57.25%), Query Frame = 1
Query:  106 DGPPRYKILNFQKIKPGLYGWIDIGKFENNQL-------WIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMD-PAKAIHHYPERIE-NQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELN 1236
            D   RY I ++ K + G Y +  +G +    +       W D+          A+P S C+  C+ ++     PG   CWICI CQ Y  L    T C  C  GQ P  N TGC ++ + Y+      A+G +  + +G+     V+ +F+K   +P+V+AS RELS+ILL G++MC+ MT I   KP+   C++ +  +G SF+VCYSALL KTNRI RIF   +   +R   ISP SQ+++C  ++  Q+V++ +WL ++ P       PER +   L CN  + SS L+ L +  ILI++CTVY F TR  PE +NE+K IGF MY+TC++WL F P ++ TA    ++  T+C+S+ LS  V L CLF PKI+IILF+ + N
Sbjct:  443 DSLGRYNIFHYHK-ENGRYVYRKVGYWAQGLILNTSLIPWADQ----------AVPNSQCSDPCRKNEVKSMQPGDVCCWICIPCQPYQYLLDEFT-CADCSFGQWPLANLTGCYDLPEEYIRWEDAWAIGPVTISCLGMMSTLFVIGLFLKHNETPVVKASGRELSYILLLGVLMCYCMTFIYIAKPSTAVCTLRRLGLGTSFAVCYSALLTKTNRIARIFGGVKDGAQRPRFISPASQVAICGALISCQLVVVVVWLLLEAPGVRKEVSPERRDVVTLKCNN-RDSSMLLSLTYNCILIILCTVYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFQPIFYVTASDYRVQTTTMCISVSLSGSVVLGCLFAPKIHIILFQPQKN 815          
BLAST of Metabotropic glutamate receptor vs. Ensembl Medaka
Match: grm2a (glutamate metabotropic receptor 2 [Source:NCBI gene;Acc:101169193])

HSP 1 Score: 240.35 bits (612), Expect = 6.595e-69
Identity = 149/386 (38.60%), Postives = 221/386 (57.25%), Query Frame = 1
Query:  106 DGPPRYKILNFQKIKPGLYGWIDIGKFENNQL-------WIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMD-PAKAIHHYPERIE-NQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELN 1236
            D   RY I ++ K + G Y +  +G +    +       W D+          A+P S C+  C+ ++     PG   CWICI CQ Y  L    T C  C  GQ P  N TGC ++ + Y+      A+G +  + +G+     V+ +F+K   +P+V+AS RELS+ILL G++MC+ MT I   KP+   C++ +  +G SF+VCYSALL KTNRI RIF   +   +R   ISP SQ+++C  ++  Q+V++ +WL ++ P       PER +   L CN  + SS L+ L +  ILI++CTVY F TR  PE +NE+K IGF MY+TC++WL F P ++ TA    ++  T+C+S+ LS  V L CLF PKI+IILF+ + N
Sbjct:  474 DSLGRYNIFHYHK-ENGRYVYRKVGYWAQGLILNTSLIPWADQ----------AVPNSQCSDPCRKNEVKSMQPGDVCCWICIPCQPYQYLLDEFT-CADCSFGQWPLANLTGCYDLPEEYIRWEDAWAIGPVTISCLGMMSTLFVIGLFLKHNETPVVKASGRELSYILLLGVLMCYCMTFIYIAKPSTAVCTLRRLGLGTSFAVCYSALLTKTNRIARIFGGVKDGAQRPRFISPASQVAICGALISCQLVVVVVWLLLEAPGVRKEVSPERRDVVTLKCNN-RDSSMLLSLTYNCILIILCTVYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFQPIFYVTASDYRVQTTTMCISVSLSGSVVLGCLFAPKIHIILFQPQKN 846          
BLAST of Metabotropic glutamate receptor vs. Ensembl Medaka
Match: grm3 (metabotropic glutamate receptor 3 [Source:NCBI gene;Acc:101166047])

HSP 1 Score: 239.965 bits (611), Expect = 8.855e-69
Identity = 137/404 (33.91%), Postives = 233/404 (57.67%), Query Frame = 1
Query:  106 DGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXX---XXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMD-PAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMNSLRIGTKSSNYQS 1305
            DG  RY I ++Q+     YG++ +G++    L ++   + + +    +P S C+  C+ ++  K   G   CWIC  C+ ++ L    T C PC  GQ P  + T C ++ + Y+      A+G +    +G  C   V+ +FI+  N+P+V+AS REL +ILL G+ M + MT +   KP+   C++ +  +G SF+VCYSALL KTNRI R     + G   V+  F ISP SQ+ +C  ++ +Q+V++++WL ++ P       PER +  ++   ++ SS L+ L + ++L+++CTVY F TR  PE +NE+K IGF MY+TC++WL F+P ++ T+    ++  T+C+S+ LS  V L C+F PK++II+F+ + N     +  +N   +   ++ Y S
Sbjct:  461 DGMGRYNIFSYQR-SSERYGYVPVGEWAET-LTLNSDLIHWPRE--VVPTSQCSDPCERNEMKKMQAGEYCCWICTACEAHEYLADEFT-CAPCAPGQWPTDDLTSCYDLPEDYIMWEDAWAIGPITIACVGFMCTGLVIWVFIRHNNTPLVKASGRELCYILLSGVFMSYAMTFLFLAKPSPAICALRRLGLGTSFAVCYSALLTKTNRIARIFNGVKEGAGAVRPRF-ISPFSQVFICLSLISVQLVMVTVWLLLEVPGTRRFTLPERRQTVILKCNVRDSSMLLSLGYDVLLVILCTVYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCMFAPKVHIIMFQPQKNV-TSHRLNLNRFSVSGAAATYAS 857          
BLAST of Metabotropic glutamate receptor vs. Planmine SMEST
Match: SMESG000024379.1 (SMESG000024379.1)

HSP 1 Score: 819.305 bits (2115), Expect = 0.000e+0
Identity = 427/428 (99.77%), Postives = 427/428 (99.77%), Query Frame = 1
Query:   76 MNFSFWKPGYDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMNSLRIGTKSSNYQSLTKSHESQYFNDSIVLSK 1359
            MNFSFWKPGYDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNRIERIFRRGRRTVKRLFCISPLSQISMCFLIVLIQIVILSLWLYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMNSLRIGTKSSNYQSLTKSHESQYFNDSIVL K
Sbjct:    1 MNFSFWKPGYDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNRIERIFRRGRRTVKRLFCISPLSQISMCFLIVLIQIVILSLWLYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMNSLRIGTKSSNYQSLTKSHESQYFNDSIVLKK 428          
BLAST of Metabotropic glutamate receptor vs. Planmine SMEST
Match: SMESG000022915.1 (SMESG000022915.1)

HSP 1 Score: 442.195 bits (1136), Expect = 4.357e-144
Identity = 233/415 (56.14%), Postives = 300/415 (72.29%), Query Frame = 1
Query:   58 FICLSGMNFSFWKPGYDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMNSLRIGTKSSNYQ 1302
            F  LSG+   F    +DG PRY+ILNF K   G+Y W++IG + N +L ID  KL+FR +S+ IPISSCTPKC  DQR K HPGIC+CWICI+CQ+Y+I    +T C  C +GQ PD+N+T C+ + Q YL    P+++G+++F+ + +  A T   IF+ +  +PIV+ASSRELSFILL GI++CFV++++LCT PT   CS +KF IG SFS+CYSALLVK NRIERIFR+GR+  ++L  IS  SQI +C  IV IQI+IL   LY   +  + H+P R E  LIC++I G+S +I + HPMILIL+CTVY FLTRNIPE +NESKHIGF MYSTCVVWLGFIPCY ATA + HLR+ATLCVSI++SA+V L CLFGPK+Y ILFK + N R+G       LRI  K+   Q
Sbjct:  469 FTSLSGLEMEFTPITFDGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKG-------LRINIKNEQNQ 876          
BLAST of Metabotropic glutamate receptor vs. Planmine SMEST
Match: SMESG000033752.1 (SMESG000033752.1)

HSP 1 Score: 237.654 bits (605), Expect = 4.190e-68
Identity = 152/402 (37.81%), Postives = 243/402 (60.45%), Query Frame = 1
Query:   46 IYNLFICLSGMNFSFWKPGYDGPPRYKILNF-QKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQ-RIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQ 1245
            I N F    G   SF   G D   +Y I N+ +  K G Y + +IG+F ++ L+++  ++ +      IP S C+  C   Q RI      C CW C  C+  + +  + T+C  C  G+ P +N+TGC  +T  Y++ +  +A+  ++ + +G     +V+ +F  + N+PIVRAS RELSF++L G ++C++++ I   KPT ++C+I++  +GL F+V Y++LL KTNRI RIF   ++T KR  CISP SQ+ +C +++ +Q++  ++WL+  P   I +  ++ E  ++   I+  +FL+ L + M+LI VCT Y   TR IPE +NESK IGF MY+TCV+WL FI  YF T     ++++TL +S+ LSA VTL CLF PK++II  + E N R+
Sbjct:  465 INNSFTDSYGNLVSFDSNG-DSVGQYNIYNYIRNKKTGKYYYKNIGEFRHDGLFLNS-EVTWPGEEKEIPRSICSEDCPVGQIRIYSKESKC-CWGCSLCKSNEFVVNM-TKCEMCAEGEWPYQNRTGCYLLTVHYMKLSGWLAIIPMILSFLGTATTTSVMGVFYYYKNTPIVRASGRELSFLILSGCLVCYLVSFIFLLKPTPYSCAIQRILLGLGFAVMYASLLTKTNRIARIFESAQKTAKRPPCISPKSQLMICAVLISVQLLSNAIWLFFSPP-GIRYDRKKPEFPVLKCKIETKTFLVSLVYNMLLISVCTYYAIKTRKIPENFNESKFIGFTMYTTCVIWLAFITIYFGTLHSFEVQISTLGISVSLSAWVTLICLFFPKLHIIFLQPEKNVRK 861          
BLAST of Metabotropic glutamate receptor vs. Planmine SMEST
Match: SMESG000033752.1 (SMESG000033752.1)

HSP 1 Score: 237.654 bits (605), Expect = 5.582e-68
Identity = 152/402 (37.81%), Postives = 243/402 (60.45%), Query Frame = 1
Query:   46 IYNLFICLSGMNFSFWKPGYDGPPRYKILNF-QKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQ-RIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTVKRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQ 1245
            I N F    G   SF   G D   +Y I N+ +  K G Y + +IG+F ++ L+++  ++ +      IP S C+  C   Q RI      C CW C  C+  + +  + T+C  C  G+ P +N+TGC  +T  Y++ +  +A+  ++ + +G     +V+ +F  + N+PIVRAS RELSF++L G ++C++++ I   KPT ++C+I++  +GL F+V Y++LL KTNRI RIF   ++T KR  CISP SQ+ +C +++ +Q++  ++WL+  P   I +  ++ E  ++   I+  +FL+ L + M+LI VCT Y   TR IPE +NESK IGF MY+TCV+WL FI  YF T     ++++TL +S+ LSA VTL CLF PK++II  + E N R+
Sbjct:  480 INNSFTDSYGNLVSFDSNG-DSVGQYNIYNYIRNKKTGKYYYKNIGEFRHDGLFLNS-EVTWPGEEKEIPRSICSEDCPVGQIRIYSKESKC-CWGCSLCKSNEFVVNM-TKCEMCAEGEWPYQNRTGCYLLTVHYMKLSGWLAIIPMILSFLGTATTTSVMGVFYYYKNTPIVRASGRELSFLILSGCLVCYLVSFIFLLKPTPYSCAIQRILLGLGFAVMYASLLTKTNRIARIFESAQKTAKRPPCISPKSQLMICAVLISVQLLSNAIWLFFSPP-GIRYDRKKPEFPVLKCKIETKTFLVSLVYNMLLISVCTYYAIKTRKIPENFNESKFIGFTMYTTCVIWLAFITIYFGTLHSFEVQISTLGISVSLSAWVTLICLFFPKLHIIFLQPEKNVRK 876          
BLAST of Metabotropic glutamate receptor vs. Planmine SMEST
Match: SMESG000064049.1 (SMESG000064049.1)

HSP 1 Score: 194.512 bits (493), Expect = 8.859e-53
Identity = 130/416 (31.25%), Postives = 225/416 (54.09%), Query Frame = 1
Query:  106 DGPPRYKILNFQ-----KIKPGLYGWIDIGKFENNQLWIDRRKLRF-------RKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKL--KTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNXXXXXXXXXXXTV--KRLFCISPLSQISMCFXXXXXXXXXXXXXXYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMN-SLRIGTKSSNYQ 1302
            D P RY I+N+Q     K     Y +  IG ++ N L I+   +++       R N T+I  S C+  C+ DQ   F      CW C  C + +I NK      C  C+ G  P+ +++ C  I   +L+ +    +  ++F+ +G+     +V IF K+ N+P+V++ +REL +++L G+ + ++ T  L  KPT F+C + +   GLSFS+ + +L+ KTNRI RI    ++ +  ++   ++  +QI + FL+ +++I+I+S+ ++ +  K+   Y      +LICN  +     I +    +L+  CT Y F TRN+PE +NE+K IGF MY+TC++W+G +  Y +    T+L+  +LC ++  +A + +  LF PK+YIILFK E N R            IG+  + Y+
Sbjct:  283 DPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIK-SHCSDPCKFDQIRIFRERKKCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDASVIVAIIFSIVGLIITVIIVGIFAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNRICRILSISKKKIIRRKGRFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICN-TESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLS----TNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGKTEYE 692          
The following BLAST results are available for this feature:
BLAST of Metabotropic glutamate receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRM32.025e-7538.89glutamate metabotropic receptor 3 [Source:HGNC Sym... [more]
GRM79.438e-6736.36glutamate metabotropic receptor 7 [Source:HGNC Sym... [more]
GRM71.631e-6536.36glutamate metabotropic receptor 7 [Source:HGNC Sym... [more]
GRM71.801e-6536.36glutamate metabotropic receptor 7 [Source:HGNC Sym... [more]
GRM71.964e-6536.36glutamate metabotropic receptor 7 [Source:HGNC Sym... [more]
back to top
BLAST of Metabotropic glutamate receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mgl-12.082e-6836.19Probable metabotropic glutamate receptor mgl-1 [S... [more]
mgl-12.082e-6836.19Probable metabotropic glutamate receptor mgl-1 [S... [more]
mgl-15.292e-6836.19Probable metabotropic glutamate receptor mgl-1 [S... [more]
mgl-19.848e-6836.19Probable metabotropic glutamate receptor mgl-1 [S... [more]
mgl-11.129e-6736.19Probable metabotropic glutamate receptor mgl-1 [S... [more]
back to top
BLAST of Metabotropic glutamate receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtt1.270e-10344.39gene:FBgn0050361 transcript:FBtr0088756[more]
mtt2.238e-10144.39gene:FBgn0050361 transcript:FBtr0273326[more]
mtt2.159e-10044.39gene:FBgn0050361 transcript:FBtr0273327[more]
mtt8.060e-10044.39gene:FBgn0050361 transcript:FBtr0273325[more]
mtt1.273e-9944.39gene:FBgn0050361 transcript:FBtr0330608[more]
back to top
BLAST of Metabotropic glutamate receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grm2b2.487e-7039.25glutamate receptor, metabotropic 2b [Source:ZFIN;A... [more]
grm2b3.292e-7040.00glutamate receptor, metabotropic 2b [Source:ZFIN;A... [more]
grm2b3.292e-7040.00glutamate receptor, metabotropic 2b [Source:ZFIN;A... [more]
grm2b3.292e-7040.00glutamate receptor, metabotropic 2b [Source:ZFIN;A... [more]
grm2a3.355e-7036.93glutamate receptor, metabotropic 2a [Source:ZFIN;A... [more]
back to top
BLAST of Metabotropic glutamate receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfn12.299e-7337.19mitofusin 1 [Source:Xenbase;Acc:XB-GENE-998114][more]
GRM28.809e-6737.41glutamate receptor, metabotropic 2 [Source:NCBI ge... [more]
GRM51.094e-6336.00glutamate receptor, metabotropic 5 [Source:NCBI ge... [more]
GRM52.520e-6336.00glutamate receptor, metabotropic 5 [Source:NCBI ge... [more]
GRM52.757e-6336.00glutamate receptor, metabotropic 5 [Source:NCBI ge... [more]
back to top
BLAST of Metabotropic glutamate receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Grm31.596e-7638.62glutamate receptor, metabotropic 3 [Source:MGI Sym... [more]
Grm71.130e-6536.60glutamate receptor, metabotropic 7 [Source:MGI Sym... [more]
Grm71.389e-6536.60glutamate receptor, metabotropic 7 [Source:MGI Sym... [more]
Grm53.287e-6335.64glutamate receptor, metabotropic 5 [Source:MGI Sym... [more]
Grm53.287e-6335.64glutamate receptor, metabotropic 5 [Source:MGI Sym... [more]
back to top
BLAST of Metabotropic glutamate receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9QYS2|GRM3_MOUSE1.116e-7538.62Metabotropic glutamate receptor 3 OS=Mus musculus ... [more]
sp|Q14832|GRM3_HUMAN9.726e-7538.89Metabotropic glutamate receptor 3 OS=Homo sapiens ... [more]
sp|Q1ZZH1|GRM3_MACFA1.789e-7438.62Metabotropic glutamate receptor 3 OS=Macaca fascic... [more]
sp|P31422|GRM3_RAT4.884e-7438.10Metabotropic glutamate receptor 3 OS=Rattus norveg... [more]
sp|Q5RAL3|GRM3_PONAB8.532e-7438.62Metabotropic glutamate receptor 3 OS=Pongo abelii ... [more]
back to top
BLAST of Metabotropic glutamate receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUL03.119e-14156.14GCR106 OS=Schmidtea mediterranea OX=79327 GN=gcr10... [more]
A0A0A9XNL61.922e-11244.44Metabotropic glutamate receptor 7 OS=Lygus hesperu... [more]
A0A0L7R3U05.976e-10945.28Metabotropic glutamate receptor 8 (Fragment) OS=Ha... [more]
A0A2A3E9Y41.557e-10845.04Metabotropic glutamate receptor OS=Apis cerana cer... [more]
T1IGY41.913e-10846.40G_PROTEIN_RECEP_F3_4 domain-containing protein OS=... [more]
back to top
BLAST of Metabotropic glutamate receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grm2a4.932e-7038.23metabotropic glutamate receptor 2 [Source:NCBI gen... [more]
grm2b6.104e-7040.44metabotropic glutamate receptor 2-like [Source:NCB... [more]
grm2b1.557e-6941.44metabotropic glutamate receptor 2-like [Source:NCB... [more]
grm32.962e-6833.66metabotropic glutamate receptor 3 [Source:NCBI gen... [more]
grm34.067e-6833.66metabotropic glutamate receptor 3 [Source:NCBI gen... [more]
back to top
BLAST of Metabotropic glutamate receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grm31.081e-5835.43glutamate receptor, metabotropic 3 [Source:ZFIN;Ac... [more]
ENSPMAT00000003019.17.848e-5837.06pep scaffold:Pmarinus_7.0:GL478098:6745:34806:-1 g... [more]
ENSPMAT00000007590.12.170e-5235.46pep scaffold:Pmarinus_7.0:GL478498:6932:63706:-1 g... [more]
casr1.213e-3027.32calcium-sensing receptor [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000004832.17.174e-2842.06pep scaffold:Pmarinus_7.0:GL494148:1537:3056:-1 ge... [more]
back to top
BLAST of Metabotropic glutamate receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Metabotropic glutamate receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352534.446e-5432.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476271.816e-4531.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317674.897e-4429.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428158.201e-4126.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO413151.258e-3931.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Metabotropic glutamate receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grm2b3.602e-7038.64metabotropic glutamate receptor 2-like [Source:NCB... [more]
grm2b7.441e-7038.64metabotropic glutamate receptor 2-like [Source:NCB... [more]
grm2a4.198e-6938.60glutamate metabotropic receptor 2 [Source:NCBI gen... [more]
grm2a6.595e-6938.60glutamate metabotropic receptor 2 [Source:NCBI gen... [more]
grm38.855e-6933.91metabotropic glutamate receptor 3 [Source:NCBI gen... [more]
back to top
BLAST of Metabotropic glutamate receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024379.10.000e+099.77SMESG000024379.1[more]
SMESG000022915.14.357e-14456.14SMESG000022915.1[more]
SMESG000033752.14.190e-6837.81SMESG000033752.1[more]
SMESG000033752.15.582e-6837.81SMESG000033752.1[more]
SMESG000064049.18.859e-5331.25SMESG000064049.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020660 ID=SMED30020660|Name=Metabotropic glutamate receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=1769bp
CAATAAATATATATATATATACATAATTTAATTTAATCATTAAATATTTA
TAATCTTTTTATATGTCTATCCGGCATGAATTTTTCATTTTGGAAACCCG
GTTATGATGGACCTCCACGCTATAAAATATTGAATTTTCAAAAGATCAAG
CCAGGACTTTACGGATGGATTGACATTGGGAAATTTGAAAATAATCAACT
TTGGATTGACAGGAGGAAATTGAGATTTCGGAAAAATTCAACTGCCATTC
CAATATCGTCTTGTACGCCGAAATGTCAATCAGATCAAAGGATTAAGTTT
CATCCGGGAATTTGCTCTTGTTGGATTTGTATACGCTGCCAAAAATATGA
TATTTTAAACAAATTGAAAACAGAATGTCTTCCCTGCGAAATGGGACAAA
TACCGGATAAAAATAAAACCGGATGTATAAATATAACTCAAAGTTATTTA
GAACCGAACAGCCCAATTGCTTTGGGGATTTTACTGTTCACATCTATGGG
AATTTGTTGCGCGGCTACAGTTGTTATTATTTTTATCAAATTTATCAATT
CCCCAATTGTTCGTGCGTCGAGTAGGGAACTCAGTTTCATTTTATTATTC
GGGATAATGATGTGTTTTGTAATGACTATCATTTTGTGTACGAAGCCGAC
AGATTTCAATTGTTCCATTGAAAAGTTTTGTATAGGTCTTAGCTTTTCAG
TTTGTTACTCGGCACTGCTTGTTAAAACAAACAGAATTGAACGAATATTT
CGACGGGGCCGAAGAACTGTTAAACGGCTATTTTGTATATCTCCATTGTC
ACAAATTTCAATGTGTTTTCTAATAGTTTTAATCCAAATTGTAATTTTAT
CTTTATGGCTCTACATGGATCCCGCCAAAGCTATTCATCACTACCCGGAA
AGGATTGAAAACCAACTCATTTGTAACTTCATTAAAGGAAGTTCATTTCT
AATAGGATTATGTCATCCGATGATTTTAATTTTGGTCTGTACTGTCTATG
TCTTTCTAACAAGAAACATTCCAGAAGGTTATAATGAGAGTAAGCACATT
GGATTTGCCATGTACAGCACTTGTGTCGTTTGGCTTGGGTTTATTCCGTG
CTACTTTGCCACTGCTAAACTGACTCATCTTAGATTAGCAACTTTGTGTG
TTTCAATTGACTTATCAGCTATGGTGACATTATTTTGTTTATTCGGACCA
AAAATATATATCATATTATTCAAGCAAGAACTTAATACTAGACAGGGCAT
GAAACCAATGATGAATAGCTTAAGAATTGGAACGAAATCTTCAAATTATC
AATCTTTGACAAAATCTCACGAATCCCAATATTTCAATGATTCTATAGTT
TTAAGTAAATATTTTATTCATCTATATCAGTGTTTCTCAAACTACGTTCC
GCGGAATCCTAGAGTTCCGAGGTACCAGAAAGCTTGAGAAACACTAATCT
ATATTATTATGCATGGTAAGAGTTGAACAATCAATATTTAAAAGAATTAA
TTATTTGCTTTTAAAAAGCATTAATTAAAACAATTAATTAAAACATTAAT
CTTATACATAAAAGATCATTTCGAATAATAATTGCGGAAGGGTTATAACA
TTTGTTAACAAAAACAGAATTATAAATATTTGACAGGCAATGACTAATGA
AGTTTTTCGAGAAAGTTTGTGGGTAACTGGTATATCCAAAAATATACGGG
GAGGAGGGGGGTTGTGACTTAGTAAAATATTTTAATCGTTGGTTAAAATA
AACAATTAGCATGCAGAAT
back to top

protein sequence of SMED30020660-orf-1

>SMED30020660-orf-1 ID=SMED30020660-orf-1|Name=SMED30020660-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=454bp
MNFSFWKPGYDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLR
FRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTE
CLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVV
IIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEK
FCIGLSFSVCYSALLVKTNRIERIFRRGRRTVKRLFCISPLSQISMCFLI
VLIQIVILSLWLYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMI
LILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLT
HLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMNSLR
IGTKSSNYQSLTKSHESQYFNDSIVLSKYFIHLYQCFSNYVPRNPRVPRY
QKA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR038550GPCR_3_9-Cys_sf
IPR000337GPCR_3
IPR000162GPCR_3_mtglu_rcpt
IPR017978GPCR_3_C
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005886plasma membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000337GPCR, family 3PRINTSPR00248GPCRMGRcoord: 297..320
score: 38.8
coord: 320..341
score: 59.94
coord: 204..225
score: 59.23
coord: 159..181
score: 56.66
coord: 243..266
score: 28.91
IPR000162GPCR, family 3, metabotropic glutamate receptorPRINTSPR00593MTABOTROPICRcoord: 200..214
score: 45.61
coord: 356..370
score: 54.74
IPR017978GPCR family 3, C-terminalPFAMPF000037tm_3coord: 144..379
e-value: 4.8E-55
score: 186.9
IPR017978GPCR family 3, C-terminalPROSITEPS50259G_PROTEIN_RECEP_F3_4coord: 131..396
score: 53.695
IPR038550GPCR, family 3, nine cysteines domain superfamilyGENE3DG3DSA:2.10.50.30coord: 57..133
e-value: 1.7E-14
score: 55.3
NoneNo IPR availablePANTHERPTHR24060METABOTROPIC GLUTAMATE RECEPTORcoord: 3..398
NoneNo IPR availablePANTHERPTHR24060:SF155MANGETOUT, ISOFORM Gcoord: 3..398
NoneNo IPR availableCDDcd150457tmC_mGluRscoord: 130..382
e-value: 8.54556E-113
score: 329.591
NoneNo IPR availableTMHMMTMhelixcoord: 197..216
NoneNo IPR availableTMHMMTMhelixcoord: 135..157
NoneNo IPR availableTMHMMTMhelixcoord: 290..312
NoneNo IPR availableTMHMMTMhelixcoord: 169..187
NoneNo IPR availableTMHMMTMhelixcoord: 236..258
NoneNo IPR availableTMHMMTMhelixcoord: 325..347
NoneNo IPR availableTMHMMTMhelixcoord: 360..382