PKD1L-2

Overview
NamePKD1L-2 (AKN21725.1)
Smed IDSMED30020654
Length (bp)4753
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PKD1L-2 (SMED30020654) t-SNE clustered cells

Violin plots show distribution of expression levels for PKD1L-2 (SMED30020654) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PKD1L-2 (SMED30020654) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PKD1L-2 (SMED30020654) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020654

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30020654SMESG000014725.1 SMESG000014723.1 SmedASXL_014419SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30020654SMESG000014725.1 SMESG000014723.1 dd_Smed_v4_13975_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
neuronSMED30020654SMESG000014725.1 SMESG000014723.1 dd_Smed_v4_13975_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30020654SMESG000014725.1 SMESG000014723.1 dd_Smed_v4_13975_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal-ventral axis of the whole animalSMED30020654SMESG000014725.1 SMESG000014723.1 dd_Smed_v4_13975_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
headSMED30020654SMESG000014725.1 SMESG000014723.1 dd_Smed_v6_13975_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neuronSMED30020654SMESG000014725.1 SMESG000014723.1 dd_Smed_v6_13975_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PKD1L-2 vs. Ensembl Human
Match: PKD1L2 (polycystin 1 like 2 (gene/pseudogene) [Source:HGNC Symbol;Acc:HGNC:21715])

HSP 1 Score: 149.443 bits (376), Expect = 2.977e-35
Identity = 100/338 (29.59%), Postives = 171/338 (50.59%), Query Frame = 2
Query: 1217 WNFNMEVWQDFSASVDDTSDISNINFKSNFLGTFSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMW--RKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVL-LEIKRDEK-FQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIF 2218
            W+   E W D    V   +     +   N L  F +   +  N I+       FA+   N  VV  V  L  +  L++   +W  RKD ++   ++   L DNDP  +Y Y+++V+TG  R A TSS + + L G  G      + D     +FE G V  F+++T  PLG+L +LR+WH++SG +PSW + ++++ D+  ++ + F+C +WLS +  D   ++V  +  ++D K F +LF     +G  D HI   I +    S +TRVQ+V+   ++    M+++ MF+G   +    A  K+D G I  TW +   G+ S ++ +P   +  +IF
Sbjct:  600 WDEVQETWDDSGCQVGPRTSPYQTHCLCNHLTFFGSTFLVMSNAINIHQTAELFATFEDNPVVVTTVGCLCVVYVLVV---IWARRKDAQDQAKVKVTVLEDNDPFAQYHYLVTVYTGHRRGAATSSKVTVTLYGLDGEREPHHLADP-DTPVFERGAVDAFLLSTLFPLGELRSLRLWHDNSGDRPSWYVSRVLVYDLVMDRKWYFLCNSWLSINVGDCVLDKVFPVATEQDRKQFSHLFFMKTSAGFQDGHIWYSIFSRCARSSFTRVQRVSCCFSLLLCTMLTSIMFWGVPKD---PAEQKMDLGKIEFTWQEVMIGLESSILMFPINLLIVQIF 930          

HSP 2 Score: 54.299 bits (129), Expect = 2.828e-6
Identity = 71/278 (25.54%), Postives = 115/278 (41.37%), Query Frame = 2
Query: 2288 LPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILLIIFVLAKKLLGAVSTDQEANI----DEFVKDDLKKVLGANLN-------PPDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIK--SNVQTYMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVPCNENYNLLSEDTRSFSVKW--TPLANSSV 3076
            LP   I VGW L+      + FFT LY L +G   S +WL +  V     +F++ P+ +L        +L  V  D+E  +       +  D   +  A  N       PP    +EK+K      Q+   ++ + L Y+  L +L  +AY  R    +   + ++  F +  S V  + +F+ WA   L            N  G     I   +    G  +IRQ+RV+ ++C + A   + Y N  C   Y+L +ED   +   W  T L+N S 
Sbjct: 1132 LPWWCILVGWLLVAATSGVAAFFTMLYGLHYGRASSLRWLISMAVSFVESMFVTQPLKVLGFAAFFALVLKRVD-DEEDTVAPLPGHLLGPDPYALFRARRNSSRDVYQPPLTAAIEKMKTTHLKEQKAFALIREILAYLGFLWMLLLVAYGQRDPSAYHLNRHLQHSFTRGFSGVLGFREFFKWANTTLVS----------NLYGHPPGFITDGNSKLVGSAQIRQVRVQESSCPL-AQQPQAYLNG-CRAPYSLDAEDMADYGEGWNATTLSNGST 1396          
BLAST of PKD1L-2 vs. Ensembl Human
Match: PKD1L2 (polycystin 1 like 2 (gene/pseudogene) [Source:HGNC Symbol;Acc:HGNC:21715])

HSP 1 Score: 149.058 bits (375), Expect = 3.984e-35
Identity = 100/338 (29.59%), Postives = 171/338 (50.59%), Query Frame = 2
Query: 1217 WNFNMEVWQDFSASVDDTSDISNINFKSNFLGTFSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMW--RKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVL-LEIKRDEK-FQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIF 2218
            W+   E W D    V   +     +   N L  F +   +  N I+       FA+   N  VV  V  L  +  L++   +W  RKD ++   ++   L DNDP  +Y Y+++V+TG  R A TSS + + L G  G      + D     +FE G V  F+++T  PLG+L +LR+WH++SG +PSW + ++++ D+  ++ + F+C +WLS +  D   ++V  +  ++D K F +LF     +G  D HI   I +    S +TRVQ+V+   ++    M+++ MF+G   +    A  K+D G I  TW +   G+ S ++ +P   +  +IF
Sbjct: 1285 WDEVQETWDDSGCQVGPRTSPYQTHCLCNHLTFFGSTFLVMSNAINIHQTAELFATFEDNPVVVTTVGCLCVVYVLVV---IWARRKDAQDQAKVKVTVLEDNDPFAQYHYLVTVYTGHRRGAATSSKVTVTLYGLDGEREPHHLADP-DTPVFERGAVDAFLLSTLFPLGELRSLRLWHDNSGDRPSWYVSRVLVYDLVMDRKWYFLCNSWLSINVGDCVLDKVFPVATEQDRKQFSHLFFMKTSAGFQDGHIWYSIFSRCARSSFTRVQRVSCCFSLLLCTMLTSIMFWGVPKD---PAEQKMDLGKIEFTWQEVMIGLESSILMFPINLLIVQIF 1615          

HSP 2 Score: 54.299 bits (129), Expect = 2.360e-6
Identity = 71/278 (25.54%), Postives = 115/278 (41.37%), Query Frame = 2
Query: 2288 LPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILLIIFVLAKKLLGAVSTDQEANI----DEFVKDDLKKVLGANLN-------PPDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIK--SNVQTYMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVPCNENYNLLSEDTRSFSVKW--TPLANSSV 3076
            LP   I VGW L+      + FFT LY L +G   S +WL +  V     +F++ P+ +L        +L  V  D+E  +       +  D   +  A  N       PP    +EK+K      Q+   ++ + L Y+  L +L  +AY  R    +   + ++  F +  S V  + +F+ WA   L            N  G     I   +    G  +IRQ+RV+ ++C + A   + Y N  C   Y+L +ED   +   W  T L+N S 
Sbjct: 1817 LPWWCILVGWLLVAATSGVAAFFTMLYGLHYGRASSLRWLISMAVSFVESMFVTQPLKVLGFAAFFALVLKRVD-DEEDTVAPLPGHLLGPDPYALFRARRNSSRDVYQPPLTAAIEKMKTTHLKEQKAFALIREILAYLGFLWMLLLVAYGQRDPSAYHLNRHLQHSFTRGFSGVLGFREFFKWANTTLVS----------NLYGHPPGFITDGNSKLVGSAQIRQVRVQESSCPL-AQQPQAYLNG-CRAPYSLDAEDMADYGEGWNATTLSNGST 2081          
BLAST of PKD1L-2 vs. Ensembl Human
Match: PKD1L3 (polycystin 1 like 3, transient receptor potential channel interacting [Source:HGNC Symbol;Acc:HGNC:21716])

HSP 1 Score: 135.961 bits (341), Expect = 3.093e-31
Identity = 86/338 (25.44%), Postives = 167/338 (49.41%), Query Frame = 2
Query: 1217 WNFNMEVWQDFSASVDDTSDISNINFKSNFLGTFSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMW--RKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVLLEIKRDE--KFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIF 2218
            W  + + W      V   S I       N L  F++  F+ P  ++ ++    F  +  N   V ++  L+    + +   +W  +KD+ +   ++   L DNDP  ++ Y+I V+TG  R+A T++ + I L G  G S    + D  +  +FE G +  F++TT + LG+L +LR+WH++SG+ PSW + ++++ D+   + + F+C  WL+    D   +RV + + + E   F++LF  M V      ++   I      + +TRVQ+++  +T+    MV N MF+ K N+ +   + ++     ++ W +    I + +I +P   +   +F
Sbjct:  638 WEIHNQTWSSAGCQVGPQSTILRTQCLCNHLTFFASDFFVVPRTVNVEDTIKLFLRVTNNPVGVSLLASLLGFYVITV---VWARKKDQADMQKVKVTVLADNDPSAQFHYLIQVYTGYRRSAATTAKVVITLYGSEGRSEPHHLCDPQKT-VFERGGLDVFLLTTWTSLGNLHSLRLWHDNSGVSPSWYVSQVIVCDMAVKRKWHFLCNCWLAVDLGDCELDRVFIPVSKRELFSFRHLFSSMIVEKFTQDYLWLSIATRHPWNQFTRVQRLSCCMTLLLCNMVINVMFW-KINSTTAKRDEQMR--PFAVAWSELLVSIHTAVILFPINLVIGRLF 968          
BLAST of PKD1L-2 vs. Ensembl Human
Match: PKD2L1 (polycystin 2 like 1, transient receptor potential cation channel [Source:HGNC Symbol;Acc:HGNC:9011])

HSP 1 Score: 114.39 bits (285), Expect = 7.301e-25
Identity = 104/451 (23.06%), Postives = 201/451 (44.57%), Query Frame = 2
Query: 2774 VQTYMDFYDWAQG-ILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDE 4123
            + +  DF+D+AQG +L+  Y   WYNN +  G  + +    + +  G  R+RQ++V+ ++C +             +E++    ED  S    ++P     + F   N              A+ Y +    GG+   G    Y GGGY   L   ++ +A  +R LQ   WLD+ TR +F + +VYN N NLF  ++++ E P +GG  +  + +R+ +L  Y+      ++  ++++ + +   +  EI ++   +  Y SS WN+++L+ I LS+  +     R +     +  L      Y  F+    W      +  ++ F + I++ KY+ FNK ++ +  T+ R    +     MF     A+  +G +LF      F+  +    + F + +    Y  +         A +      +    + ++F+ I+NDTY+E  +E
Sbjct:  151 ISSMADFWDFAQGPLLDSLYWTKWYNNQS-LGHGSHSFIYYENMLLGVPRLRQLKVRNDSCVV-------------HEDFR---EDILSCYDVYSPDKEEQLPFGPFNGT------------AWTYHSQDELGGFSHWGRLTSYSGGGYYLDLPGSRQGSAEALRALQEGLWLDRGTRVVFIDFSVYNANINLFCVLRLVVEFPATGG-AIPSWQIRTVKLIRYVSNWDFFIVGCEVIFCVFIFYYVVEEILELHIHRLRYLSSIWNILDLVVILLSIVAVGFHIFRTLEVNRLMGKLLQQPNTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAVMFFIVFFAYAQLGYLLFGTQVENFSTFIKCIFTQFRIILGDFDYNAIDNANRILGPAYFVTYVFFVFFVLL-NMFLAIINDTYSEVKEE 570          
BLAST of PKD1L-2 vs. Ensembl Human
Match: PKDREJ (polycystin family receptor for egg jelly [Source:HGNC Symbol;Acc:HGNC:9015])

HSP 1 Score: 105.531 bits (262), Expect = 7.189e-22
Identity = 79/320 (24.69%), Postives = 157/320 (49.06%), Query Frame = 2
Query: 1268 TSDISNINFKSNFLGTFSAKIFIAPNMIDFK-NVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMWRKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVLLEIKRDEKF--QNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIF 2218
            T  ++ I+  ++++    AK+ + PN +D + N+     SL  N   +  V+ +I +   L    ++R +  + +      L DNDP     Y++++ TGS   +GT +++F+ L G   +S    ++  +   L+  G++  F++TT S LGD+ ++R+WHN+ G  PSW L ++ +E++ +  +++F+C+ WLS    D   +R       DE+   ++ F     S +   H+   I  +     + R+Q+++  + M    ++ N MFF  +     ++  +     + I       GI SVLIT P   + + +F
Sbjct: 1146 TIGLTGIHLHTHYV---MAKVIVIPNPVDLRLNIIK---SLHQNPVTLFTVLFIILLYVGLAFWALYRDEMDQHLRGHVIVLPDNDPYDNLCYLVTIFTGSRWGSGTRANVFVQLRGTVSTSDVHCLSHPHFTTLYR-GSINTFLLTTKSDLGDIHSIRVWHNNEGRSPSWYLSRIKVENLFSRHIWLFICQKWLS---VDTTLDRTFHVTHPDERLTRKDFFFIDVSSNLRKNHMWFSIFASVVAKTFNRLQRLSCCLAMLLSSLLCNIMFFNLNRQEQTESRERKYMRSMMI-------GIESVLITIPVQLLITFLF 1448          

HSP 2 Score: 93.2041 bits (230), Expect = 4.267e-18
Identity = 152/654 (23.24%), Postives = 271/654 (41.44%), Query Frame = 2
Query: 2258 QEAKMKKMFLLPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDP--IILLIIFVLAK------------------KLLGAVSTDQEANIDEFVKDDLKKVLGANLNPPDQEKLEKIKKDKASGQRLSRV-VGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIK--SNVQTYMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVK--RNTCTISA--LVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSP--TQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRL--YDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITS---VFICILNDTYAETI 4117
            Q+ K K   +LP   ++V W L+F     S FF   Y L +G +KS +WL   F      V L  P  IILL  F   K                  +L G     +E    + + D + ++ G  +  P  E   +I K K   +R + + +   LT+ + L LL  L    R    F   + IR RF    + V    D Y W    LN     + +N++N T    ++  I      G   +RQ+R K     C  +   + + +   + C+  Y +  EDT+++S  W  +   ++   D + N     P  TQ +  ++   +   SGGY     +       + ++L +K+         LQ +NWLD+ T A+  E T +N + NLF +I V+FE    G +      + S+ L  +D      I L +  +++ L  V++   E   + +++  Y  S +NL+      +   +I+    +  +    I     N   ++ F   +       I++G   F++I++ L+Y  F   + + Q  I  A   +  + F+   +   ++  G ++F  +   ++NL+ ST ++F   V+            AF +  + N    L V F++S   V IC+L + +   I
Sbjct: 1562 QQLKKKPRIVLPWWCVYVAWFLVFATSSISSFFIVFYGLTYGYDKSIEWLFASFCSFCQSVLLVQPSKIILLSGFRTNKPKYCKNLSWSTKYKYTEIRLDGMRMHPEEM---QRIHDQIVRIRGTRMYQPLTEDEIRIFKRKKRIKRRALLFLSYILTHFIFLALLLILIVLLRHTDCFYYNQFIRDRFSMDLATVTKLEDIYRW----LNSVLLPLLHNDLNPTFLPESSSKIL-----GLPLMRQVRAKSSEKMCLPAEKFVQNSIRREIHCHPKYGIDPEDTKNYSGFWNEVDKQAI---DESTNGFTYKPQGTQWLYYSYGLLHTYGSGGY---ALYFFPEQQRFNSTLRLKE---------LQESNWLDEKTWAVVLELTTFNPDINLFCSISVIFEVSQLGVVNT-SISLHSFSLADFDRKASAEIYLYVAILIFFLAYVVD---EGCIIMQERASYVRSVYNLLNFALKCIFTVLIVLFLRKHFLATGIIRFYLSNPEDFIPFHAVSQVDHIMRIILGFLLFLTILKTLRYSRFFYDVRLAQRAIQAALPGICHMAFVVSVYFFVYMAFGYLVFGQHEWNYSNLIHSTQTVFSYCVS------------AFQNTEFSNN-RILGVLFLSSFMLVMICVLINLFQAVI 2171          
BLAST of PKD1L-2 vs. Ensembl Celegans
Match: pkd-2 (Polycystin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U1S7])

HSP 1 Score: 97.4413 bits (241), Expect = 4.409e-20
Identity = 114/462 (24.68%), Postives = 203/462 (43.94%), Query Frame = 2
Query: 2780 TYMD-FYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASL---GMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMV 4153
            T MD  +DW   +L    P +++   + + D    I   + L   P RIR ++V  ++CT+     +      C  NY    ED        T + + SV                   +AF+Y            GT   YGGGG++  L   G  + Q+A  I  L+AN W+D+ +RAI  +  +YN N NLF  +++LFE P SGG+   P  + +Y L  Y       +++ + ++   ++  I+ E+  + + +  Y +  WNLV+++ +  S++ II +  R    +N +  +  N      FD  TS   +   +     FV+ ++V K++  NK +S +  T+ R+   +     MF  F  AF   G + F      ++NL  S  +L  + +    +  + E+   F    ++  +     F + ++F+ I+ND+Y E   E     D E +
Sbjct:  126 TSMDNIWDWLSQVL---IPGIYWTETSNSTDNENMIYYENRLLGEP-RIRMLKVTNDSCTVMKSFQREIKE--CFANYEEKLEDK-------TMVGDGSV-------------------DAFIYATAKELENLKTVGTIASYGGGGFVQRLPVAGSTEAQSA--IATLKANRWIDRGSRAIIVDFALYNANINLFCVVKLLFELPASGGVITTP-KLMTYDLLTYQTSGGTRMMIFEGIFCGFILYFIFEELFAIGRHRLHYLTQFWNLVDVVLLGFSVATIILSVNRTKTGVNRVNSVIENGLTNAPFDDVTSSENSYLNIKACVVFVAWVKVFKFISVNKTMSQLSSTLTRSAKDIGGFAVMFAVFFFAFAQFGYLCFGTQIADYSNLYNSAFALLRLILGDFNFSAL-ESCNRFFGPAFFIAYVFFVSFILLNMFLAIINDSYVEVKAELARKKDGEGI 551          
BLAST of PKD1L-2 vs. Ensembl Celegans
Match: lov-1 (Location of vulva defective 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09624])

HSP 1 Score: 88.5817 bits (218), Expect = 4.175e-17
Identity = 56/149 (37.58%), Postives = 78/149 (52.35%), Query Frame = 2
Query: 1475 RRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSS---GHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGI--KPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVL-LEIKR 1903
            R+++   R   L DN+P   Y YVI+V TG    A T S I  NL G  G       R   DG  +  F  GT   FVMTT  PLG+L  +R+W + +G+  + SW   +++++D+QT  +Y F    WL     DG TER+  +E KR
Sbjct: 2268 RKDASRGRLRFLKDNEPHDGYMYVIAVETGYRMFATTDSTICFNLSGNEGDQIFRSFRSEEDGNWEFPFSWGTTDRFVMTTAFPLGELEYMRLWLDDAGLDHRESWYCNRIIVKDLQTQDIYYFPFNNWLGTKNGDGETERLARVEYKR 2416          

HSP 2 Score: 72.0182 bits (175), Expect = 4.552e-12
Identity = 92/400 (23.00%), Postives = 165/400 (41.25%), Query Frame = 2
Query: 2771 NVQTYMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNT-CTISALVSKVYGNV-PCNENYNLLSED-TRSFSVKWTPLA--NSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIK--------------------KVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKG-FYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTV 3892
            ++Q   DF+DWA+  L  +    WY+  N    +   +        G   IRQ+R K++  CT   +  +  G +  C E     +E+ T      WT L   N + + ++  +  +    T+TV +  LY  +   GGY                S+   Q +   +   L +  W+D  TRA+  E + YN   N F+ +Q+L E P S G+ +    V S RL      +  V+   ++LY    VL   +EI                     K+  Q      S WN ++L+   L+++ ++   +R   T  A+   N N G  Y++  +  +W       +  + F +  ++++ + FN+ I ++  T+  A   + S G  F+ F + F +V
Sbjct: 2726 SIQHADDFWDWARESLATALLASWYDG-NPAYGMRAYMNDKVSRSMGIGTIRQVRTKKSAECT---MFKQFQGYINDCGEELTSKNEEKTLYMQAGWTELESENGTDASDEYTYKTSEELSTETV-SGLLYSYS--GGGYTI--------------SMSGTQAEIITLFNKLDSERWIDDHTRAVIIEFSAYNAQINYFSVVQLLVEIPKS-GIYLPNSWVESVRLIKSEGSDGTVVKYYEMLYIFFSVLIFVKEIVFYLYGRYKVITTMKPTRNPFKIVYQLALGNFSPWNFMDLIVGALAVASVLAYTIRQRTTNRAMEDFNANNGNSYINLTEQRNWEIVFSYCLAGAVFFTSCKMIRILRFNRRIGVLAATLDNALGAIVSFGIAFLFFSMTFNSV 3103          
BLAST of PKD1L-2 vs. Ensembl Fly
Match: Pkd2 (gene:FBgn0041195 transcript:FBtr0080365)

HSP 1 Score: 94.3597 bits (233), Expect = 5.064e-19
Identity = 92/404 (22.77%), Postives = 190/404 (47.03%), Query Frame = 2
Query: 2909 GPFRIRQIRVKRNTCTISALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYG-VRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQK-KEYFSSNWNLVEXXXXX---XXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTY 4105
            GP R+RQIRV++ +C ++    + +    C   Y+  +ED +    K +P      + +D +      +P  TV+  +       +GGY                +L   +++   II +L+  +WLD+ +R    E  ++N NT++F +I+++ E P +GG+   P   +++ ++Y +     +++ ++ I + + V+     EI ++ K   K YF S  N+++   +    L+L   I  + ++M ++ A    +V    Y S D    W      +M I +F+  I++ K++ FNK +     T+ R    L+    MF    +A+  +G +LF   +  F N +TS +++  + +   +Y ++ E        +Y+  +  L  F + ++F+ I+ +TY
Sbjct:  436 GPPRLRQIRVRKESCYVNDAFIRYFNT--CYAAYSSGAEDRKPMH-KGSPFR----TMHDLDS-----TPIWTVLAFYR------TGGY--------------TVNLDYDKDRNVKIINDLKDIHWLDRGSRLCLVEFNLFNENTDIFQSIKLIAEIPPTGGV--IPQAHLQTVKMYSFFTDRSMLMTVIYIFWYIMVIYYTIYEITEIRKSGIKIYFCSMLNILDCAILLGCYLALVYNIWHSFKVM-SLTARAHSDVT---YQSLDVLCFWNIIYVDMMAILAFLVWIKIFKFISFNKTLVQFTTTLKRCSKDLAGFSLMFGIVFLAYAQLGLLLFGTKHPDFRNFITSILTMIRMILGDFQY-NLIEQANRVLGPIYFLTYILLVFFILLNMFLAIIMETY 800          
BLAST of PKD1L-2 vs. Ensembl Fly
Match: brv2 (gene:FBgn0036712 transcript:FBtr0331846)

HSP 1 Score: 53.9138 bits (128), Expect = 1.440e-6
Identity = 59/243 (24.28%), Postives = 110/243 (45.27%), Query Frame = 2
Query: 3260 IRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLY---DYLPGNMIVL----LLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNV----NKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVS 3955
            I  L+  +WLDK T A+F + T+YN + NLFT I +  E  NS      P+G++  R++     + GN+       LL+  +Y + V+L       K+         + W +V+   + + +  +  T + IM  I    +L +     KG Y+ F +     +   I+ G    ++ +R+ K + F         T+  A+  ++SLG + +  L+A      +    N V F++++ S V+
Sbjct:  289 IEYLRDYSWLDKNTSALFIDLTMYNADANLFTLITLRVE--NS------PFGIQLPRVHVDSVSMLGNVETRSNSELLILFVYTVLVILFARGVFTKIWHHPAAAHEA-WTMVD---LAIYILNVFLTVLAIMRDIETDALLQIIETATKGQYLDFQRPLRLHQMLFIVKGFLVCITTLRLWKVLQFASVFQHFTQTLFSAWRAVASLGVIILVVLMAIGITLAVPNGNNAVVFSHMVQSVVT 519          
BLAST of PKD1L-2 vs. Ensembl Fly
Match: brv2 (gene:FBgn0036712 transcript:FBtr0075242)

HSP 1 Score: 53.1434 bits (126), Expect = 1.997e-6
Identity = 59/243 (24.28%), Postives = 110/243 (45.27%), Query Frame = 2
Query: 3260 IRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLY---DYLPGNMIVL----LLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNV----NKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVS 3955
            I  L+  +WLDK T A+F + T+YN + NLFT I +  E  NS      P+G++  R++     + GN+       LL+  +Y + V+L       K+         + W +V+   + + +  +  T + IM  I    +L +     KG Y+ F +     +   I+ G    ++ +R+ K + F         T+  A+  ++SLG + +  L+A      +    N V F++++ S V+
Sbjct:  311 IEYLRDYSWLDKNTSALFIDLTMYNADANLFTLITLRVE--NS------PFGIQLPRVHVDSVSMLGNVETRSNSELLILFVYTVLVILFARGVFTKIWHHPAAAHEA-WTMVD---LAIYILNVFLTVLAIMRDIETDALLQIIETATKGQYLDFQRPLRLHQMLFIVKGFLVCITTLRLWKVLQFASVFQHFTQTLFSAWRAVASLGVIILVVLMAIGITLAVPNGNNAVVFSHMVQSVVT 541          
BLAST of PKD1L-2 vs. Ensembl Fly
Match: brv3 (gene:FBgn0040333 transcript:FBtr0340092)

HSP 1 Score: 51.2174 bits (121), Expect = 9.203e-6
Identity = 67/309 (21.68%), Postives = 142/309 (45.95%), Query Frame = 2
Query: 3257 IIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLY---DYLPGNMIVLLLMQIL----YALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITML-NVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSL----FGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKE 4147
            +I  L  N+WL   T A+F + T+YN + NLF+   +  E+   GG+ +    V S +L    D +P   ++ LL+ +L    +A T+ + ++ E             S WN ++L    +++ +++   +R  +  + +  +   +K  ++ F + +   + + I +G    ++ +R+ + + F     +   T+  A++ ++S     + FLI F      +    +  F  L+ S V      FG F A VK  ++F         L Y V + + +  + +VF+ ++ND +  T+ + + D ++E
Sbjct:  311 VIDYLSENHWLTLNTSAVFIDFTLYNVDVNLFSICTLRVEKTPFGGI-VPDVQVDSAKLLENVDQMPYTGLLALLIYVLVFIQFAQTLAVKLWYE--------PHLLKSVWNKLDLFIFMVNVLVVVLVVLRESLVASMMKKVEGASKMEFIDFRRPSRMHQLTTITIGFLICITTLRLWRVLQFASVFKLFTRTLYLAWSAVASTAIAIVIFLIGFCFAVVTINGNYSSNFNKLVKSMVMCMCYSFG-FSAQVKPSELFHGGKWL-GILCYGVLAFVIIVLLINVFVSLINDYF--TVAKTIRDSERE 606          
BLAST of PKD1L-2 vs. Ensembl Zebrafish
Match: pkd1l2a (polycystic kidney disease 1 like 2a [Source:ZFIN;Acc:ZDB-GENE-050208-89])

HSP 1 Score: 163.31 bits (412), Expect = 1.281e-39
Identity = 179/680 (26.32%), Postives = 309/680 (45.44%), Query Frame = 2
Query: 2255 DQEAKMKKMFLLPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILLIIFVLAKKLLGAVSTDQ--EANIDEFVK--DDLKKVLGANLN-------PPDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIKSNVQT--YMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPY--GVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMVDHVWNIFNEMMTGFKSSMKYTVPDALKKKAIV 4249
            ++E   K    LP  F+FVGW L+      S +FT LY L +G E+S  WL +  V  F  +F++ P+ +L   V    +L  V  D+  + +ID  +   DD   V  A  +       PP    +EK++ +    Q++  ++ + L YV  L +L  +AY  R    +  T  IR  F     +T  + D + WA    N S  +  Y      G     I   +    G  RIRQ+RV+R+TC I+  +   Y    C+  Y+  SED  S+S  W             N  RN ++ ++TV+  + YQ        P  G   +Y GGG++  LG  Q+ A+ +++ L  N WLD  TRA+F E TVYN N NLF  + ++FE   + G+  F Y   V++  LY    G  + ++  + +Y + ++  +  + K + +QK  YF S WNL+EL  I LS S +     R ++    I     NK  +VSF++  +       L+     ++ I++   +  N  + ++  T+ RA+T +S    +     +A+    N+++      +  LL +  ++  + + I  Y ++ +  P   + L  +    ++ F + ++FI ++   + E         ++E+V+ +      ++ G K   K T  DA    A V
Sbjct: 1834 EKEGSRKCQKGLPWWFVFVGWFLVLATSGVSAYFTMLYGLTYGKERSISWLISMVVSFFESLFITQPVKVLGFAVFFALVLKTVDQDEYGDVSIDGTLSNTDDPDAVRIARRDSTCSFYKPPPPTDIEKMRNNMIKEQKVFALIREILIYVGFLWMLLLVAYGQRDPNAYYLTHHIRQSFSTGISETLNHKDIFIWA----NSSLLRNLY------GQYPGFITDGNSKLVGNARIRQVRVRRDTCKIANPMQ--YSVRDCHAPYSWESEDMGSYSPGW-------------NQTRN-VNGSKTVLKPWYYQTQAKLRANPVWGGLALYKGGGFVVDLGPDQKNASRLLQYLFDNTWLDVYTRAVFVEFTVYNANVNLFCIVTLIFE---TTGVGTFQYRSEVQAVHLYQSTGGFHVFVMASEAIYYIFILYYMVVQGKLMKQQKWAYFKSKWNLLELAIIILSWSALSVFVKRTILGNRDIEFYQNNKDMFVSFNETATADAVLGYLIAFLVLLATIKLWHLLRLNPKLHMITSTLQRAWTDISGFIVVMTIMFLAYSIACNLMYGWRLNSYRTLLEAAQTIICLQLGIFNYDEVLDYNPVLGAFLIGSCIIFMT-FVVLNLFISVILVAFNEEQLHPTPSEEEEIVELMLMKVCSLL-GIKCKKKQTNADAPMTTASV 2482          

HSP 2 Score: 147.902 bits (372), Expect = 6.437e-35
Identity = 96/308 (31.17%), Postives = 164/308 (53.25%), Query Frame = 2
Query: 1316 FSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMW--RKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVL-----LEIKRDEKFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIF 2218
            F +  F+ PN++D       FA+ + N  VV  V  +I    L++   +W  RKD ++++ ++   L DNDP  EY Y++S++TG  R A TSS + + L G  G S    +TD  +  +FE G +  F++TT   LG+L ++R+WH++SG  P+W + K+ ++D++  + + F+C +WLS    +   ++V      +++KR   F NLF         D HI   + +    S +TRVQ+V+   ++    M+++ MF+G  ++ S      +D G I  TW Q   GI S +I +P   +   IF
Sbjct: 1334 FGSSFFVMPNVVDVSRTAELFATFVNNPVVVCFVGAIILAYLLVV---IWARRKDIQDAVKVKVTVLEDNDPLAEYRYLLSINTGQRRGASTSSQVTVTLQGSEGESEPHHLTDPEKP-VFERGGLDLFLLTTPFSLGELQSIRLWHDNSGYYPAWYVNKVTVQDLENGQKWHFLCNSWLSIDLGECTLDKVFPVATEMDLKR---FSNLFFAKTAKDFRDGHIWFSVISRPPSSNFTRVQRVSCCFSLLLCTMLTSIMFWGIPSDPSEQT---MDLGKIEFTWQQVMIGIQSSIIMFPINLLIVSIF 1631          
BLAST of PKD1L-2 vs. Ensembl Zebrafish
Match: pkd1l2a (polycystic kidney disease 1 like 2a [Source:ZFIN;Acc:ZDB-GENE-050208-89])

HSP 1 Score: 156.762 bits (395), Expect = 6.949e-38
Identity = 178/709 (25.11%), Postives = 305/709 (43.02%), Query Frame = 2
Query: 2255 DQEAKMKKMFLLPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILL---IIFVLAKKLL-----GAVSTD-----------QEANIDEFVKDDLKKVLGANLN-----------------------PPDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIKSNVQT--YMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMVDHVWNIFNEMMTGFKSSMKYTVPDALKKKAIV 4249
            ++E   K    LP  F+FVGW L+      S +FT LY L +G E+S  WL +  V  F  +F++ P+ +L   + F L  K +     G VS D           +  N      D L  V+   L                        PP    +EK++ +    Q++  ++ + L YV  L +L  +AY  R    +  T  IR  F     +T  + D + WA   L            N  G     I   +    G  RIRQ+RV+R+TC I+  +   Y    C+  Y+  SED  S+S  W             N  RN ++ ++TV+  + YQ        P  G   +Y GGG++  LG  Q+ A+ +++ L  N WLD  TRA+F E TVYN N NLF  + ++FE    G  + +   V++  LY    G  + ++  + +Y + ++  +  + K + +QK  YF S WNL+EL  I LS S +     R ++    I     NK  +VSF++  +       L+     ++ I++   +  N  + ++  T+ RA+T +S    +     +A+    N+++      +  LL +  ++  + + I  Y ++ +  P   + L  +    ++ F + ++FI ++   + E         ++E+V+ +      ++ G K   K T  DA    A V
Sbjct:  443 EKEGSRKCQKGLPWWFVFVGWFLVLATSGVSAYFTMLYGLTYGKERSISWLISMVVSFFESLFITQPVKVLGFAVFFALVLKTVDQDEYGDVSIDGTLSNTGNRIIRNMNYLSIFDDHLISVVKLQLKCLSTDDPDAVRIARRDSTCSFYKPPPPTDIEKMRNNMIKEQKVFALIREILIYVGFLWMLLLVAYGQRDPNAYYLTHHIRQSFSTGISETLNHKDIFIWANSSLLR----------NLYGQYPGFITDGNSKLVGNARIRQVRVRRDTCKIANPMQ--YSVRDCHAPYSWESEDMGSYSPGW-------------NQTRN-VNGSKTVLKPWYYQTQAKLRANPVWGGLALYKGGGFVVDLGPDQKNASRLLQYLFDNTWLDVYTRAVFVEFTVYNANVNLFCIVTLIFETTGVGTFQ-YRSEVQAVHLYQSTGGFHVFVMASEAIYYIFILYYMVVQGKLMKQQKWAYFKSKWNLLELAIIILSWSALSVFVKRTILGNRDIEFYQNNKDMFVSFNETATADAVLGYLIAFLVLLATIKLWHLLRLNPKLHMITSTLQRAWTDISGFIVVMTIMFLAYSIACNLMYGWRLNSYRTLLEAAQTIICLQLGIFNYDEVLDYNPVLGAFLIGSCIIFMT-FVVLNLFISVILVAFNEEQLHPTPSEEEEIVELMLMKVCSLL-GIKCKKKQTNADAPMTTASV 1122          

HSP 2 Score: 97.0561 bits (240), Expect = 1.159e-19
Identity = 77/301 (25.58%), Postives = 126/301 (41.86%), Query Frame = 2
Query: 1316 FSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMWRKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVLLEIKRDEKFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIF 2218
            F +  F+ PN++D       FA+ + N                              ++++   L DNDP  EY Y++S++TG  R A TSS + + L G  G S    +TD  +  +FE G +  F++TT   LG+L ++R+WH++SG  P+ NL               F  +T                   +D +              D HI   + +    S +TRVQ+V+   ++    M+++ MF+G  ++ S      +D G I  TW Q   GI S +I +P   +   IF
Sbjct:   20 FGSSFFVMPNVVDVSRTAELFATFVNNP-----------------------------VVVKVTVLEDNDPLAEYRYLLSINTGQRRGASTSSQVTVTLQGSEGESEPHHLTDPEKP-VFERGGLDLFLLTTPFSLGELQSIRLWHDNSGYYPACNL---------------FFAKT------------------AKDFR--------------DGHIWFSVISRPPSSNFTRVQRVSCCFSLLLCTMLTSIMFWGIPSDPSEQT---MDLGKIEFTWQQVMIGIQSSIIMFPINLLIVSIF 240          
BLAST of PKD1L-2 vs. Ensembl Zebrafish
Match: pkd1l2b (polycystic kidney disease 1 like 2b [Source:ZFIN;Acc:ZDB-GENE-141222-87])

HSP 1 Score: 144.436 bits (363), Expect = 5.898e-34
Identity = 154/639 (24.10%), Postives = 290/639 (45.38%), Query Frame = 2
Query: 2291 PKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILLIIFVLAKKLLGAVSTDQEANIDEFVK------DDLKKVLGANLN-------PPDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIK--SNVQTYMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMVDHV 4162
            P  F++VGW L+    V S +FT LY L++G ++S  W+ +   G    +  ++P+ ++ I +    ++  V  + E  +D   K      D L +V  A  +       PP    +EK++++    Q+   +V + L ++  L +L  +AY  +    F  T+ I+  F K  S+     D + WA  +L +          N  G     I   +    G  RIRQ+RVK++TC ++ ++        CN  Y+  +ED  S+   W         FN  N        ++  I A+ YQ+ +     P  G   +Y GGGY+  LG  ++ A   ++ L  + WLD+ TRA+F E TVYN N +LF  + ++ E    G  + F   +++  LY  +   M  L+  +++Y L VV  ++ + K + +QK  YF + WNL+++  I LS S +     + +     I     +K  + SF    +   T   +M     +  +++   +  +  + ++  ++ RA+  +S+L  +    L+A+    N++F      +  L  +  ++F + + I  Y ++  + PA   A+  +    ++ F + S+FI I+     E  + +    ++E V+ V
Sbjct: 1268 PWWFVYVGWVLVIGTSVISGYFTMLYGLKYGKDRSVSWIISNVTGFTQSLCFTEPVKVVFIGIFFALVMKKVEAEDE-EVDTLQKKTTAGSDGLSEVCFAQRDCTQSYYQPPPPGDIEKLRRNMIKQQKAQALVMEVLIFLGFLSMLLLVAYGQQDPNAFYLTQHIQQSFSKGISDSMKTNDVFVWANTVLLK----------NLFGQYPGFITDGNSKLVGNARIRQVRVKKDTCKVAKVMLHTVSQ--CNTPYSWGNEDMMSYGPGWE-------EFNSVN-------GSEEGITAWQYQSQSTLKALPVWGLTALYRGGGYVMDLGPDKQNATMKLQYLFNSTWLDEYTRAVFVEFTVYNANVDLFCIVTLILESSAVGAFQ-FRSVLQNVSLYSSVGSFMSFLMASRVIYFLFVVYYMFLQGKLLKRQKWAYFRNKWNLLDMAIIILSWSSLSLFIQKTVQGNIDIQYYQKHKNQFPSFHDTAAVDATLRYVMAFLVLLGCVKLWHLLRLSPKLYVIASSLQRAWDDMSTLTVVIFIILLAYSLACNLIFGWELYTYRTLPDAFTAIFSLQIGIFNYDEVMNSNPAL-GAVIISSCVLIATFVVLSLFISIILMAVTEERENHQPSEEEETVELV 1877          

HSP 2 Score: 139.428 bits (350), Expect = 1.779e-32
Identity = 106/352 (30.11%), Postives = 171/352 (48.58%), Query Frame = 2
Query: 1184 SLGVASLTPRI--WNFNMEVWQDFSASVDDTSDISNINFKSNFLGTFSAKIFIAPNMID---FKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMWRKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVL-LEIKRDEK-FQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIF 2218
            S+ V S+T +   W      W D+   V   +           L  F    F+ PN +D      +F+NFA     + VV+  I  IF+ ++L      RKD ++   ++   L DNDP  EY Y++ + TG    + TSS + + + G  G      +TD  +  +FE G V  F++TT   LGDL ++R+WH++SG  P+W +  +VI+D+QT + + F+C +WLS    D   E+V  +  + D K F N+F     +   DKH+   +      S +T VQ+V+   ++    M+++ MF+G   + S      +D G I +TW Q   G  S L+ +P   I   IF
Sbjct:  751 SVTVTSVTAQCIFWEEARANWSDYGCRVGPKTTPYVTQCLCTHLTFFGNSFFVMPNTVDPTKSAQLFSNFA----QNPVVVCFIGAIFVAFILTAAWARRKDLKDKAKVKVTVLDDNDPFAEYCYLVKISTGHRPGSSTSSRVIVTVQGMEGDCEPHHLTDPEKP-VFERGGVDLFLLTTPYSLGDLQSIRLWHDNSGNHPAWFVSTVVIKDLQTEQKWNFLCNSWLSVDVDDCTVEKVFPVASEVDMKGFSNVFFSKTTTDFCDKHLWYSVVCRPVNSSFTCVQRVSCCFSVLLCSMLTSIMFYGIPTDPSEQT---MDMGQIQLTWSQVMIGFESTLLVFPINLIIVGIF 1094          
BLAST of PKD1L-2 vs. Ensembl Zebrafish
Match: pkd1l2b (polycystic kidney disease 1 like 2b [Source:ZFIN;Acc:ZDB-GENE-141222-87])

HSP 1 Score: 139.043 bits (349), Expect = 1.572e-32
Identity = 153/635 (24.09%), Postives = 290/635 (45.67%), Query Frame = 2
Query: 2291 PKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIIL-------LIIFVLAKKLLGAV--STDQEANIDEFVKDDLKKVLGANLNPPDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIK--SNVQTYMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMVDHV 4162
            P  F++VGW L+    V S +FT LY L++G ++S  W+ +   G    +  ++P+ L       +  FV  K  + ++  STD  + +  F + D  +   +   PP    +EK++++    Q+   +V + L ++  L +L  +AY  +    F  T+ I+  F K  S+     D + WA  +L +          N  G     I   +    G  RIRQ+RVK++TC ++ ++        CN  Y+  +ED  S+   W         FN  N        ++  I A+ YQ+ +     P  G   +Y GGGY+  LG  ++ A   ++ L  + WLD+ TRA+F E TVYN N +LF  + ++ E    G  + F   +++  LY  +   M  L+  +++Y L VV  ++ + K + +QK  YF + WNL+++  I LS S +     + +     I     +K  + SF    +   T   +M     +  +++   +  +  + ++  ++ RA+  +S+L  +    L+A+    N++F      +  L  +  ++F + + I  Y ++  + PA  + +  +    ++ F + S+FI I+     E  + +    ++E V+ V
Sbjct:  395 PWWFVYVGWVLVIGTSVISGYFTMLYGLKYGKDRSVSWIISNVTGFTQSLCFTEPVKLSWSLRFRIKNFVSHKADVFSICNSTDGLSEVC-FAQRDCTQ---SYYQPPPPGDIEKLRRNMIKQQKAQALVMEVLIFLGFLSMLLLVAYGQQDPNAFYLTQHIQQSFSKGISDSMKTNDVFVWANTVLLK----------NLFGQYPGFITDGNSKLVGNARIRQVRVKKDTCKVAKVMLHTVSQ--CNTPYSWGNEDMMSYGPGWE-------EFNSVN-------GSEEGITAWQYQSQSTLKALPVWGLTALYRGGGYVMDLGPDKQNATMKLQYLFNSTWLDEYTRAVFVEFTVYNANVDLFCIVTLILESSAVGAFQ-FRSVLQNVSLYSSVGSFMSFLMASRVIYFLFVVYYMFLQGKLLKRQKWAYFRNKWNLLDMAIIILSWSSLSLFIQKTVQGNIDIQYYQKHKNQFPSFHDTAAVDATLRYVMAFLVLLGCVKLWHLLRLSPKLYVIASSLQRAWDDMSTLTVVIFIILLAYSLACNLIFGWELYTYRTLPDAFTAIFSLQIGIFNYDEVMNSNPALGAVIISSC-VLIATFVVLSLFISIILMAVTEERENHQPSEEEETVELV 997          

HSP 2 Score: 107.842 bits (268), Expect = 6.015e-23
Identity = 67/217 (30.88%), Postives = 112/217 (51.61%), Query Frame = 2
Query: 1574 NAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVL-LEIKRDEK-FQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIF 2218
            N  ++  + + + G  G      +TD  +  +FE G V  F++TT   LGDL ++R+WH++SG  P+W +  +VI+D+QT + + F+C +WLS    D   E+V  +  + D K F N+F     +   DKH+   +      S +T VQ+V+   ++    M+++ MF+G   + S      +D G I +TW Q   G  S L+ +P   I   IF
Sbjct:    9 NVISTLQVIVTVQGMEGDCEPHHLTDPEKP-VFERGGVDLFLLTTPYSLGDLQSIRLWHDNSGNHPAWFVSTVVIKDLQTEQKWNFLCNSWLSVDVDDCTVEKVFPVASEVDMKGFSNVFFSKTTTDFCDKHLWYSVVCRPVNSSFTCVQRVSCCFSVLLCSMLTSIMFYGIPTDPSEQT---MDMGQIQLTWSQVMIGFESTLLVFPINLIIVGIF 221          
BLAST of PKD1L-2 vs. Ensembl Zebrafish
Match: pkd2 (polycystic kidney disease 2 [Source:NCBI gene;Acc:432387])

HSP 1 Score: 123.25 bits (308), Expect = 8.697e-28
Identity = 116/496 (23.39%), Postives = 224/496 (45.16%), Query Frame = 2
Query: 2771 NVQTYMDFYDWAQG-ILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISA-LVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAET-IDENLFDYDKEMVDHVWNIFNEMMT--GFKSSMKYTVPDALKKKA 4243
            ++ T  DF+ + +G  LN  Y ++WYNN  ++     ++   + L  G  R+RQ+RV+  +C++   L  +VY    C   Y+  +ED   F  K           N + W   +   +    +++  Q +T  GG  ++              L   +E++A  ++ L+ N WLD+ TRA+F + ++YNGN NLF  +++L E P +GG  +  +  ++ RL  Y+      + + ++ + L V+  +  E  ++   +  YF S WN +++L + LS+  II    R     + +  L  N   Y +F+           L  I  F+S +++ K++ FNK ++ +  T+ R    L     MF    +A+  +  ++F      F+       + F + +    + ++ E        +Y+  +       + ++F+ I+NDTY+E   D      + E+ D +   +N  M     K S    +PD+L++ A
Sbjct:  208 SLSTMEDFWKFTEGPFLNGMYWELWYNN--KSLPENQSLIYYENLLLGVPRLRQLRVRNESCSVHEDLRDEVYD---CYNVYSPANEDKAPFGPK-----------NGTAWR--FKDESSLGESSYWGQVSTYGGGGYYQ-------------DLSRTREKSANQLQELKNNLWLDRGTRAVFLDFSIYNGNVNLFCIVRLLVEFPATGGA-VPSWQFQTVRLLRYVSSWDYFVGMCEVSFCLFVLYYLVEEALEIRLHRLRYFKSLWNCLDVLIVALSVPAIIMNICRTSAVSHRLHFLLENHSTYPNFEPLARLQVHFNNLAAIIVFLSWVKLFKFINFNKTMNQLSTTMSRCAKDLMGFAIMFFIVFLAYAQLAYLVFGTQVNDFSTFQACIFTQFRIILGDFDFSEIEEADSVL-GPIYFTTFVFFIFMILLNMFLAIINDTYSEVKADMAQQRSEMEITDLIKKSYNRAMVKLKLKKSSINDIPDSLQQAA 670          
BLAST of PKD1L-2 vs. Ensembl Xenopus
Match: ENSXETT00000038579.1 (polycystin 1 like 2 (gene/pseudogene) [Source:NCBI gene;Acc:100486136])

HSP 1 Score: 172.17 bits (435), Expect = 3.283e-42
Identity = 156/619 (25.20%), Postives = 295/619 (47.66%), Query Frame = 2
Query: 2288 LPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILLIIFVLAKKLLGAVSTDQEA----NIDEFVKDDLKKVLGANLN-----PPDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIKS--NVQTYMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAE 4111
            LP  F+F+GW L+      S FFT LY L +G + S +WL +  +  F  +F++ P+ +L        +L  V  + E     N +     D   +LG+  +     PP    + K+K +    Q++  ++ + L Y+  L +L  +AY  R   ++   K I S F     ++ +Y +F+ WA   L         NN+   G     I   +    G  R+RQIR+K+++C +++++     N  C   Y+L +E+   +               D +WN + ++    V + + YQN++   G+P  G    Y GGGY+A LG +++ A  ++++L +N WLD  TRA+F E TVYN N NLF  ++++FE  N+ G       ++S RLY +  G  I ++  +++Y L V+  +  + K++  +K  YF S WNL+EL  I +S S +     R ++    +     +K  +VSF++  +       L+     +S I++   +  N  ++++  T+ RA+  +S    + +   +A+    N++F      +  +  S  ++  + + I  Y ++ +  P   S L  +    ++ F + ++FI ++   ++E
Sbjct: 1545 LPWWFVFIGWLLVAATSGVSAFFTMLYGLHYGKDSSIKWLISMAISFFESLFITQPLKVLGFAAFFALVLKKVEPEDEEETTINGNLSTPGDPNPLLGSRRDSNIYQPPPPTDITKMKNNYMKEQKVFALIREILAYLGFLWMLLLVAYGQRDPNSYYLNKHIESSFTDGFEDLCSYQEFFTWANTTL--------INNL--YGSHPGFITDGNSKLVGGARMRQIRIKKDSCPVASVLQSTIDN--CRAPYSLDAEEMGHY---------------DGSWNFSAITNATDVNSPWYYQNHSKLRGHPTWGKLATYRGGGYVADLGNERKYAHRVLQDLFSNIWLDSYTRAVFVEFTVYNANVNLFCIVKLMFET-NALGTFFTRANLQSVRLYPFTDGLHIFVVAAEVIYFLFVIYYMVVQGKRMKAEKWGYFRSKWNLLELALIIISWSALSVYVKRTILGTRDLRYYQEHKNEFVSFNETAAADAALGYLIAFLVLLSTIKLWHLLRLNPKLNMITATLRRAWGDISGFITVIVIMFLAYSIACNLIFGWKLNSYKTVFDSAKTMVSLQLGIFNYEEVLDYNPVLGSFLVGSCIIFMT-FVVLNLFISVILVAFSE 2134          

HSP 2 Score: 151.369 bits (381), Expect = 8.084e-36
Identity = 101/338 (29.88%), Postives = 171/338 (50.59%), Query Frame = 2
Query: 1217 WNFNMEVWQDFSASVDDTSDISNINFKSNFLGTFSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMW--RKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVL-LEIKRDEK-FQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIF 2218
            W+   + W      V   +  S+     N L  F +   + PN +D       FA+ + N  VV  V  +  +  L++   +W  RKD +++  ++   L DNDP  +Y Y+++V TG  R A T+S + I L G  G S    ++D     +FE G    F++TT  PLGD+  +R+WH++SG KPSW + ++++ D++ ++ + F+C +WLS    D   ++V  +  + D K F NLF      G  D HI   + + +  S +TRVQ+V+   ++    M+++ MF+G   +    A  K+D G I  TW +   G  S L+ +P   +  +IF
Sbjct: 1047 WDEANQDWNSTGCHVGPKTTPSSTQCLCNHLTFFGSSFIVMPNAVDVSRTVELFATFVDNPVVVTTVGCIALVYVLVM---IWARRKDIQDNAKVKIIALEDNDPFAQYRYLVTVFTGHRRGAATTSKVTITLYGSDGESDPHHLSDP-EGPVFERGGEDIFLLTTLFPLGDVQTIRLWHDNSGDKPSWYVNRVLVHDMELDQKWYFLCNSWLSIEVGDCVLDKVFSVATEEDMKQFSNLFFMKTSKGFRDGHIWYSVFSRSPRSSFTRVQRVSCCFSLLLCTMLTSIMFWGVPTD---PAEQKMDMGKIEFTWQEVMIGFESSLLMFPINLLIVQIF 1377          
BLAST of PKD1L-2 vs. Ensembl Xenopus
Match: PKD2L1 (polycystic kidney disease 2-like 1 [Source:NCBI gene;Acc:100495064])

HSP 1 Score: 122.094 bits (305), Expect = 6.289e-28
Identity = 117/448 (26.12%), Postives = 209/448 (46.65%), Query Frame = 2
Query: 2789 DFYDWAQG-ILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGN--VPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDE 4123
            DF+ + QG +L+  Y   WYNN++ T D T ++   + L  G  R+RQ++VK N+C    +V K + +  V C + Y+   EDT  F +            N + W                Y      GG  + G    Y GGGY   L + +  +   ++ L++N WLD+ TRA+F + +VYN N NLF  ++++ E P +GG  +  + +R+ +L  Y+ G    ++  +I++ + +   +  EI ++   K  YF+S WN+++++ I LSL  I     R M     +  L  N   Y  F+    W      +  ++ F + I++ KY+ FNK ++ +  T+ R    +     MF     A+  +G +LF      F+  +    + F + +    Y D  +        +Y+  +     F + ++F+ I+NDTY+E  +E
Sbjct:   86 DFWSYLQGPMLDGLYWTKWYNNVSLT-DNTNSLIYYENLLLGVPRMRQLKVKNNSC----MVYKDFKDEIVGCFDVYSKDKEDTSQFGL-----------INGTAWT---------------YYTEEELGGSSYWGKITTYSGGGYYIDLELTKRDSLRQLQTLKSNLWLDRGTRAVFVDFSVYNANINLFCVLRLVVEFPATGG-AIPSWQIRTVKLIRYVSGWDYFIIGCEIVFCIFIFYYVVEEILELRIHKFRYFTSIWNILDVIVILLSLVAIGFHIFRTMEVNRLMGTLLKNPTIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAIMFFIVFFAYAQLGYLLFGTQVENFSTFVKCIFTQFRIILGDFDY-DAIDNANRVLGPIYFVTYVFFVFFVLLNMFLAIINDTYSEVKEE 500          
BLAST of PKD1L-2 vs. Ensembl Xenopus
Match: PKD2L1 (polycystic kidney disease 2-like 1 [Source:NCBI gene;Acc:100495064])

HSP 1 Score: 122.094 bits (305), Expect = 1.255e-27
Identity = 117/448 (26.12%), Postives = 209/448 (46.65%), Query Frame = 2
Query: 2789 DFYDWAQG-ILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGN--VPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDE 4123
            DF+ + QG +L+  Y   WYNN++ T D T ++   + L  G  R+RQ++VK N+C    +V K + +  V C + Y+   EDT  F +            N + W                Y      GG  + G    Y GGGY   L + +  +   ++ L++N WLD+ TRA+F + +VYN N NLF  ++++ E P +GG  +  + +R+ +L  Y+ G    ++  +I++ + +   +  EI ++   K  YF+S WN+++++ I LSL  I     R M     +  L  N   Y  F+    W      +  ++ F + I++ KY+ FNK ++ +  T+ R    +     MF     A+  +G +LF      F+  +    + F + +    Y D  +        +Y+  +     F + ++F+ I+NDTY+E  +E
Sbjct:  100 DFWSYLQGPMLDGLYWTKWYNNVSLT-DNTNSLIYYENLLLGVPRMRQLKVKNNSC----MVYKDFKDEIVGCFDVYSKDKEDTSQFGL-----------INGTAWT---------------YYTEEELGGSSYWGKITTYSGGGYYIDLELTKRDSLRQLQTLKSNLWLDRGTRAVFVDFSVYNANINLFCVLRLVVEFPATGG-AIPSWQIRTVKLIRYVSGWDYFIIGCEIVFCIFIFYYVVEEILELRIHKFRYFTSIWNILDVIVILLSLVAIGFHIFRTMEVNRLMGTLLKNPTIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAIMFFIVFFAYAQLGYLLFGTQVENFSTFVKCIFTQFRIILGDFDY-DAIDNANRVLGPIYFVTYVFFVFFVLLNMFLAIINDTYSEVKEE 514          
BLAST of PKD1L-2 vs. Ensembl Xenopus
Match: PKD2L1 (polycystic kidney disease 2-like 1 [Source:NCBI gene;Acc:100495064])

HSP 1 Score: 118.242 bits (295), Expect = 2.926e-26
Identity = 106/403 (26.30%), Postives = 187/403 (46.40%), Query Frame = 2
Query: 2789 DFYDWAQG-ILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGN--VPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKY 3988
            DF+ + QG +L+  Y   WYNN++ T D T ++   + L  G  R+RQ++VK N+C    +V K + +  V C + Y+   EDT  F +            N + W                Y      GG  + G    Y GGGY   L + +  +   ++ L++N WLD+ TRA+F + +VYN N NLF  ++++ E P +GG  +  + +R+ +L  Y+ G    ++  +I++ + +   +  EI ++   K  YF+S WN+++++ I LSL  I     R M     +  L  N   Y  F+    W      +  ++ F + I++ KY+ FNK ++ +  T+ R    +     MF     A+  +G +LF      F+  +    + F + +    Y
Sbjct:  162 DFWSYLQGPMLDGLYWTKWYNNVSLT-DNTNSLIYYENLLLGVPRMRQLKVKNNSC----MVYKDFKDEIVGCFDVYSKDKEDTSQFGL-----------INGTAWT---------------YYTEEELGGSSYWGKITTYSGGGYYIDLELTKRDSLRQLQTLKSNLWLDRGTRAVFVDFSVYNANINLFCVLRLVVEFPATGG-AIPSWQIRTVKLIRYVSGWDYFIIGCEIVFCIFIFYYVVEEILELRIHKFRYFTSIWNILDVIVILLSLVAIGFHIFRTMEVNRLMGTLLKNPTIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAIMFFIVFFAYAQLGYLLFGTQVENFSTFVKCIFTQFRIILGDFDY 532          
BLAST of PKD1L-2 vs. Ensembl Xenopus
Match: PKD2L1 (polycystic kidney disease 2-like 1 [Source:NCBI gene;Acc:100495064])

HSP 1 Score: 117.472 bits (293), Expect = 3.291e-26
Identity = 102/403 (25.31%), Postives = 189/403 (46.90%), Query Frame = 2
Query: 2789 DFYDWAQG-ILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGN--VPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKY 3988
            DF+ + QG +L+  Y   WYNN++ T D T ++   + L  G  R+RQ++VK N+C    +V K + +  V C + Y+   EDT  F +            N + W   Y +  +   +++  +  T SGG  +               L + +  +   ++ L++N WLD+ TRA+F + +VYN N NLF  ++++ E P +GG  +  + +R+ +L  Y+ G    ++  +I++ + +   +  EI ++   K  YF+S WN+++++ I LSL  I     R M     +  L  N   Y  F+    W      +  ++ F + I++ KY+ FNK ++ +  T+ R    +     MF     A+  +G +LF      F+  +    + F + +    Y
Sbjct:   86 DFWSYLQGPMLDGLYWTKWYNNVSLT-DNTNSLIYYENLLLGVPRMRQLKVKNNSC----MVYKDFKDEIVGCFDVYSKDKEDTSQFGL-----------INGTAWT--YYTEEELGGSSYWGKITTYSGGGYY-------------IDLELTKRDSLRQLQTLKSNLWLDRGTRAVFVDFSVYNANINLFCVLRLVVEFPATGG-AIPSWQIRTVKLIRYVSGWDYFIIGCEIVFCIFIFYYVVEEILELRIHKFRYFTSIWNILDVIVILLSLVAIGFHIFRTMEVNRLMGTLLKNPTIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAIMFFIVFFAYAQLGYLLFGTQVENFSTFVKCIFTQFRIILGDFDY 456          
BLAST of PKD1L-2 vs. Ensembl Mouse
Match: Pkd1l2 (polycystic kidney disease 1 like 2 [Source:MGI Symbol;Acc:MGI:2664668])

HSP 1 Score: 158.303 bits (399), Expect = 4.394e-38
Identity = 105/338 (31.07%), Postives = 174/338 (51.48%), Query Frame = 2
Query: 1217 WNFNMEVWQDFSASVDDTSDISNINFKSNFLGTFSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMW--RKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVL-LEIKRDEK-FQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIF 2218
            W+   E W D    V   +  S  +   N L  F +   + PN ID +     FA+   N  VV  V  L  +  L+L   +W  RKD ++   ++   L DNDP  +Y Y+++V+TG  R A TSS + + L G  G S    ++D     +FE G V  F+++T  PLG+L +LR+WH++SG +PSW + ++++ D   ++ + F+C +WLS    D   ++V  +  ++D K F +LF     +G  D HI   +  +   S +TRVQ+V+   +M    M+++ MF+G   +    A  K+D G I  TW +   G+ S ++ +P   +  +IF
Sbjct: 1286 WDETQETWDDSGCQVGPRTTPSQTHCLCNHLTFFGSSFLVMPNAIDVRQTAELFATFEDNPVVVTTVGCLCMLYVLVL---IWARRKDIQDQAKVKVVVLEDNDPFAQYHYLVTVYTGHRRGAATSSKVTLTLYGSDGESEPHHLSDP-DAAVFERGGVDVFLLSTLFPLGELQSLRLWHDNSGDRPSWYVSRVLVYDSVVDRKWYFLCNSWLSVDVGDCVLDKVFPVATEQDRKQFSHLFFTKTSTGFQDGHIWYSVFCSATRSSFTRVQRVSCCFSMLLCTMLTSIMFWGVPKD---PAEQKMDLGKIEFTWQEVMIGLESSILMFPINLLIVQIF 1616          

HSP 2 Score: 135.191 bits (339), Expect = 4.963e-31
Identity = 155/641 (24.18%), Postives = 276/641 (43.06%), Query Frame = 2
Query: 2288 LPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILL---IIFVLAKKLLGAVSTDQEANIDEFVKDDLKKVLGA-----------NLNPPDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIK--SNVQTYMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGV--RSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMVD 4156
            LP   + VGW L+      + FFT LY L +G   S +WL +  V     VF++ P+ +L     F L  K       D E  +  F         G               PP    +EK+K  +   Q+   ++ + L Y+  L +L  +AY  R    +   + +   F +  S V  +  F++WA   L +          N  G     +   +    G   IRQ+RV+ ++C ++  +        C+  Y+L  ED   +   W    N+S ++N+SN              A+ YQ+ +   GYP  G   +YGGGGY+  LG   + A+ I++ L  N+WLD LTRA+F E TVYN N NLF T+ +  E   + GL  F   V  +S RLY +  G    ++  ++ Y L +   +  + K + KQK  YF S WNL+E+  I  S S ++    R ++    +     ++   +SF +  +       ++     +S +++   +  N  ++++   + RA+  +S    + +  L+A+    N++F      +  L  +  ++  + + I  Y ++ +  P   S L  +       F + ++FI ++   ++E    +    + E+ D
Sbjct: 1814 LPWWCVLVGWLLVATTSGVAAFFTMLYGLHYGRVSSLKWLISMAVSFVESVFITQPLKVLGFAAFFALVLK-----REDDEETLPLFPGHLSSPGPGVLFRSRRHSSERAYQPPPMAAIEKMKTTRLKEQKAFALIREILAYLAFLWMLLLVAYGQRDPNAYHFHRHLERSFSQGFSPVLGFRGFFEWANTTLVK----------NLYGHHPGFVTDGNSKLVGSAHIRQVRVRESSCAVAQQLQDSLDG--CHGPYSLGIEDLVDYGEGW----NAS-AYNNSN----------GFPQAWRYQSQSQRRGYPMWGKLTLYGGGGYVVPLGTDHQSASRILQYLFDNSWLDALTRAVFVEFTVYNANVNLFCTVTLTLE---TSGLGTFFSHVTLQSLRLYPFTDGWHPFVVAAELTYFLFLFYYMVVQGKLMRKQKWGYFCSKWNLLEVAIILASWSALVVFVKRTILADRDLQRYREHRDEGISFSETAAADAALGYIIAFLVLLSTVKLWHLLRLNPKMNMITSALRRAWGDISGFVAVILIMLLAYSFASNLVFGWKLRSYKTLFDAAETMVSLQLGIFNYEEVLDYSPILGSLLIGSC-IVFMTFVVLNLFISVILVAFSEEQKSDQLWEEGEIAD 2418          
BLAST of PKD1L-2 vs. Ensembl Mouse
Match: Pkd1l2 (polycystic kidney disease 1 like 2 [Source:MGI Symbol;Acc:MGI:2664668])

HSP 1 Score: 158.303 bits (399), Expect = 4.545e-38
Identity = 105/338 (31.07%), Postives = 174/338 (51.48%), Query Frame = 2
Query: 1217 WNFNMEVWQDFSASVDDTSDISNINFKSNFLGTFSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMW--RKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVL-LEIKRDEK-FQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIF 2218
            W+   E W D    V   +  S  +   N L  F +   + PN ID +     FA+   N  VV  V  L  +  L+L   +W  RKD ++   ++   L DNDP  +Y Y+++V+TG  R A TSS + + L G  G S    ++D     +FE G V  F+++T  PLG+L +LR+WH++SG +PSW + ++++ D   ++ + F+C +WLS    D   ++V  +  ++D K F +LF     +G  D HI   +  +   S +TRVQ+V+   +M    M+++ MF+G   +    A  K+D G I  TW +   G+ S ++ +P   +  +IF
Sbjct: 1285 WDETQETWDDSGCQVGPRTTPSQTHCLCNHLTFFGSSFLVMPNAIDVRQTAELFATFEDNPVVVTTVGCLCMLYVLVL---IWARRKDIQDQAKVKVVVLEDNDPFAQYHYLVTVYTGHRRGAATSSKVTLTLYGSDGESEPHHLSDP-DAAVFERGGVDVFLLSTLFPLGELQSLRLWHDNSGDRPSWYVSRVLVYDSVVDRKWYFLCNSWLSVDVGDCVLDKVFPVATEQDRKQFSHLFFTKTSTGFQDGHIWYSVFCSATRSSFTRVQRVSCCFSMLLCTMLTSIMFWGVPKD---PAEQKMDLGKIEFTWQEVMIGLESSILMFPINLLIVQIF 1615          

HSP 2 Score: 135.191 bits (339), Expect = 5.132e-31
Identity = 155/641 (24.18%), Postives = 276/641 (43.06%), Query Frame = 2
Query: 2288 LPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILL---IIFVLAKKLLGAVSTDQEANIDEFVKDDLKKVLGA-----------NLNPPDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIK--SNVQTYMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGV--RSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMVD 4156
            LP   + VGW L+      + FFT LY L +G   S +WL +  V     VF++ P+ +L     F L  K       D E  +  F         G               PP    +EK+K  +   Q+   ++ + L Y+  L +L  +AY  R    +   + +   F +  S V  +  F++WA   L +          N  G     +   +    G   IRQ+RV+ ++C ++  +        C+  Y+L  ED   +   W    N+S ++N+SN              A+ YQ+ +   GYP  G   +YGGGGY+  LG   + A+ I++ L  N+WLD LTRA+F E TVYN N NLF T+ +  E   + GL  F   V  +S RLY +  G    ++  ++ Y L +   +  + K + KQK  YF S WNL+E+  I  S S ++    R ++    +     ++   +SF +  +       ++     +S +++   +  N  ++++   + RA+  +S    + +  L+A+    N++F      +  L  +  ++  + + I  Y ++ +  P   S L  +       F + ++FI ++   ++E    +    + E+ D
Sbjct: 1813 LPWWCVLVGWLLVATTSGVAAFFTMLYGLHYGRVSSLKWLISMAVSFVESVFITQPLKVLGFAAFFALVLK-----REDDEETLPLFPGHLSSPGPGVLFRSRRHSSERAYQPPPMAAIEKMKTTRLKEQKAFALIREILAYLAFLWMLLLVAYGQRDPNAYHFHRHLERSFSQGFSPVLGFRGFFEWANTTLVK----------NLYGHHPGFVTDGNSKLVGSAHIRQVRVRESSCAVAQQLQDSLDG--CHGPYSLGIEDLVDYGEGW----NAS-AYNNSN----------GFPQAWRYQSQSQRRGYPMWGKLTLYGGGGYVVPLGTDHQSASRILQYLFDNSWLDALTRAVFVEFTVYNANVNLFCTVTLTLE---TSGLGTFFSHVTLQSLRLYPFTDGWHPFVVAAELTYFLFLFYYMVVQGKLMRKQKWGYFCSKWNLLEVAIILASWSALVVFVKRTILADRDLQRYREHRDEGISFSETAAADAALGYIIAFLVLLSTVKLWHLLRLNPKMNMITSALRRAWGDISGFVAVILIMLLAYSFASNLVFGWKLRSYKTLFDAAETMVSLQLGIFNYEEVLDYSPILGSLLIGSC-IVFMTFVVLNLFISVILVAFSEEQKSDQLWEEGEIAD 2417          
BLAST of PKD1L-2 vs. Ensembl Mouse
Match: Pkd1l3 (polycystic kidney disease 1 like 3 [Source:MGI Symbol;Acc:MGI:2664670])

HSP 1 Score: 132.109 bits (331), Expect = 3.439e-30
Identity = 93/338 (27.51%), Postives = 158/338 (46.75%), Query Frame = 2
Query: 1217 WNFNMEVWQDFSASVDDTSDISNINFKSNFLGTFSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMW--RKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVLLEIKRDE--KFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIF 2218
            W+     W+     V   S I       + L  FS+  FI P  +D +N       LL  +   + V +L  +L   +++ MW  RKDR +   ++   L DNDP     Y+I V+TG  R A T++ + I L G  G S    + D  +  +FE G +  F+++T S LGDL  LR+WH++SG  PSW + ++++ D+ T K + F C  WL+    +   +RV     R E   F++LF    V      ++   +      + +TRVQ+++  + +    MV N MF+      +     ++  G +++T  +    I + +I +P   I   +F
Sbjct: 1014 WDRYNRTWKSDGCQVGPKSTILKTQCLCDHLTFFSSDFFIVPRTVDVENTIK---LLLHVTNNPVGVSLLSSLLGFYILLAMWASRKDREDMQKVKVTVLADNDPSSASHYLIQVYTGYRRRAATTAKVVITLYGSEGHSEPHHLCDPEKT-VFERGALDVFLLSTGSWLGDLHGLRLWHDNSGDSPSWYVSQVIVSDMTTRKKWHFQCNCWLAVDLGNCERDRVFTPASRSELSSFRHLFSSTIVEKFTQDYLWLSVATRHPWNQFTRVQRLSCCMALLLCDMVINIMFWKMGGTTAKRGTEQL--GPLAVTLSELLVSIQTSIILFPIHLIFGRLF 1345          

HSP 2 Score: 118.627 bits (296), Expect = 4.601e-26
Identity = 148/607 (24.38%), Postives = 262/607 (43.16%), Query Frame = 2
Query: 2261 EAKMKKMFLLPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPI---ILLIIFVLAKKLLGAVSTDQEANIDEFVKDDLKKVLGA-----NLNP----PDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIK--SNVQTYMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNM-IVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFI--CFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSAL 4030
            E K    F L +      W LL V  +AS FF  LYSL+   +++  W+ +  + +   +F+S PI    L ++F L    +  ++ D+E +    V    K    A       NP    P    L K  + KA  ++LS++ G  L  +L L LL    Y A+    F   + I  RF    S ++T  DFY WA G L    P ++       GD    I   +    G   IRQ R+  N       + K   + P ++      ED  ++   W P  +++++  DS W+               YQN    GGYP +G    Y GGGY+  LG     A  ++++L+   WLD  T+A+F E TV+N N NL   + ++ E   S G+  F   ++   L            ++ Q++Y L V    + +  ++ +Q+  +F+   NL++   + +S SI+  +   + +    +   + ++  ++SF +A         L G     + +RV   +  +  + ++  T+ +A+ ++  LGF+ I    L ++    N+LF  +   + +   S V++ G+ +   K+ ++    P   S L
Sbjct: 1517 EGKKPMSFCLFRWLKCSCWLLLGVISLASAFFITLYSLELDKDQATSWVISMMLSVLQDIFISQPIKVIFLTLLFSLMANHMPWLNKDKEQHARRIVALWAKCPWSAPGLRDKNNPIYTAPAMNNLAKPTR-KAWKKQLSKLTGGTLVQILFLTLLMTTVYSAKDSSRFFLHRAIWKRFSHRFSEIKTVEDFYPWANGTL---LPNLY-------GDYRGFITDGNSFLLGNVLIRQTRIP-NDIFFPGSLHKQMKSPPQHQ------EDRENYGAGWVP-PDTNITKVDSIWH---------------YQNQESLGGYPIQGELATYSGGGYVVRLGRNHSAATRVLQHLEQRRWLDHCTKALFVEFTVFNANVNLLCAVTLILE---SSGVGTFLTSLQLDSLTSLQSSERGFAWIVSQVVYYLLVCYYAFIQGCRLKRQRLAFFTRKRNLLDTSIVLISFSILGLSMQSLSLLHKKMQQYHCDRDRFISFYEALRVNSAVTHLRGFLLLFATVRVWDLLRHHAQLQVINKTLSKAWDEV--LGFILIIVVLLSSYAMTFNLLFGWSISDYQSFFRSIVTVVGLLMGTSKHKEVIALYPILGSLL 2084          
BLAST of PKD1L-2 vs. Ensembl Mouse
Match: Pkd1l3 (polycystic kidney disease 1 like 3 [Source:MGI Symbol;Acc:MGI:2664670])

HSP 1 Score: 131.724 bits (330), Expect = 4.771e-30
Identity = 93/338 (27.51%), Postives = 158/338 (46.75%), Query Frame = 2
Query: 1217 WNFNMEVWQDFSASVDDTSDISNINFKSNFLGTFSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMW--RKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVLLEIKRDE--KFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIF 2218
            W+     W+     V   S I       + L  FS+  FI P  +D +N       LL  +   + V +L  +L   +++ MW  RKDR +   ++   L DNDP     Y+I V+TG  R A T++ + I L G  G S    + D  +  +FE G +  F+++T S LGDL  LR+WH++SG  PSW + ++++ D+ T K + F C  WL+    +   +RV     R E   F++LF    V      ++   +      + +TRVQ+++  + +    MV N MF+      +     ++  G +++T  +    I + +I +P   I   +F
Sbjct: 1014 WDRYNRTWKSDGCQVGPKSTILKTQCLCDHLTFFSSDFFIVPRTVDVENTIK---LLLHVTNNPVGVSLLSSLLGFYILLAMWASRKDREDMQKVKVTVLADNDPSSASHYLIQVYTGYRRRAATTAKVVITLYGSEGHSEPHHLCDPEKT-VFERGALDVFLLSTGSWLGDLHGLRLWHDNSGDSPSWYVSQVIVSDMTTRKKWHFQCNCWLAVDLGNCERDRVFTPASRSELSSFRHLFSSTIVEKFTQDYLWLSVATRHPWNQFTRVQRLSCCMALLLCDMVINIMFWKMGGTTAKRGTEQL--GPLAVTLSELLVSIQTSIILFPIHLIFGRLF 1345          

HSP 2 Score: 117.857 bits (294), Expect = 8.352e-26
Identity = 148/607 (24.38%), Postives = 262/607 (43.16%), Query Frame = 2
Query: 2261 EAKMKKMFLLPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPI---ILLIIFVLAKKLLGAVSTDQEANIDEFVKDDLKKVLGA-----NLNP----PDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIK--SNVQTYMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNM-IVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFI--CFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSAL 4030
            E K    F L +      W LL V  +AS FF  LYSL+   +++  W+ +  + +   +F+S PI    L ++F L    +  ++ D+E +    V    K    A       NP    P    L K  + KA  ++LS++ G  L  +L L LL    Y A+    F   + I  RF    S ++T  DFY WA G L    P ++       GD    I   +    G   IRQ R+  N       + K   + P ++      ED  ++   W P  +++++  DS W+               YQN    GGYP +G    Y GGGY+  LG     A  ++++L+   WLD  T+A+F E TV+N N NL   + ++ E   S G+  F   ++   L            ++ Q++Y L V    + +  ++ +Q+  +F+   NL++   + +S SI+  +   + +    +   + ++  ++SF +A         L G     + +RV   +  +  + ++  T+ +A+ ++  LGF+ I    L ++    N+LF  +   + +   S V++ G+ +   K+ ++    P   S L
Sbjct: 1517 EGKKPMSFCLFRWLKCSCWLLLGVISLASAFFITLYSLELDKDQATSWVISMMLSVLQDIFISQPIKVIFLTLLFSLMANHMPWLNKDKEQHARRIVALWAKCPWSAPGLRDKNNPIYTAPAMNNLAKPTR-KAWKKQLSKLTGGTLVQILFLTLLMTTVYSAKDSSRFFLHRAIWKRFSHRFSEIKTVEDFYPWANGTL---LPNLY-------GDYRGFITDGNSFLLGNVLIRQTRIP-NDIFFPGSLHKQMKSPPQHQ------EDRENYGAGWVP-PDTNITKVDSIWH---------------YQNQESLGGYPIQGELATYSGGGYVVRLGRNHSAATRVLQHLEQRRWLDHCTKALFVEFTVFNANVNLLCAVTLILE---SSGVGTFLTSLQLDSLTSLQSSERGFAWIVSQVVYYLLVCYYAFIQGCRLKRQRLAFFTRKRNLLDTSIVLISFSILGLSMQSLSLLHKKMQQYHCDRDRFISFYEALRVNSAVTHLRGFLLLFATVRVWDLLRHHAQLQVINKTLSKAWDEV--LGFILIIVVLLSSYAMTFNLLFGWSISDYQSFFRSIVTVVGLLMGTSKHKEVIALYPILGSLL 2084          
BLAST of PKD1L-2 vs. Ensembl Mouse
Match: Pkd1l3 (polycystic kidney disease 1 like 3 [Source:MGI Symbol;Acc:MGI:2664670])

HSP 1 Score: 131.724 bits (330), Expect = 5.611e-30
Identity = 93/338 (27.51%), Postives = 158/338 (46.75%), Query Frame = 2
Query: 1217 WNFNMEVWQDFSASVDDTSDISNINFKSNFLGTFSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMW--RKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVLLEIKRDE--KFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIF 2218
            W+     W+     V   S I       + L  FS+  FI P  +D +N       LL  +   + V +L  +L   +++ MW  RKDR +   ++   L DNDP     Y+I V+TG  R A T++ + I L G  G S    + D  +  +FE G +  F+++T S LGDL  LR+WH++SG  PSW + ++++ D+ T K + F C  WL+    +   +RV     R E   F++LF    V      ++   +      + +TRVQ+++  + +    MV N MF+      +     ++  G +++T  +    I + +I +P   I   +F
Sbjct: 1024 WDRYNRTWKSDGCQVGPKSTILKTQCLCDHLTFFSSDFFIVPRTVDVENTIK---LLLHVTNNPVGVSLLSSLLGFYILLAMWASRKDREDMQKVKVTVLADNDPSSASHYLIQVYTGYRRRAATTAKVVITLYGSEGHSEPHHLCDPEKT-VFERGALDVFLLSTGSWLGDLHGLRLWHDNSGDSPSWYVSQVIVSDMTTRKKWHFQCNCWLAVDLGNCERDRVFTPASRSELSSFRHLFSSTIVEKFTQDYLWLSVATRHPWNQFTRVQRLSCCMALLLCDMVINIMFWKMGGTTAKRGTEQL--GPLAVTLSELLVSIQTSIILFPIHLIFGRLF 1355          

HSP 2 Score: 117.857 bits (294), Expect = 8.578e-26
Identity = 148/607 (24.38%), Postives = 262/607 (43.16%), Query Frame = 2
Query: 2261 EAKMKKMFLLPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPI---ILLIIFVLAKKLLGAVSTDQEANIDEFVKDDLKKVLGA-----NLNP----PDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIK--SNVQTYMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNM-IVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFI--CFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSAL 4030
            E K    F L +      W LL V  +AS FF  LYSL+   +++  W+ +  + +   +F+S PI    L ++F L    +  ++ D+E +    V    K    A       NP    P    L K  + KA  ++LS++ G  L  +L L LL    Y A+    F   + I  RF    S ++T  DFY WA G L    P ++       GD    I   +    G   IRQ R+  N       + K   + P ++      ED  ++   W P  +++++  DS W+               YQN    GGYP +G    Y GGGY+  LG     A  ++++L+   WLD  T+A+F E TV+N N NL   + ++ E   S G+  F   ++   L            ++ Q++Y L V    + +  ++ +Q+  +F+   NL++   + +S SI+  +   + +    +   + ++  ++SF +A         L G     + +RV   +  +  + ++  T+ +A+ ++  LGF+ I    L ++    N+LF  +   + +   S V++ G+ +   K+ ++    P   S L
Sbjct: 1527 EGKKPMSFCLFRWLKCSCWLLLGVISLASAFFITLYSLELDKDQATSWVISMMLSVLQDIFISQPIKVIFLTLLFSLMANHMPWLNKDKEQHARRIVALWAKCPWSAPGLRDKNNPIYTAPAMNNLAKPTR-KAWKKQLSKLTGGTLVQILFLTLLMTTVYSAKDSSRFFLHRAIWKRFSHRFSEIKTVEDFYPWANGTL---LPNLY-------GDYRGFITDGNSFLLGNVLIRQTRIP-NDIFFPGSLHKQMKSPPQHQ------EDRENYGAGWVP-PDTNITKVDSIWH---------------YQNQESLGGYPIQGELATYSGGGYVVRLGRNHSAATRVLQHLEQRRWLDHCTKALFVEFTVFNANVNLLCAVTLILE---SSGVGTFLTSLQLDSLTSLQSSERGFAWIVSQVVYYLLVCYYAFIQGCRLKRQRLAFFTRKRNLLDTSIVLISFSILGLSMQSLSLLHKKMQQYHCDRDRFISFYEALRVNSAVTHLRGFLLLFATVRVWDLLRHHAQLQVINKTLSKAWDEV--LGFILIIVVLLSSYAMTFNLLFGWSISDYQSFFRSIVTVVGLLMGTSKHKEVIALYPILGSLL 2094          
BLAST of PKD1L-2 vs. UniProt/SwissProt
Match: sp|Q7TN88|PK1L2_MOUSE (Polycystic kidney disease protein 1-like 2 OS=Mus musculus OX=10090 GN=Pkd1l2 PE=2 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 3.073e-37
Identity = 105/338 (31.07%), Postives = 174/338 (51.48%), Query Frame = 2
Query: 1217 WNFNMEVWQDFSASVDDTSDISNINFKSNFLGTFSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMW--RKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVL-LEIKRDEK-FQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIF 2218
            W+   E W D    V   +  S  +   N L  F +   + PN ID +     FA+   N  VV  V  L  +  L+L   +W  RKD ++   ++   L DNDP  +Y Y+++V+TG  R A TSS + + L G  G S    ++D     +FE G V  F+++T  PLG+L +LR+WH++SG +PSW + ++++ D   ++ + F+C +WLS    D   ++V  +  ++D K F +LF     +G  D HI   +  +   S +TRVQ+V+   +M    M+++ MF+G   +    A  K+D G I  TW +   G+ S ++ +P   +  +IF
Sbjct: 1286 WDETQETWDDSGCQVGPRTTPSQTHCLCNHLTFFGSSFLVMPNAIDVRQTAELFATFEDNPVVVTTVGCLCMLYVLVL---IWARRKDIQDQAKVKVVVLEDNDPFAQYHYLVTVYTGHRRGAATSSKVTLTLYGSDGESEPHHLSDP-DAAVFERGGVDVFLLSTLFPLGELQSLRLWHDNSGDRPSWYVSRVLVYDSVVDRKWYFLCNSWLSVDVGDCVLDKVFPVATEQDRKQFSHLFFTKTSTGFQDGHIWYSVFCSATRSSFTRVQRVSCCFSMLLCTMLTSIMFWGVPKD---PAEQKMDLGKIEFTWQEVMIGLESSILMFPINLLIVQIF 1616          

HSP 2 Score: 132.88 bits (333), Expect = 1.667e-29
Identity = 157/647 (24.27%), Postives = 277/647 (42.81%), Query Frame = 2
Query: 2288 LPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILL---IIFVLAKKLLGAVSTDQEANIDEFVKDDLKKVLGA-----------NLNPPDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIK--SNVQTYMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGV--RSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCI------LMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMVD 4156
            LP   + VGW L+      + FFT LY L +G   S +WL +  V     VF++ P+ +L     F L  K       D E  +  F         G               PP    +EK+K  +   Q+   ++ + L Y+  L +L  +AY  R    +   + +   F +  S V  +  F++WA   L +          N  G     +   +    G   IRQ+RV+ ++C ++  +        C+  Y+L  ED   +   W    N+S ++N+SN              A+ YQ+ +   GYP  G   +YGGGGY+  LG   + A+ I++ L  N+WLD LTRA+F E TVYN N NLF T+ +  E   + GL  F   V  +S RLY +  G    ++  ++ Y L +   +  + K + KQK  YF S WNL+E+  I  S S        ++V +    + + +   Y    +  S+ ET+        ++     +S +++   +  N  ++++   + RA+  +S    + +  L+A+    N++F      +  L  +  ++  + + I  Y ++ +  P   S L  +       F + ++FI ++   ++E    +    + E+ D
Sbjct: 1814 LPWWCVLVGWLLVATTSGVAAFFTMLYGLHYGRVSSLKWLISMAVSFVESVFITQPLKVLGFAAFFALVLK-----REDDEETLPLFPGHLSSPGPGVLFRSRRHSSERAYQPPPMAAIEKMKTTRLKEQKAFALIREILAYLAFLWMLLLVAYGQRDPNAYHFHRHLERSFSQGFSPVLGFRGFFEWANTTLVK----------NLYGHHPGFVTDGNSKLVGSAHIRQVRVRESSCAVAQQLQDSLDG--CHGPYSLGIEDLVDYGEGW----NAS-AYNNSN----------GFPQAWRYQSQSQRRGYPMWGKLTLYGGGGYVVPLGTDHQSASRILQYLFDNSWLDALTRAVFVEFTVYNANVNLFCTVTLTLE---TSGLGTFFSHVTLQSLRLYPFTDGWHPFVVAAELTYFLFLFYYMVVQGKLMRKQKWGYFCSKWNLLEVAIILASWSA-------LVVFVKRTILADRDLQRYREHREGISFSETAAADAALGYIIAFLVLLSTVKLWHLLRLNPKMNMITSALRRAWGDISGFVAVILIMLLAYSFASNLVFGWKLRSYKTLFDAAETMVSLQLGIFNYEEVLDYSPILGSLLIGSC-IVFMTFVVLNLFISVILVAFSEEQKSDQLSEEGEIAD 2417          
BLAST of PKD1L-2 vs. UniProt/SwissProt
Match: sp|Q7Z442|PK1L2_HUMAN (Polycystic kidney disease protein 1-like 2 OS=Homo sapiens OX=9606 GN=PKD1L2 PE=1 SV=5)

HSP 1 Score: 149.828 bits (377), Expect = 1.078e-34
Identity = 100/338 (29.59%), Postives = 171/338 (50.59%), Query Frame = 2
Query: 1217 WNFNMEVWQDFSASVDDTSDISNINFKSNFLGTFSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMW--RKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVL-LEIKRDEK-FQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIF 2218
            W+   E W D    V   +     +   N L  F +   +  N I+       FA+   N  VV  V  L  +  L++   +W  RKD ++   ++   L DNDP  +Y Y+++V+TG  R A TSS + + L G  G      + D     +FE G V  F+++T  PLG+L +LR+WH++SG +PSW + ++++ D+  ++ + F+C +WLS +  D   ++V  +  ++D K F +LF     +G  D HI   I +    S +TRVQ+V+   ++    M+++ MF+G   +    A  K+D G I  TW +   G+ S ++ +P   +  +IF
Sbjct: 1285 WDEVQETWDDSGCQVGPRTSPYQTHCLCNHLTFFGSTFLVMSNAINIHQTAELFATFEDNPVVVTTVGCLCVVYVLVV---IWARRKDAQDQAKVKVTVLEDNDPFAQYHYLVTVYTGHRRGAATSSKVTVTLYGLDGEREPHHLADP-DTPVFERGAVDAFLLSTLFPLGELRSLRLWHDNSGDRPSWYVSRVLVYDLVMDRKWYFLCNSWLSINVGDCVLDKVFPVATEQDRKQFSHLFFMKTSAGFQDGHIWYSIFSRCARSSFTRVQRVSCCFSLLLCTMLTSIMFWGVPKD---PAEQKMDLGKIEFTWQEVMIGLESSILMFPINLLIVQIF 1615          

HSP 2 Score: 138.658 bits (348), Expect = 2.905e-31
Identity = 152/636 (23.90%), Postives = 271/636 (42.61%), Query Frame = 2
Query: 2288 LPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILLIIFVLAKKLLGAVSTDQEANI----DEFVKDDLKKVLGANLN-------PPDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIK--SNVQTYMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMVD 4156
            LP   I VGW L+      + FFT LY L +G   S +WL +  V     +F++ P+ +L        +L  V  D+E  +       +  D   +  A  N       PP    +EK+K      Q+   ++ + L Y+  L +L  +AY  R    +   + ++  F +  S V  + +F+ WA   L            N  G     I   +    G  +IRQ+RV+ ++C + A   + Y N  C   Y+L +ED   +                  WN   LS  Q       YQ+     GYP  G   +Y GGGY+  LG  ++  + I+R L  N WLD LTRA+F E TVYN N NLF  + +  E  ++ G       ++S RLY +  G    ++  +++Y L ++  +  + K++ K+   YF S WNL+EL  I  S S +     R ++    +     ++   +SF +  +       ++     +S +++   +  N  ++++   + RA+  +S    + +  L+A+    N++F      +  L  +  ++  + + I  Y ++ +  P   S L  +       F + ++FI ++   ++E         + E+VD
Sbjct: 1817 LPWWCILVGWLLVAATSGVAAFFTMLYGLHYGRASSLRWLISMAVSFVESMFVTQPLKVLGFAAFFALVLKRVD-DEEDTVAPLPGHLLGPDPYALFRARRNSSRDVYQPPLTAAIEKMKTTHLKEQKAFALIREILAYLGFLWMLLLVAYGQRDPSAYHLNRHLQHSFTRGFSGVLGFREFFKWANTTLVS----------NLYGHPPGFITDGNSKLVGSAQIRQVRVQESSCPL-AQQPQAYLNG-CRAPYSLDAEDMADYG---------------EGWNATTLSEWQ-------YQSQDQRQGYPIWGKLTVYRGGGYVVPLGTDRQSTSRILRYLFDNTWLDALTRAVFVESTVYNANVNLFCIVTLTLET-SALGTFFTHAALQSLRLYPFTDGWHPFVVAAELIYFLFLLYYMVVQGKRMSKETWGYFCSKWNLLELAIILASWSALAVFVKRAVLAERDLQRCRNHREEGISFSETAAADAALGYIIAFLVLLSTVKLWHLLRLNPKMNMITAALRRAWGDISGFMIVILTMLLAYSIASNLIFGWKLRSYKTLFDAAETMVSLQLGIFNYEEVLDYSPVLGSFLIGSC-IVFMTFVVLNLFISVILVAFSEEQKYYQLSEEGEIVD 2415          
BLAST of PKD1L-2 vs. UniProt/SwissProt
Match: sp|Q7Z443|PK1L3_HUMAN (Polycystic kidney disease protein 1-like 3 OS=Homo sapiens OX=9606 GN=PKD1L3 PE=1 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.485e-30
Identity = 86/338 (25.44%), Postives = 167/338 (49.41%), Query Frame = 2
Query: 1217 WNFNMEVWQDFSASVDDTSDISNINFKSNFLGTFSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMW--RKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVLLEIKRDE--KFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIF 2218
            W  + + W      V   S I       N L  F++  F+ P  ++ ++    F  +  N   V ++  L+    + +   +W  +KD+ +   ++   L DNDP  ++ Y+I V+TG  R+A T++ + I L G  G S    + D  +  +FE G +  F++TT + LG+L +LR+WH++SG+ PSW + ++++ D+   + + F+C  WL+    D   +RV + + + E   F++LF  M V      ++   I      + +TRVQ+++  +T+    MV N MF+ K N+ +   + ++     ++ W +    I + +I +P   +   +F
Sbjct:  638 WEIHNQTWSSAGCQVGPQSTILRTQCLCNHLTFFASDFFVVPRTVNVEDTIKLFLRVTNNPVGVSLLASLLGFYVITV---VWARKKDQADMQKVKVTVLADNDPSAQFHYLIQVYTGYRRSAATTAKVVITLYGSEGRSEPHHLCDPQKT-VFERGGLDVFLLTTWTSLGNLHSLRLWHDNSGVSPSWYVSQVIVCDMAVKRKWHFLCNCWLAVDLGDCELDRVFIPVSKRELFSFRHLFSSMIVEKFTQDYLWLSIATRHPWNQFTRVQRLSCCMTLLLCNMVINVMFW-KINSTTAKRDEQMR--PFAVAWSELLVSIHTAVILFPINLVIGRLF 968          
BLAST of PKD1L-2 vs. UniProt/SwissProt
Match: sp|Q2EG98|PK1L3_MOUSE (Polycystic kidney disease protein 1-like 3 OS=Mus musculus OX=10090 GN=Pkd1l3 PE=1 SV=2)

HSP 1 Score: 131.724 bits (330), Expect = 3.925e-29
Identity = 93/338 (27.51%), Postives = 158/338 (46.75%), Query Frame = 2
Query: 1217 WNFNMEVWQDFSASVDDTSDISNINFKSNFLGTFSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMW--RKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVLLEIKRDE--KFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIF 2218
            W+     W+     V   S I       + L  FS+  FI P  +D +N       LL  +   + V +L  +L   +++ MW  RKDR +   ++   L DNDP     Y+I V+TG  R A T++ + I L G  G S    + D  +  +FE G +  F+++T S LGDL  LR+WH++SG  PSW + ++++ D+ T K + F C  WL+    +   +RV     R E   F++LF    V      ++   +      + +TRVQ+++  + +    MV N MF+      +     ++  G +++T  +    I + +I +P   I   +F
Sbjct: 1024 WDRYNRTWKSDGCQVGPKSTILKTQCLCDHLTFFSSDFFIVPRTVDVENTIK---LLLHVTNNPVGVSLLSSLLGFYILLAMWASRKDREDMQKVKVTVLADNDPSSASHYLIQVYTGYRRRAATTAKVVITLYGSEGHSEPHHLCDPEKT-VFERGALDVFLLSTGSWLGDLHGLRLWHDNSGDSPSWYVSQVIVSDMTTRKKWHFQCNCWLAVDLGNCERDRVFTPASRSELSSFRHLFSSTIVEKFTQDYLWLSVATRHPWNQFTRVQRLSCCMALLLCDMVINIMFWKMGGTTAKRGTEQL--GPLAVTLSELLVSIQTSIILFPIHLIFGRLF 1355          

HSP 2 Score: 117.857 bits (294), Expect = 6.000e-25
Identity = 148/607 (24.38%), Postives = 262/607 (43.16%), Query Frame = 2
Query: 2261 EAKMKKMFLLPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPI---ILLIIFVLAKKLLGAVSTDQEANIDEFVKDDLKKVLGA-----NLNP----PDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIK--SNVQTYMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNM-IVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFI--CFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSAL 4030
            E K    F L +      W LL V  +AS FF  LYSL+   +++  W+ +  + +   +F+S PI    L ++F L    +  ++ D+E +    V    K    A       NP    P    L K  + KA  ++LS++ G  L  +L L LL    Y A+    F   + I  RF    S ++T  DFY WA G L    P ++       GD    I   +    G   IRQ R+  N       + K   + P ++      ED  ++   W P  +++++  DS W+               YQN    GGYP +G    Y GGGY+  LG     A  ++++L+   WLD  T+A+F E TV+N N NL   + ++ E   S G+  F   ++   L            ++ Q++Y L V    + +  ++ +Q+  +F+   NL++   + +S SI+  +   + +    +   + ++  ++SF +A         L G     + +RV   +  +  + ++  T+ +A+ ++  LGF+ I    L ++    N+LF  +   + +   S V++ G+ +   K+ ++    P   S L
Sbjct: 1527 EGKKPMSFCLFRWLKCSCWLLLGVISLASAFFITLYSLELDKDQATSWVISMMLSVLQDIFISQPIKVIFLTLLFSLMANHMPWLNKDKEQHARRIVALWAKCPWSAPGLRDKNNPIYTAPAMNNLAKPTR-KAWKKQLSKLTGGTLVQILFLTLLMTTVYSAKDSSRFFLHRAIWKRFSHRFSEIKTVEDFYPWANGTL---LPNLY-------GDYRGFITDGNSFLLGNVLIRQTRIP-NDIFFPGSLHKQMKSPPQHQ------EDRENYGAGWVP-PDTNITKVDSIWH---------------YQNQESLGGYPIQGELATYSGGGYVVRLGRNHSAATRVLQHLEQRRWLDHCTKALFVEFTVFNANVNLLCAVTLILE---SSGVGTFLTSLQLDSLTSLQSSERGFAWIVSQVVYYLLVCYYAFIQGCRLKRQRLAFFTRKRNLLDTSIVLISFSILGLSMQSLSLLHKKMQQYHCDRDRFISFYEALRVNSAVTHLRGFLLLFATVRVWDLLRHHAQLQVINKTLSKAWDEV--LGFILIIVVLLSSYAMTFNLLFGWSISDYQSFFRSIVTVVGLLMGTSKHKEVIALYPILGSLL 2094          
BLAST of PKD1L-2 vs. UniProt/SwissProt
Match: sp|Q6IVV8|PKD2_DANRE (Polycystin-2 OS=Danio rerio OX=7955 GN=pkd2 PE=1 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 6.565e-27
Identity = 116/496 (23.39%), Postives = 224/496 (45.16%), Query Frame = 2
Query: 2771 NVQTYMDFYDWAQG-ILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISA-LVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAET-IDENLFDYDKEMVDHVWNIFNEMMT--GFKSSMKYTVPDALKKKA 4243
            ++ T  DF+ + +G  LN  Y ++WYNN  ++     ++   + L  G  R+RQ+RV+  +C++   L  +VY    C   Y+  +ED   F  K           N + W   +   +    +++  Q +T  GG  ++              L   +E++A  ++ L+ N WLD+ TRA+F + ++YNGN NLF  +++L E P +GG  +  +  ++ RL  Y+      + + ++ + L V+  +  E  ++   +  YF S WN +++L + LS+  II    R     + +  L  N   Y +F+           L  I  F+S +++ K++ FNK ++ +  T+ R    L     MF    +A+  +  ++F      F+       + F + +    + ++ E        +Y+  +       + ++F+ I+NDTY+E   D      + E+ D +   +N  M     K S    +PD+L++ A
Sbjct:  208 SLSTMEDFWKFTEGPFLNGMYWELWYNN--KSLPENQSLIYYENLLLGVPRLRQLRVRNESCSVHEDLRDEVYD---CYNVYSPANEDKAPFGPK-----------NGTAWR--FKDESSLGESSYWGQVSTYGGGGYYQ-------------DLSRTREKSANQLQELKNNLWLDRGTRAVFLDFSIYNGNVNLFCIVRLLVEFPATGGA-VPSWQFQTVRLLRYVSSWDYFVGMCEVSFCLFVLYYLVEEALEIRLHRLRYFKSLWNCLDVLIVALSVPAIIMNICRTSAVSHRLHFLLENHSTYPNFEPLARLQVHFNNLAAIIVFLSWVKLFKFINFNKTMNQLSTTMSRCAKDLMGFAIMFFIVFLAYAQLAYLVFGTQVNDFSTFQACIFTQFRIILGDFDFSEIEEADSVL-GPIYFTTFVFFIFMILLNMFLAIINDTYSEVKADMAQQRSEMEITDLIKKSYNRAMVKLKLKKSSINDIPDSLQQAA 670          
BLAST of PKD1L-2 vs. TrEMBL
Match: A0A0H3YFF8 (PKD1L-2 OS=Schmidtea mediterranea OX=79327 GN=PKD1L-2 PE=2 SV=1)

HSP 1 Score: 2262.65 bits (5862), Expect = 0.000e+0
Identity = 1180/1191 (99.08%), Postives = 1185/1191 (99.50%), Query Frame = 2
Query: 1055 STSWDTSSGMLRITIPSGQVTPPNNMTLVMITSTNTTNGILLLSLGVASLTPRIWNFNMEVWQDFSASVDDTSDISNINFKSNFLGTFSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMWRKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVLLEIKRDEKFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIFXXXXXXXXXXXEDQEAKMKKMFLLPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILLIIFVLAKKLLGAVSTDQEANIDEFVKDDLKKVLGANLNPPDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIKSNVQTYMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMVDHVWNIFNEMMTGFKSSMKYTVPDALKKKAIVPVDMSDVDMQFASKENIRNMVSKRVNPSLRRKLADLNGEKYKTEKRENKPNSENDVYINPISFTDIKVAATGSQILDDKTFAERLPKYRAKQNAVDTNNQPPSYMEPVRPLKPNPKIDLFSKTERK 4627
            S SWDTSSGMLRITIPSGQVTPPNNMTLVMITSTNTTNGILLLSLGVASLTPRIWNF+MEVWQDFSASVDDTSDISNINFKSNFLGTFSAKIFIAPNMIDFKNVFANFASLLANSYVVLIVIILIFILYLLLVIVMWRKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVLLEIKRDEKFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTG+ISVLITYPCIFIASEIFRRTRRWKRRWTEDQEAKMKKMFLLPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILLIIFVLAKKLLGAVSTDQEANIDEFVKDDLKKVLGANLNPPDQEKLEKIKKDKASGQRLSRVVGDALTYVLSLLLLTALAYDARSQVTFDQTKMIRSRFIKSNVQTYMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCT+SALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFGIYGGGGYIASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVELLSIFLSLSIIICTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMVDHVWNIFNEMMTGFKSSMKYTVPDALKKKAIVPVDMSDVDMQFASKENIRNMVSKRVNPSLRRKLADLNGEKYKTEKRENKPNSENDVYINPISFTDIKVAATGSQILDDKTFAERLPKYRAKQNAVDTNNQPPSYMEPVRPLKPNPKID   +  +K
Sbjct:  613 SASWDTSSGMLRITIPSGQVTPPNNMTLVMITSTNTTNGILLLSLGVASLTPRIWNFDMEVWQDFSASVDDTSDISNINFKSNFLGTFSAKIFIAPNMIDFKNVFANFASLLANSYVVLIVIILIFILYLLLVIVMWRKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVLLEIKRDEKFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGMISVLITYPCIFIASEIFRRTRRWKRRWTEDQEAKMKKMFLLPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILLIIFVLAKKLLGAVSTDQEANIDEFVKDDLKKVLGANLNPPDQEKLEKIKKDKASGQRLSRVVGDALTYVLSLLLLTALAYDARSQVTFDQTKMIRSRFIKSNVQTYMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTVSALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFGIYGGGGYIASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVELLSIFLSLSIIICTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMVDHVWNIFNEMMTGFKSSMKYTVPDALKKKAIVPVDMSDVDMQFASKENIRNMVSKRVNPSLRRKLADLNGEKYKTEKRENKPNSENDVYINPISFTDIKVAATGSQILDDKTFAERLPKYRAKQNAVDTNNQPPSYMEPVRPLKPNPKIDYILQNRKK 1803          

HSP 2 Score: 541.576 bits (1394), Expect = 9.183e-160
Identity = 326/327 (99.69%), Postives = 327/327 (100.00%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNGMXXXXXXXXXXXXXXXXXXXXXXXNCDNPSPLNGGLGCSSCVTVIFGSCGMSDINVENCTWISCSDPQLVAQNIISDTLSKLNISGTNSTMSVQQTMNLAFDVVNKIQSALQNALLNSTGPLMIQTNEVTVGLQSLSPTSGQQNISMVSTDKGKISIGSSLNLTTPTVVTXXXXXXXXXXXXXXXXXXXXXMLSLTIQNVSNTTPVQLSVSIPNSNQQVESDMLSPVKFNVSNQLIQTLQYTSLSTVYKLSMNLSNATDFTIFFSASSLANTTDSSDAFIYLSNQL 1061
            IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNGMWSSWSTWSSCSSSCGFGTRSRTRNCDNPSPLNGGLGCSSCVTVIFGSCGMSDINVENCTWISCSDPQLVAQNIISDTLSKLNISGTNSTMSVQQTMNLAFDVVNKIQSALQNALLNSTGPLMIQTNEVTVGLQSLSPTSGQQNISMVSTDKGKISIGSSLNLTTPTVVTFSALKSSVFFSASSVADTSAAMLSLTIQNVSNTTPVQLSVSIPNSNQQVESDMLSPVKFNVSNQLIQTLQYTSLSTVYKLSMNLSNATDFTIFFSASSLANTTDSSDAFIYLSNQ+
Sbjct:  276 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNGMWSSWSTWSSCSSSCGFGTRSRTRNCDNPSPLNGGLGCSSCVTVIFGSCGMSDINVENCTWISCSDPQLVAQNIISDTLSKLNISGTNSTMSVQQTMNLAFDVVNKIQSALQNALLNSTGPLMIQTNEVTVGLQSLSPTSGQQNISMVSTDKGKISIGSSLNLTTPTVVTFSALKSSVFFSASSVADTSAAMLSLTIQNVSNTTPVQLSVSIPNSNQQVESDMLSPVKFNVSNQLIQTLQYTSLSTVYKLSMNLSNATDFTIFFSASSLANTTDSSDAFIYLSNQV 602          
BLAST of PKD1L-2 vs. TrEMBL
Match: A0A267G7R4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019064g1 PE=4 SV=1)

HSP 1 Score: 829.321 bits (2141), Expect = 0.000e+0
Identity = 479/1132 (42.31%), Postives = 712/1132 (62.90%), Query Frame = 2
Query: 1085 LRITIPSGQVTP----------PNNMTLVMITSTNTT--NGILLLSLGVASLTPRIWNFNMEVWQDFSASVDDTSDISNINFKSNFLGTFSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMWRKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVLLEIKRDEKFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIFXXXXXXXXXXXEDQEAKMKKMFLLPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILLIIFVLAKKLLGAVSTDQEA-NIDEFVKDDLKKVL-GANLNPPDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIKSNVQTYMDF---YDWAQG-ILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVP--CNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNY------------LSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSAL-YYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMVDHVWNIFNEMMTGFKSSMKYTVPDALKKKAIVP----VDMSDVDMQF----------ASKENIRNMVSKRVNPSLR 4339
            L + IP GQ+             +N T    + +N T  +  + L++GVAS+TPR W+  +  W D  A V + S I  + FKSNF G++S K+FIAPN I+F  VF NFA  LA ++V L+V+ LI  +Y+++ + MWR DR+E+  LRYEPL DN+ + +Y+++ISV+TG    A T+S++FINL G WGSSG R+++DG R   F  G+VCNF MTT +PLG+L  L++WH++SG KP W LEK++IED+QT K Y+FMC+ WL+++KFD  T RVL E+K+D++FQ +  R K  GV++KH+I  +   TG S Y+R+Q+  V   MFFL MV NAM++GK ++L  +ANF ID G IS+TWFQ Y+GI+S+ ITYPCIF A+EIFRRT++W+RRW+ED     KK   LPKGF+ +GW LL + +  S FFTFLYS++WG EK+N WL++FF+GI  +V ++DPI LLI+FV+AKK+ G   +++    +D+ + DDLK+VL G    PPD  ++E+I+ ++ + Q++S+   D ++YV+ + LL ALAYD+R QV+F Q + ++ +F+ +    + DF   +DW  G I+   Y    YN    TGDL  AI  CDC++QGPFR+RQ+RV    C ++    K Y      C+ +++  + D   +   W P +N         W RN             + P + V+ AF Y++      +PFEG F  Y G GY A+LG+   +A +II  L+A NWLD+ TRA+F EGTVYN NTNLFTTIQ+L E P +GG+  +  GVR+YRLY+Y  G  I+L+ MQ L+AL  +  IYRE + +   + +YF   WN +E ++I L ++I+I   +RI +TI++I ++  N+G YV+FD    W+E +C+ M +S F++I RVLK++GFNK+I+I+  T+ +   QLSS G  F+  + AFL+ G ILFS     F ++L+S  SLF   + I  Y  +F       ++L ++  WS L+VFF+ SVF+ IL DTY+  + + L+ YD+E V+H+W+ F   M    +S K  + +AL+K         V   D+++Q            ++E+     +K +NP  R
Sbjct: 1027 LSVFIPGGQMAAGSAVFMSLELADNGTAAAASGSNVTTESANMSLTVGVASITPRAWSDLLGGWVDTDAEVAEESSIEKMVFKSNFFGSYSGKMFIAPNTINFATVFNNFAGKLAENFVTLLVLCLIIGIYVVVSVWMWRLDRQEAANLRYEPLEDNEFDNDYTFIISVYTGDESGADTTSNVFINLAGTWGSSGKRQLSDGVRQN-FSRGSVCNFAMTTRAPLGELRGLKVWHDNSGKKPGWFLEKILIEDLQTKKNYVFMCDQWLAENKFDSRTMRVLPEVKQDQRFQEMMLRYKAGGVVNKHVITALFRKTGQSNYSRLQRTGVANAMFFLTMVCNAMWYGKGDDLDAEANFSIDLGPISVTWFQLYSGILSMAITYPCIFAAAEIFRRTKKWQRRWSEDDVESKKKEIRLPKGFLVIGWGLLLLGVGLSFFFTFLYSIEWGKEKANGWLKSFFLGILQLVVVTDPICLLIVFVVAKKIFGQKESEENVFELDDLINDDLKQVLDGTEYAPPDPTRMEEIRAERRNNQKMSQTFTDVMSYVVYMFLLVALAYDSRDQVSFRQNQNLKDQFLTAAPTRFNDFKHVFDWLNGSIVPRLYRTTEYNGEPLTGDLKDAIDTCDCIKQGPFRLRQLRVNPRKCPVTWPF-KAYPQKSWICSSDFSPQAADQAVYRPLWLPDSN--------GWVRNASLQMRAKSQIKRMRPDEIVLQAFWYRSADSMMSFPFEGAFTTYPGDGYAATLGLNSAEAMWIINRLRATNWLDEKTRAMFLEGTVYNANTNLFTTIQILLEFPAAGGILTYKNGVRTYRLYNYTGGKGIILMAMQGLFALICLYQIYRETRSLLTLRLKYFDDLWNKIEFVNILLCITIMITYGIRIKITIDSIELMMNNRGMYVAFDNVIEWVEATCVAMALSVFLTIFRVLKFLGFNKHIAILLATVKQCARQLSSFGVAFVLIMAAFLSAGTILFSFTEASFASVLSSCRSLFTTALGIQGYTQIFVNSQGTTASLIFFGGWSCLAVFFLVSVFVSILTDTYSVVVSDGLYSYDEEFVNHMWSKFMGTMASI-TSKKDELGEALQKSVSAVKRRMVTEDDIEIQLNEDRRQESVGGAEESSGGKKAKDINPGSR 2147          
BLAST of PKD1L-2 vs. TrEMBL
Match: A0A1I8J395 (PKD_channel domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 625.55 bits (1612), Expect = 0.000e+0
Identity = 365/877 (41.62%), Postives = 549/877 (62.60%), Query Frame = 2
Query: 1832 MCETWLSDSKFDGNTERVLLEIKRDEKFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIFXXXXXXXXXXXEDQEAKMKKMFLLPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILLIIFVLAKKLLGAVSTDQEA-NIDEFVKDDLKKVL-GANLNPPDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIKSNVQTYMDF---YDWAQG-ILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVP--CNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNR-----NYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSAL-YYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMVDHVWNIFNEMMTGFKSSMKYTVPDALKKKAIVP----VDMSDVDMQF----------ASKENIRNMVSKRVNPSLRRKLADLNGEKYKT 4378
            MC+ WL+++KFD  T RVL E+K+D++FQ +  R K  GV++KH+I  +   TG S Y+R+Q+  V   MFFL MV NAM++GK ++L  +ANF ID G IS+TWFQ Y+GI+S+ ITYPCIF A+EIFRRT++W+RRW+ED     KK   LPKGF+ +GW LL + +  S FFTFLYS++WG EK+N WL++FF+GI  +V ++DPI LLI+FV+AKK+ G   +++    +D+ + DDLK+VL G    PPD  ++E+I+ ++ + Q++S+   D ++YV+ + LL ALAYD+R QV+F Q + ++ +F+ +    + DF   +DW  G I+   Y    YN    TGDL  AI  CDC++QGPFR+RQ+RV    C ++    K Y      C+ +++  + D   +   W P +N  V  N S   R       + P + V+ AF Y++      +PFEG F  Y G GY A+LG+   +A +II  L+A NWLD+ TRA+F EGTVYN NTNLFTTIQ+L E P +GG+  +  GVR+YRLY+Y  G  I+L+ MQ L+AL  +  IYRE + +   + +YF   WN +E ++I L ++I+I   +RI +TI++I ++  N+G YV+FD    W+E +C+ M +S F++I RVLK++GFNK+I+I+  T+ +   QLSS G  F+  + AFL+ G ILFS     F ++L+S  SLF   + I  Y  +F       ++L ++  WS L+VFF+ SVF+ IL DTY+  + + L+ YD+E V+H+W+ F   M    +S K  + +AL+K         V   D+++Q            ++E+     +K +NP L+ KLA +N +K +T
Sbjct:    1 MCDQWLAENKFDSRTMRVLPEVKQDQRFQEMMLRYKAGGVVNKHVITALFRKTGQSNYSRLQRTGVANAMFFLTMVCNAMWYGKGDDLDAEANFSIDLGPISVTWFQLYSGILSMAITYPCIFAAAEIFRRTKKWQRRWSEDDVESKKKEIRLPKGFLVIGWGLLLLGVGLSFFFTFLYSIEWGKEKANGWLKSFFLGILQLVVVTDPICLLIVFVVAKKIFGQKESEENVFELDDLINDDLKQVLDGTEYAPPDPTRMEEIRAERRNNQKMSQTFTDVMSYVVYMFLLVALAYDSRDQVSFRQNQNLKDQFLTAAPTRFNDFKHVFDWLNGSIVPRLYRTTEYNGEPLTGDLKDAIDTCDCIKQGPFRLRQLRVNPRKCPVTWPF-KAYPQKSWICSSDFSPQAADQAVYRPLWLPDSNGWVR-NASLQMRAKSQIKRMRPDEIVLQAFWYRSADSMMSFPFEGAFTTYPGDGYAATLGLNSAEAMWIINRLRATNWLDEKTRAMFLEGTVYNANTNLFTTIQILLEFPAAGGILTYKNGVRTYRLYNYTGGKGIILMAMQGLFALICLYQIYRETRSLLTLRLKYFDDLWNKIEFVNILLCITIMITYGIRIKITIDSIELMMNNRGMYVAFDNVIEWVEATCVAMALSVFLTIFRVLKFLGFNKHIAILLATVKQCARQLSSFGVAFVLIMAAFLSAGTILFSFTEASFASVLSSCRSLFTTALGIQGYTQIFVNSQGTTASLIFFGGWSCLAVFFLVSVFVSILTDTYSVVVSDGLYSYDEEFVNHMWSKFMGTMASI-TSKKDELGEALQKSVSAVKRRMVTEDDIEIQLNEDRRQESVGGAEESSGGKKAKDINPGLKMKLAVVNRDKPET 874          
BLAST of PKD1L-2 vs. TrEMBL
Match: A0A1I8FWM9 (PKD_channel domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 625.55 bits (1612), Expect = 0.000e+0
Identity = 376/939 (40.04%), Postives = 568/939 (60.49%), Query Frame = 2
Query: 1832 MCETWLSDSKFDGNTERVLLEIKRDEKFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIFXXXXXXXXXXXEDQEAKMKKMFLLPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILLIIFVLAKKLLGAVSTDQEA-NIDEFVKDDLKKVL-GANLNPPDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIKSNVQTYMDF---YDWAQG-ILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVP--CNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNR-----NYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSAL-YYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMVDHVWNIFNEMMTGFKSSMKYTVPDALKKKAIVP----VDMSDVDMQF----------ASKENIRNMVSKRVNPSLRRKLADLNGEKYKTEKRENKPNSENDVYINPISFTDIKVAATG--SQILDDKTFAERLPKYRAKQNAVDTNNQPPS 4558
            MC+ WL+++KFD  T RVL E+K+D++FQ +  R K  GV++KH+I  +   TG S Y+R+Q+  V   MFFL MV NAM++GK ++L  +ANF ID G IS+TWFQ Y+GI+S+ ITYPCIF A+EIFRRT++W+RRW+ED     KK   LPKGF+ +GW LL + +  S FFTFLYS++WG EK+N WL++FF+GI  +V ++DPI LLI+FV+AKK+ G   +++    +D+ + DDLK+VL G    PPD  ++E+I+ ++ + Q++S+   D ++YV+ + LL ALAYD+R QV+F Q + ++ +F+ +    + DF   +DW  G I+   Y    YN    TGDL  AI  CDC++QGPFR+RQ+RV    C ++    K Y      C+ +++  + D   +   W P +N  V  N S   R       + P + V+ AF Y++      +PFEG F  Y G GY A+LG+   +A +II  L+A NWLD+ TRA+F EGTVYN NTNLFTTIQ+L E P +GG+  +  GVR+YRLY+Y  G  I+L+ MQ L+AL  +  IYRE + +   + +YF   WN +E ++I L ++I+I   +RI +TI++I ++  N+G YV+FD    W+E +C+ M +S F++I RVLK++GFNK+I+I+  T+ +   QLSS G  F+  + AFL+ G ILFS     F ++L+S  SLF   + I  Y  +F       ++L ++  WS L+VFF+ SVF+ IL DTY+  + + L+ YD+E V+H+W+ F   M    +S K  + +AL+K         V   D+++Q            ++E+     +K +NP L+ KLA +N          +KP +       P    D  +   G  S +  +    + +P++  K  A+D   QPP 
Sbjct:    1 MCDQWLAENKFDSRTMRVLPEVKQDQRFQEMMLRYKAGGVVNKHVITALFRKTGQSNYSRLQRTGVANAMFFLTMVCNAMWYGKGDDLDAEANFSIDLGPISVTWFQLYSGILSMAITYPCIFAAAEIFRRTKKWQRRWSEDDVESKKKEIRLPKGFLVIGWGLLLLGVGLSFFFTFLYSIEWGKEKANGWLKSFFLGILQLVVVTDPICLLIVFVVAKKIFGQKESEENVFELDDLINDDLKQVLDGTEYAPPDPTRMEEIRAERRNNQKMSQTFTDVMSYVVYMFLLVALAYDSRDQVSFRQNQNLKDQFLTAAPTRFNDFKHVFDWLNGSIVPRLYRTTEYNGEPLTGDLKDAIDTCDCIKQGPFRLRQLRVNPRKCPVTWPF-KAYPQKSWICSSDFSPQAADQAVYRPLWLPDSNGWVR-NASLQMRAKSQIKRMRPDEIVLQAFWYRSADSMMSFPFEGAFTTYPGDGYAATLGLNSAEAMWIINRLRATNWLDEKTRAMFLEGTVYNANTNLFTTIQILLEFPAAGGILTYKNGVRTYRLYNYTGGKGIILMAMQGLFALICLYQIYRETRSLLTLRLKYFDDLWNKIEFVNILLCITIMITYGIRIKITIDSIELMMNNRGMYVAFDNVIEWVEATCVAMALSVFLTIFRVLKFLGFNKHIAILLATVKQCAHQLSSFGVAFVLIMAAFLSAGTILFSFTEASFASVLSSCRSLFTTALGIQGYTQIFVNSQGTTASLIFFGGWSCLAVFFLVSVFVSILTDTYSVVVSDGLYSYDEEFVNHMWSKFMGTMASI-TSKKDELGEALQKSVSAVKRRMVTEDDIEIQLNEDRRQESVGGAEESSGGKKAKDINPGLKMKLAVVN---------RDKPETGESYVWTPKETGDEVLVDAGELSAVATEDAEPDWIPRF--KSTALDL--QPPG 923          
BLAST of PKD1L-2 vs. TrEMBL
Match: A0A1I8FX52 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 354/877 (40.36%), Postives = 537/877 (61.23%), Query Frame = 2
Query: 1832 MCETWLSDSKFDGNTERVLLEIKRDEKFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIFXXXXXXXXXXXEDQEAKMKKMFLLPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILLIIFVLAKKLLGAVSTDQEA-NIDEFVKDDLKKVL-GANLNPPDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIKSNVQTYMDF---YDWAQG-ILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVP--CNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNR-----NYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSAL-YYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMVDHVWNIFNEMMTGFKSSMKYTVPDALKKKAIVP----VDMSDVDMQF----------ASKENIRNMVSKRVNPSLRRKLADLNGEKYKT 4378
            MC+ WL+++KFD  T RVL E+K+D++FQ +  R K  GV++KH+I  +   TG S Y+R+Q+  V   MFFL MV NAM++GK ++L  +ANF ID G IS+TWFQ Y+GI+S+ ITYPCIF A+EIFRRT++W+RRW+ED     KK   LPKGF+ +GW LL + +  S FFTFLYS++WG EK+N WL++FF+GI  +V ++DPI LLI+FV+AKK+ G   +++    +D+ + DDLK+VL G    PPD  ++E+I+ ++ + Q++S+   D ++YV+ + LL ALAYD+R QV+F Q + ++ +F+ +    + DF   +DW  G I+   Y    YN    TGDL  AI  CDC++QGPFR+RQ+RV    C ++    K Y      C+ +++  + D   +   W P +N  V  N S   R       + P + V+ AF Y++      +PFEG F  Y G GY A+LG      + ++R             ++F EGTVYN NTNLFTTIQ+L E P +GG+  +  GVR+YRLY+Y  G  I+L+ MQ L+AL  +  IYRE + +   + +YF   WN +E ++I L ++I+I   +RI +TI++I ++  N+G YV+FD    W+E +C+ M +S F++I RVLK++GFNK+I+I+  T+ +   QLSS G  F+  + AFL+ G ILFS     F ++L+S  SLF   + I  Y  +F       ++L ++  WS L+VFF+ SVF+ IL DTY+  + + L+ YD+E V+H+W+ F   M    +S K  + +AL+K         V   D+++Q            ++E+     +K +NP L+ KLA +N +K +T
Sbjct:    1 MCDQWLAENKFDSRTMRVLPEVKQDQRFQEMMLRYKAGGVVNKHVITALFRKTGQSNYSRLQRTGVANAMFFLTMVCNAMWYGKGDDLDAEANFSIDLGPISVTWFQLYSGILSMAITYPCIFAAAEIFRRTKKWQRRWSEDDVESKKKEIRLPKGFLVIGWGLLLLGVGLSFFFTFLYSIEWGKEKANGWLKSFFLGILQLVVVTDPICLLIVFVVAKKIFGQKESEENVFELDDLINDDLKQVLDGTEYAPPDPTRMEEIRAERRNNQKMSQTFTDVMSYVVYMFLLVALAYDSRDQVSFRQNQNLKDQFLTAAPTRFNDFKHVFDWLNGSIVPRLYRTTEYNGEPLTGDLKDAIDTCDCIKQGPFRLRQLRVNPRKCPVTWPF-KAYPQKSWICSSDFSPQAADQAVYRPLWLPDSNGWVR-NASLQMRAKSQIKRMRPDEIVLQAFWYRSADSMMSFPFEGAFTTYPGDGYAATLG------STVLRP------------SMFLEGTVYNANTNLFTTIQILLEFPAAGGILTYKNGVRTYRLYNYTGGKGIILMAMQGLFALICLYQIYRETRSLLTLRLKYFDDLWNKIEFVNILLCITIMITYGIRIKITIDSIELMMNNRGMYVAFDNVIEWVEATCVAMALSVFLTIFRVLKFLGFNKHIAILLATVKQCARQLSSFGVAFVLIMAAFLSAGTILFSFTEASFASVLSSCRSLFTTALGIQGYTQIFVNSQGTTASLIFFGGWSCLAVFFLVSVFVSILTDTYSVVVSDGLYSYDEEFVNHMWSKFMGTMASI-TSKKDELGEALQKSVSAVKRRMVTEDDIEIQLNEDRRQESVGGAEESSGGKKAKDINPGLKMKLAVVNRDKPET 856          
BLAST of PKD1L-2 vs. Ensembl Cavefish
Match: pkd1l2a (polycystin 1 like 2 [Source:NCBI gene;Acc:103044173])

HSP 1 Score: 158.688 bits (400), Expect = 2.590e-38
Identity = 102/340 (30.00%), Postives = 172/340 (50.59%), Query Frame = 2
Query: 1211 RIWNFNMEVWQDFSASVDDTSDISNINFKSNFLGTFSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMW--RKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVL-LEIKRD-EKFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIF 2218
            + W+     W D+   V   +           L  F +  F+ PN++D       FA+ + N  VV  V  +     L++   +W  RKD +++  L+   L DNDP  EY Y+++V TG    A TSS + + +LG  G S    +TD ++  +FE G V  F++TT   LGDL ++R+WH++SG  P+W + K++++D++T + + F+C +WL+    +   ++V  +  + D ++F NLF         D HI   + +    S +TRVQ+V+   ++    M++N MF+G   + S      +D G I  TW Q   GI S +I +P   +   IF
Sbjct: 1411 KYWDETKTNWSDYGCRVGPRTTPQLTQCLCTHLTFFGSSFFVMPNLVDVSRTAELFATFVNNPVVVCFVGAIFLAYLLVV---IWARRKDIQDTAKLKLTVLQDNDPLAEYRYLVTVTTGHRLGASTSSQVTVTILGSEGESEPHHLTDPHKP-VFERGAVDMFLLTTPFSLGDLQSIRLWHDNSGTHPAWFVNKVMVQDLETGQKWHFLCSSWLAIDVGECTLDKVFPVATEMDLKQFSNLFFMKTAKDFRDGHIWFSVISRPPSSNFTRVQRVSCCFSLLLCTMLTNIMFWGIPTDPSEQT---MDLGKIEFTWQQVMIGIQSSIIMFPINLLIVSIF 1743          

HSP 2 Score: 157.147 bits (396), Expect = 8.662e-38
Identity = 161/639 (25.20%), Postives = 288/639 (45.07%), Query Frame = 2
Query: 2288 LPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILLIIFVLAKKLLGAVSTDQEANIDEFV------KDDLKKVLGANLN-------PPDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIK--SNVQTYMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVP-CNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMVD 4156
            LP  F+FVGW L+      S +FT +Y L +G +KS  WL +  V  F  +F++ P+ +L   V    +L  V  DQE   D  +       DD   V  A  +       PP    +EK++ +    Q++  ++ + L Y+  L +L  +AY  R    F  T+ I+  F    S+  T+ + + WA   L         NN+   G     I   +    G  R+RQ+RV+  +C +      +  +VP C+  Y+   ED  S+   W P         D+N ++   +P Q       YQ  +    +P  G   +Y GGG++  LG  +E A+  ++ L  N WLD  TRAIF E TVYN N NLF  + ++FE    G  + +   ++S RLY    G  I ++  +++Y L +   ++++ K + +QK EYF S WNL+++  I LS S +     R ++   +I     +K  Y  F++  +       ++     ++ +++   +  N  + ++  T+ RA+  +S    +     +A+    N+L+      +  LL +  ++  + + I  Y ++ +  P    A           F + ++FI ++   ++E    +    ++E+VD
Sbjct: 1958 LPWWFVFVGWFLVAATSGVSAYFTMMYGLTYGKQKSISWLISMLVSFFESLFITQPVKVLGFAVFFALVLKKV--DQEEYGDVPIDGNLPNSDDPDAVRFARRDSTCSFYQPPPPSNIEKMRNNMIKEQKVFGLIREILIYMGFLWMLLLVAYGQRDPNAFYLTQHIQQSFSNGISDSMTHGEVFQWANSTL--------LNNL--FGQQPGFITDGNSKLVGNARLRQVRVQDGSCRVD---RSMRNSVPDCHAPYSWDMEDLGSYGPGWNPSI-------DANLSKTLPTPWQ-------YQTQSRLRAHPIWGGVAVYRGGGFVVDLGPNRENASSSLQYLFENTWLDMFTRAIFVEFTVYNANVNLFCIVTLMFETTAVGAFQ-YRSELQSVRLYQSTGGLHIFVMASEVVYFLFIFYYMFQQGKLMKQQKWEYFRSKWNLLDMAIIILSWSALPVFIKRTLLGNQSIEYYQNHKDEYAGFNETATADAVLGYIIAFLVLLATVKLWHLLRLNPKLHMITSTLQRAWNDISGFIVVMTIMFLAYSVACNLLYGWKLYSYRTLLNAAQTIVSLQLGIFNYEEVLDYNPVL-GAFIVGSCIIFMTFVVLNLFISVILVAFSEEQIHHKPSEEEEIVD 2565          
BLAST of PKD1L-2 vs. Ensembl Cavefish
Match: ENSAMXT00000006495.2 (pep primary_assembly:Astyanax_mexicanus-2.0:5:35007331:35041448:1 gene:ENSAMXG00000006274.2 transcript:ENSAMXT00000006495.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 141.354 bits (355), Expect = 4.200e-33
Identity = 99/359 (27.58%), Postives = 179/359 (49.86%), Query Frame = 2
Query: 1157 NTTNGILLLSLGVASLTPRIWNFNMEVWQDFSASVDDTSDISNINFKSNFLGTFSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMW--RKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGK-WGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVL-LEIKRD-EKFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIF 2218
            N++N  +++S   A    + W+     W D+   V   +           L  F +  F+ PN +D       FA+   N  VV  V  +  + ++ +   +W  RKD ++ + ++   L DNDP  EY Y++ + TG  R A TSS + + + G  W S  H  +TD  +  +FE G V  F+++T   LGDL ++R+WH++SG  P+W + K++++D++  + + F+C +WL+    +   ++V  L  + D ++F NLF       + D H+   + +    S +TRVQ+V+   ++    M++  MF+G  ++ S  +   +  G I  +W Q   GI S +I +P   +   IF
Sbjct:  531 NSSNASVIISSIAAQC--KYWDNIKTNWSDYGCRVGPGTTRLVTQCLCTHLTFFGSSFFVMPNAVDVTRTAELFATFSQNPVVVCFVGAVFLLYFITV---VWARRKDLQDQVKVKVTVLEDNDPLAEYRYLLVISTGHRRGASTSSQVTVTVTGSVWESEPHH-LTDPDKP-VFERGGVDMFLLSTPFNLGDLQSIRLWHDNSGTHPAWYVNKVMVQDLENGQKWHFLCSSWLAIDMGECTLDKVFSLATETDLKRFSNLFFMKTAKDLFDGHLWFSVISRPANSRFTRVQRVSCCFSLLLGTMLTGIMFWGIPSDPSEQS---VTIGSIKFSWRQLMVGIQSSIIMFPVNLLIVSIF 879          

HSP 2 Score: 136.732 bits (343), Expect = 1.157e-31
Identity = 155/643 (24.11%), Postives = 286/643 (44.48%), Query Frame = 2
Query: 2288 LPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILL---IIFVLAKKLLGAVSTDQEANIDEFVKDDLKKVLG--------------ANLNPPDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIK--SNVQTYMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVP-CNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMVD 4156
            LP  F+FVGW L+      S +FT +Y L +G EKS  WL +  V  F  + L  P+ +L   + F L  K +     D E  I + +K+ +    G              +   PP    + K+K+     Q+   ++ + L Y+    +L   AY  R    F  T+ I+  F    S+  +  D + WA   L            N  G  +  I   +    G  R+RQ+RV++++C  +   S V  +VP C+  Y+   ED  S+   WT L        DSN ++   +P Q       YQ  +    +   G   +Y GGG++  L   Q+ ++ +++ L  N WLD  TRA+F E TVYN N NLF  + ++ E    G  + +   +++ RL+    G  I  L+ + +Y L ++  ++ + K + +QK EYF + WN++EL  I LS S       +++     +     ++  + SF +  +       L  +   ++ I++   M  N  ++++  T+ +A++ +SS   + +   +A+  V N+LF      +  L+ +  ++  + + I  Y ++ +  P    A           F + ++FI ++ + +++    +    ++E+VD
Sbjct: 1072 LPWWFVFVGWFLIAATSGVSAYFTMMYGLTYGKEKSISWLISLSVSFFQSLLLIQPVKVLGFAVFFALVVKSVDDDDEDDEEYI-KMLKNKVPAFSGDPDDVRISRRNSSCSFYQPPPPSDVGKMKEIWIKDQKAFALIWEILIYLGFFCMLLMAAYSQRDPNAFFLTRHIQQSFSNGISDSMSQQDVFIWANSSLLT----------NLFGQYSGFITDGNSKLVGTARLRQVRVQKSSCRKA---SSVRSSVPDCHAPYSWEVEDMGSYGPGWTSLI-------DSNMSKALFTPWQ-------YQTQSRLRAHTVWGGMALYRGGGFVVDLEPDQQNSSSVLQYLFENAWLDIYTRALFIEFTVYNANVNLFCIVTLMLETTAVGAFQ-YRTELQNIRLFQTTDG--IPTLVSEAIYFLFILYYMFLQAKLMKQQKWEYFRNKWNILELAIILLSWSAFSVFIKKMVQGDQDLKYYQDHRNQFPSFYETAAADSVLGYLTAVLVLLATIKMWHLMRLNSKLNMITNTLQQAWSDISSFIVVIVIMFLAYSIVSNLLFGWKLYTYKTLIDAATAMVSLQLGIFNYEEILDLNPVL-GAFIIGSCIIFMTFVVLNLFISVILEAFSQEQRHHKPSEEEEIVD 1682          
BLAST of PKD1L-2 vs. Ensembl Cavefish
Match: pkd2 (polycystin 2, transient receptor potential cation channel [Source:NCBI gene;Acc:103043751])

HSP 1 Score: 120.939 bits (302), Expect = 4.402e-27
Identity = 126/510 (24.71%), Postives = 227/510 (44.51%), Query Frame = 2
Query: 2774 VQTYMDFYDWAQG-ILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISA-LVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMVDHVWNIFNEMMTGFKSSMKYTVPDALKKKAIVPVDMSDVDMQFASKEN 4297
            + T  DF+ + +G  LN  Y  VWYNN  ++     ++   + L  G  R+RQ++V   +C +   L  +VY    C   Y+  SED   F +K           N++ W               +Y    I G   + G    Y GGGY   L   +E++A  ++ L+ N WLD+ TRA+F + +VYNGN NLF  +++L E P +GG  +  +  ++ RL  Y+      +   ++++ L V+  +  E+ ++   +  YF S WN ++++ + LS   II    R     N +  L  N   Y +F            L  +  F++ +++ K++ FNK +S +  T+ R    L     MF    +A+  +  ++F      F+       + F + +    + ++ ET       +Y+  +       + ++F+ I+NDTY+E +  ++     EM      I + +  G++ +M   V   L+K  +   D+SD   Q   K N
Sbjct:  212 LSTMEDFWKYTEGPFLNGMYWDVWYNN--KSLPENQSLIYYENLLLGVPRLRQVKVLNKSCPVHEDLKDEVYD---CYSIYSPASEDKAPFGLK-----------NNTAW---------------VYSEENILGESSYWGEVATYRGGGYYQDLARSREESARQLKELKDNLWLDRGTRAVFLDFSVYNGNVNLFCIVRMLVEFPATGGA-VTSWQFQTVRLVRYVSSWDYFVGTCEVVFCLFVLYYMVEEVLEIRLHRLRYFKSLWNCLDVIIVTLSAPAIIMNIYRTSAVSNRLRYLLENHSTYPNFQPLAQVQVQFNHLAAVIVFLAWVKLFKFINFNKTMSQLSTTMSRCAKDLLGFAIMFFIVFLAYAQLAYLVFGNQLNDFSTFQACIFTQFRIILGDFDFSEIEETNRVL-GPIYFTTFVFFMFMILLNMFLAIINDTYSE-VKADMAQQRSEM-----EITDLIKKGYQKAM---VKLRLRKTTV--DDISDSLRQAGGKLN 677          
BLAST of PKD1L-2 vs. Ensembl Cavefish
Match: pkd2l1 (polycystic kidney disease 2-like 1 protein [Source:NCBI gene;Acc:103031316])

HSP 1 Score: 114.39 bits (285), Expect = 3.798e-25
Identity = 118/480 (24.58%), Postives = 217/480 (45.21%), Query Frame = 2
Query: 2717 SQVTFDQTKMIRSRFIKS---------NVQTYMDFYDWAQG-ILNESYPKVWYNNMN-RTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDE 4123
            S  T+  TK++   F+ +         ++ T  DF+ +AQG +L+  Y   WYNN + +TG  T +    + +  G  R+RQ++VK  +C +     +   +  C + YN   ED  SF +            N + W   Y +  +   +       T SGG  ++              L + +E++A ++ NL  N WLD  TRA+F + + YN N NLF  I+++ E P +GG  +  Y +R+ +L  Y+      ++  +I++ + ++  I  EI ++   K  YF S WN+++++ I L++  I+    R +     +  L      Y  F+    W      +  ++ F + I++ KY+ FNK ++ +  T+ R  T +     MF     A+  +G +LF      F+       + F + +    Y D  E        +Y+  +     F + ++F+ I+NDTY+E  +E
Sbjct:  142 SSTTYYYTKVMTDLFVNAPSDSGVTFQSIGTMDDFWSYAQGPLLDGLYWTSWYNNQSLQTG--THSFIYYENMLLGVPRVRQLKVKNKSCKVHKDFEEEISD--CFDVYNEKKEDDSSFGL-----------INGTAWQ--YHTEKELKGSNHWGMLATYSGGGYYQ-------------DLALTKEESAGVLANLNNNLWLDHGTRAVFIDFSTYNANINLFCVIRLVVEFPATGG-AIPSYQIRTVKLIRYITTWDYFIIGCEIVFCVFILYYIVEEILELRIHKLSYFKSIWNILDVVIIMLAIVAIVFNVFRTIKVDKLLGNLLKEPSIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCATDILGFAIMFFIVFFAYAQLGYLLFGTEVESFSTFHKCIFTQFRIILGDFDY-DGIERANRVLGPIYFFTYVFFVFFVLLNMFLAIINDTYSEVKEE 589          
BLAST of PKD1L-2 vs. Ensembl Cavefish
Match: pkd1a (polycystic kidney disease 1a [Source:ZFIN;Acc:ZDB-GENE-100707-1])

HSP 1 Score: 93.5893 bits (231), Expect = 1.910e-18
Identity = 50/134 (37.31%), Postives = 78/134 (58.21%), Query Frame = 2
Query: 1475 RRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLS--DSKFDG 1870
            RR S++    PL   D  Y+Y   I V TG  R AGT++ + ++L G  G SGHR +    R G F   ++  F + TD+ LG ++ +R WH++ G+ P+W L+ ++++D+QT   Y F+ E WLS  + K DG
Sbjct: 3079 RRASVV----PLCGKDGLYKYE--IQVKTGWSRGAGTTAHVGVSLHGSEGRSGHRHLD---RVGAFTRNSLDIFHIATDTSLGSVLKIRAWHDNKGLSPAWLLQYVLVKDLQTGSSYFFLVEEWLSVDNEKTDG 3203          
BLAST of PKD1L-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007306.1 (pep scaffold:Pmarinus_7.0:GL480012:400827:419749:1 gene:ENSPMAG00000006595.1 transcript:ENSPMAT00000007306.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 170.244 bits (430), Expect = 6.777e-43
Identity = 121/398 (30.40%), Postives = 199/398 (50.00%), Query Frame = 2
Query: 1316 FSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMWRKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGI--KPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVL--LEIKRDEKFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIFXXXXXXXXXXX--------EDQEAKMKKMFLLPK-----GFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPI 2458
            F+A+ F+ PN IDF  VFA F  L +N+ V   VI ++ + +LLL+    R DRR+    +  PL+DND  + Y Y++S+ TG    AGT S ++  +    G +G R + +G+  G F  G+   F MT     G+   + IWH++SG   + SW L  +++ DI   + + F C+ WL+    DG   R L     +       +F     S + D H+   +      S ++RVQ+++  V++ FL MV+NAM+F    +   D    +  G  +++  +   G++S LI +P  F+   +FRR                 E      +K  L  +      + FV WSL+F+++V S FFT LYS++WG +K+N WL+ F +  F  + +  P+
Sbjct:    1 FAAEFFVPPNTIDFATVFAKF-DLRSNAAVFTTVIAILLLYFLLLLYAR-RADRRDKDNWKIRPLVDNDDSHAYVYLLSIVTGMRAGAGTQSRVYFTVHFSLGDTGTRILHNGHLKG-FSRGSTVTFEMTVPYYWGEPKNITIWHDNSGPGGQGSWFLRHILLHDIHAKQTFAFPCDRWLAAEFEDGQLCRELPVAGFQFVPSTGMVFSSTVQSKITDDHMWVSVFMRPTRSAFSRVQRISCCVSLLFLTMVTNAMWFETGPSTGSD---NVQIGPFTLSLSEMLIGLMSNLIVFPISFVIVAVFRRQTYSPATLRFFETHGKGEGDPGPWRKPPLCRRITATAFYKFVAWSLVFLSVVTSGFFTILYSMEWGPDKANLWLRVFIMSFFQSIIIVQPV 392          

HSP 2 Score: 95.1301 bits (235), Expect = 7.496e-20
Identity = 96/451 (21.29%), Postives = 183/451 (40.58%), Query Frame = 2
Query: 2810 GILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIR-VKRN------------TCTISALVSKVYGNVPCNENYNLLSEDTRSFSV------KWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTY 4105
            G L   YP+ WYN    +      +     +R GP R+RQIR V R             T + +  V     N  C E         R + +      +  P+ + S++                     LY      GG+              IA LG+       I+ NL + +WLD  TRA+  E T YN NT+LF ++ +L E     G       +  +R+  ++     +  ++ I++A+ +V+    E  ++ +    YF S WN+ ELLSI L  + ++   +++ V    +     +   +V+F +  +W +    L+    FVS I+VL +M   +   ++ G    A   +     + +    +F  + ++LF+ +   +    T    LF + +    YG+++         +Y+  +++++ F I +  + IL++ +
Sbjct:  657 GFLPNFYPRAWYNGERMSWRERYYLRDFSTIRVGPGRLRQIRSVPRAWNLLLSAPTAVATLSRAPYVVAARANQRCGEGTTQRKRAVRQYQIFSHRVTQLVPVWHPSLA---------------------LYSG----GGF--------------IAELGLNLADGTEIVANLSSASWLDHSTRAVLTEFTGYNMNTDLFCSVTLLLEFSQGAGDAHGHAYIHVFRIESFVGKLETLTGVVYIVFAILLVIIAATEALRLSELGVAYFKSFWNIAELLSITLGAASVVTYFIKMSVATRTLEKFRTDPHKFVNFQELVTWDQQLSELLATLVFVSTIKVLGHMKSLRQFEVLVGAFSEARDHIQGFAVIVVVVFCSFGQLTSLLFAGSLRNYRTFTTCLEQLFSLLLGQPGYGELYAANRVLGPLIYF-AFTSVNTFVIVNFSLGILSEGF 1067          
BLAST of PKD1L-2 vs. Ensembl Sea Lamprey
Match: pkd2l1 (polycystic kidney disease 2-like 1 [Source:ZFIN;Acc:ZDB-GENE-030616-558])

HSP 1 Score: 115.931 bits (289), Expect = 1.483e-26
Identity = 131/585 (22.39%), Postives = 257/585 (43.93%), Query Frame = 2
Query: 2726 TFDQTKMIRSRFIKS-----------NVQTYMDFYDWAQG-ILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVP-CNENYNLLSEDTRSFS----VKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTY-------AETIDE-NLFDYDKEMVDHVWNIFN-------EMMTGFKSSMKYTVPDALKKKAIVPVDMSDVDMQFA-SK--ENIRNMVSKRVNPSLRRKLADLNGEKYK 4375
            T+  TK++   F++S           ++ +  DF+   QG +L+  Y + WYN      +L+  I   + +   P R+RQ++V+  +CTI  L   +   +P C + Y+   ED  +F       W   +   +S   S+W               L    + +G Y                 L  ++ ++A +++ L+   WLD  TRA+F + T YNGN NLF  ++++ E P +GG  +  Y  R+ +L  Y+      ++  ++++   ++  +  E  ++     +YF S WN ++++ I LS+  II    R +   N +  L  +   Y  F+    W      ++ I+ F + I++ KY+ FNK ++ +  T+ R    +     MF     A+   G ++F      F++ +    + F + +    +  + E        +Y+  +     F + ++F+ I+NDTY       A+T D+  + D+ K+   ++ N          +M     S+ K+   D + +K ++ +  SD ++  A SK  ++  N++ +     LR   A+L G+K K
Sbjct:   56 TYYYTKVMMDLFVESPVSPIDGTNFNSISSMDDFWKVVQGPVLDGLYWEKWYNGDQLPVNLSF-IQYENVMLGVP-RVRQLKVRNGSCTIYPLFRNI---IPGCYDGYSCGEEDKETFGRGTGTAWKYWSEEELS-GSSHWG--------------LLAQYSGAGYY---------------RDLSRRKNESAPMLQELKDYLWLDHGTRAVFIDFTTYNGNINLFCVVRLVVEFPLTGG-ALPSYQFRTVKLIRYVSAFDYFIMACEVIFCCFILYYVVEECLELRLHGMKYFKSVWNCLDIIVIVLSMVAIIFNICRTIAVSNLLGALLNDPNIYADFEYLAFWQTQFNNMLAINVFFAWIKIFKYVSFNKTLTQLSSTLARCAKDVLGFAVMFFIIFFAYAQTGYLVFGSQVEDFSSFVNCIFTQFRIILGDFDFHAI-ENANRILGPIYFTTYIFFVFFVLLNMFLAIINDTYTDVKAELADTKDDFEIGDFFKQGYKNMLNKLKMKKDDIADMQRALDSAGKHLEYD-IWRKNLIRLGHSDEEIAAAFSKFDKDSDNVLDEDEQKQLR---AELEGQKDK 599          
BLAST of PKD1L-2 vs. Ensembl Sea Lamprey
Match: pkd2l1 (polycystic kidney disease 2-like 1 [Source:ZFIN;Acc:ZDB-GENE-030616-558])

HSP 1 Score: 115.931 bits (289), Expect = 2.049e-26
Identity = 120/455 (26.37%), Postives = 205/455 (45.05%), Query Frame = 2
Query: 2780 TYMDFYDWAQG-ILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSK-VYGNVPCNENYNLLSEDTRSFS-VKWTPLANSSVSFNDSNWNRNY-LSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFI---TSVFICILNDTYAETIDE 4123
            T+ DF+   QG +LN  Y + WYN++    +   +    +    G  RIRQ++V+ ++CT+ A   K V G   C   Y+  +ED  SF     TP   S+ S  D N + ++ L  T +             GGY  +              L   + ++A ++++L    WLD+ TRAI  + + YNGN NLF+ I++L E P +GG  +    + + +L  Y+ G+   +L  + ++   ++  I  EI ++   K  YF S WN ++LL I LS+  II    R +     +  L      Y +F     W      ++ ++ F   I+  KY+ FNK ++ +  T+ R    +     MF     A+  +G +LF      F+       + F + +    + +  E        LY+  +    VFF+    ++F+ I+NDTYAE  +E
Sbjct:  171 TFDDFWKVVQGPVLNGLYWEKWYNDIPLVEN--QSFIYYENFLLGVPRIRQLKVRNDSCTVHADFQKDVQG---CYAAYSEDAEDKASFGPATGTPWKYSTSS--DMNGSSHWGLLATYS------------GGGYYLD--------------LTRSKSESAILLQDLFDKQWLDRGTRAILIDFSSYNGNINLFSVIRLLVEFPPTGG-AVPSSQIYTVKLIRYVTGSDYFILACEGIFCCFILYYIVEEILELSIHKFAYFKSVWNCLDLLVIMLSVVAIIFNVYRTVTVNKLLKALLDEPNRYGNFQFLAFWQTQYNNMVAVNVFFCWIKFFKYVSFNKTMTQLSSTLARCAKDVLGFAVMFFIIFFAYAQLGYLLFGTQVEDFSTFSNCIFTQFRIILGDFDF-NAIENANRVLGPLYFTTY-VFVVFFVLLPKNMFLAIINDTYAEVKNE 589          
BLAST of PKD1L-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010652.1 (pep scaffold:Pmarinus_7.0:GL477016:137094:159626:-1 gene:ENSPMAG00000009641.1 transcript:ENSPMAT00000010652.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.8265 bits (242), Expect = 1.545e-20
Identity = 56/202 (27.72%), Postives = 98/202 (48.51%), Query Frame = 2
Query: 1466 RKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVLLEIKRDEKFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAM 2071
            R DR +       PL DN P     Y +++ TG    AGT++   + L G+ G+S  R++       LFE  +   F+M+    LG +  L +WHN+ G  PSW + ++ + D+ +   ++F  E WL+  + DG  ER LL +    +F  L      + + D H+ A + +    S +T  Q+++V + +      +NA+
Sbjct: 1307 RWDRHDEHKAGAIPLQDNLPSDRQLYEVTLETGFRAGAGTTAKANVILHGEHGTSETREL-HCEDKPLFERNSTHTFIMSVPDSLGPIWKLHLWHNNRGASPSWFVSRVTVRDLWSGSAWLFPAECWLAAERGDGRVERELLALSGALRFTALLYSKVTAYLEDFHLWASVYSRPSCSRFTHTQRLSVCLCLLLAYAGANAL 1507          
BLAST of PKD1L-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010650.1 (pep scaffold:Pmarinus_7.0:GL477016:137070:158392:-1 gene:ENSPMAG00000009641.1 transcript:ENSPMAT00000010650.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.4413 bits (241), Expect = 1.739e-20
Identity = 56/202 (27.72%), Postives = 99/202 (49.01%), Query Frame = 2
Query: 1466 RKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVLLEIKRDEKFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAM 2071
            R DR +       PL DN P     Y +++ TG    AGT++   + L G+ G+S  R++    +  LFE  +   F+M+    LG +  L +WHN+ G  PSW + ++ + D+ +   ++F  E WL+  + DG  ER LL +    +F  L      + + D H+ A + +    S +T  Q+++V + +      +NA+
Sbjct: 1299 RWDRHDEHKAGAIPLQDNLPSDRQLYEVTLETGFRAGAGTTAKANVILHGEHGTSETRELHCEDKP-LFERNSTHTFIMSVPDSLGPIWKLHLWHNNRGASPSWFVSRVTVRDLWSGSAWLFPAECWLAAERGDGRVERELLALSGALRFTALLYSKVTAYLEDFHLWASVYSRPSCSRFTHTQRLSVCLCLLLAYAGANAL 1499          
BLAST of PKD1L-2 vs. Ensembl Nematostella
Match: EDO44884 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUD7])

HSP 1 Score: 254.603 bits (649), Expect = 2.484e-69
Identity = 248/1040 (23.85%), Postives = 466/1040 (44.81%), Query Frame = 2
Query: 1217 WNFNMEVWQDFSASVDDTSDISNINFKSNFLGTFSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMW--RKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGL-FETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVLLEIKRDE--KFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIFX-----------------------XXXXXXXXXXEDQEAKM--------------------KKMFLLPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILLIIFVLAKKLLGAVSTDQEANIDEFV---------KDDLKKVLGAN-----LNPPDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIKSNVQTYMD--FYDWAQGILNESYPKVWYN--------NMNRTGDLTTAIAICDC---LRQGPFRIRQIRVKRNTCTISALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAE 4111
            W+   E W      V   +  S  +   N L  F +KIF+ PN +D   + AN       +    +V ++  I  L  + V+W  R+D+ +++ +       N P   Y Y I V  G+ R AGT++++ I L G    S    + D  R+      G+  +F++TT   LG L  +R+WH+++G  P+  ++K+++ D  T   + F+C  W +  + DG  +RV+    ++E   F+ +F       + D H+   I      S +TRV++V+  ++     M++NAM++     +   +N ++D G +  +W Q   GI+S ++ +P   +  +IFR                        T   K    ED +  +                    KK+  LP    ++GW L+ + ++AS   T +Y +Q+G   S +WL + F+ +   +F+S P+ ++++ +    +L    +DQ  N +E           K D   V+        L     + LEK +      +++S ++ D  TY+  L +L  +A+       + Q++ I    +K+  ++  +       Q I N+S   +W N        N++      TA  +      L  G  R RQ+R K++TC I+ ++  V  +  C + Y++ ++D  +++ +W P   S V             P+ + I +F   + +   GYP+ G    Y GGGYI        +A   I++ + N+W+D+ T  +F E T+YN  +NLFT   VL E   +GG  + P    ++RLY  +    I  L+  +++ L      +RE+KK+ K K  YF   WN  E++ + L+   +    + + +    + +   N   Y +F   ++W  +   ++GI  F+S I+ +K + FNK + ++  T+ R+   L+  G MF+   ++F     +L   +   F+  + S   L  V +    + + F  P     A  + ++  L+ F + ++FI I+ +++ E
Sbjct:   19 WDEVQENWSTRGCRVGPNTSSSRTHCLCNHLTWFGSKIFVPPNTLDLSLIRANIQD---PAQYAAVVSVMCIIWGLYAIGVVWARRQDKNDALKVGVHFSPSNRPGSRYLYEIVVCVGTRRRAGTTANVAIKLYGDQQDSQPFLLDDSNRNSTPLSRGSNNSFIVTTSEALGQLSYIRVWHDNTGSNPALFVKKVIVRDHVTGDTWHFLCNRWFAVDEGDGMIDRVVPMTSQEELKHFKTIFMDKTKKDLTDSHLWFSIVWRPPDSNFTRVERVSCCLSFLLCTMMANAMWY----EVPTGSNTQVDIGPVQFSWEQVSIGIMSSMVVFPINLVIVQIFRNCKAKKNRGKRLLGSPKGGNRVCVTSNSKILHHEDIDTHISLPSDTSRTSFWSNKRSKNPKKIKSLPWWMTYIGWLLVTLTVLASTVVTLMYGIQFGKHTSEKWLLSMFISVTHDIFISQPLKVILLALFFAYVLKKPPSDQNNNANELDSKELLQQCNKRDTNDVIDVEAPSVPLGALSNDALEKARDRNDKERKMSVILTDIGTYLTFLWVLLVIAHSRVDSAAYWQSRSISDVLMKTTYESPPESGLTKTFQKISNDSEIWLWTNHVLLPALYNLDWYYYTKTAPKLVRGGAGLVVGFARWRQLRKKKDTCLITGVMRGVIHH--CTDPYSMSTQDETNYNSRWRPFNTSDVP------------PSPSTIWSF--NSASKLNGYPYFGEISTYSGGGYIVPFSSIYYKAVKEIKHARNNSWIDRYTAGLFTEFTLYNPYSNLFTASTVLVEVLPTGGFHVRP-EFFTFRLYSLVGDFHIFTLVCDVVFLLFTSYFTFRELKKLYKDKCSYFRDYWNWAEIVIMVLAWIAVADYFICLGIRKWTLKLHQENPNDYTNFQYISAWQMSFESILGILVFISTIKFIKLLRFNKKMFLLAYTLSRSAKDLAHYGIMFLIVFLSFAQFYYLLLGSDYDSFSTFVKSIEKLINVLLGRFSFEE-FLIPFRIMGAFGFFLYMTLTNFLLLNMFIAIIVESFTE 1033          
BLAST of PKD1L-2 vs. Ensembl Nematostella
Match: EDO43195 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ92])

HSP 1 Score: 220.705 bits (561), Expect = 2.574e-59
Identity = 224/817 (27.42%), Postives = 362/817 (44.31%), Query Frame = 2
Query: 1211 RIWNFNMEVWQDFSASVDDTSDISNINFKSNFLGTFSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMW--RKDRRES-----ILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVLL-EIKRDEK-FQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSG-DANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIFX----------------------XXXXXXXXXXEDQEAKMKKMFL--LPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILLIIFVLAKKLLGAVSTDQEANIDEFVKDDLKK-----------------VLG--ANLNPPDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIK--SNVQTYMDFYDWAQGI-LNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCT--ISALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYL-PGNMIVLLLMQIL 3484
            + W+   EVW+     V + + ++ I+   N L  F   + +APN IDF  V+A F ++  N   + +V+ +     L +V+V+W  RKD+ +      I+L +  +  + P  E+ Y +S+HTGS R + T++ +                                        LG L+ +RIWH+ SG   SW L  ++  +I+TN  +IFMC+ WL+  K DG  +RVLL    +D K F+ LF     + + D H+   +      S +TRVQ++T  +++ +  M++ AMF+    N+ G   N  I  G ++ +  Q   GI S  I  P   I  +IFR                      +    K+  +E+ +   KK+ L  LP   +++ W+L    ++ S   T  YS+ WG + SNQWL +  V  F   F++ PI +  I V    +L  +  D      EF + D K                   +G  + +  PD   +EK +K K    ++  ++     +++ L LL  + Y++R  ++++Q K+I     K  S V     F+ +   I L  ++ +  YN + R  +  TA    +    G  R RQ+RVKR  C   I+AL         C + Y+  +ED   F   W   AN S +     W         TV               P+ G  G YGGGGY A LG    QA  I+++L  NNWLD+ TRA F E TV+N   NLF+    L E   +GG       + ++RL+ ++  G  +V+LL  ++
Sbjct:   44 KYWDIKKEVWRTDGCKVGNLTTLNKIHCICNHLTAFGGGLLVAPNPIDFDKVWAGFKNISDN---LAVVVTIATGFGLYIVLVLWARRKDKGDMEKVKLIVLGFSTVETDTPFGEHLYELSIHTGSWRGSSTTAKV----------------------------------------LGPLLYIRIWHDMSGYDSSWYLNFVIAREIETNANWIFMCDRWLALEKDDGMVDRVLLVSTDKDLKTFKTLFNTKVSTDLFDGHLWMSVVKKPPKSSFTRVQRLTCCMSLLYTTMMTGAMFY----NVGGVKDNSTISLGPLTFSVRQLMIGIQSSFIALPGNMIVIQIFRNLKPQEVQSEVNNSAISKEDNLKNASEKQSNSEEDKPNGKKVCLNELPHWLLYIAWTLCISMILVSATITLFYSMMWGKDISNQWLSSMLVSFFQDAFVTQPIKVCAIAVFVAAVLKTLPKD----FSEFKQRDKKHKSPIGSCSSMKSQEQKDTIGKKSAMELPDPVTIEKARKFKLKETQMIGIMSSISLHIVFLTLLVVVGYNSRDPMSYNQMKVIEDGISKTVSLVVNIKGFWGYVGNIVLPFAFNERGYNGLPRHKEGVTADT--NLFMIGMPRFRQLRVKREKCEREITALW--------CYDAYSAFNEDKSYFLPGWRTRANLSFTECPVPWRHKDFIELNTV---------------PYWGNLGWYGGGGYTADLGYNIIQAQGIVKDLVRNNWLDQQTRATFIEFTVFNAQVNLFSVTTFLLESLGTGGGFSL-LKIDTFRLHPHVGSGQTLVILLESVV 783          
BLAST of PKD1L-2 vs. Ensembl Nematostella
Match: EDO32324 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVF4])

HSP 1 Score: 172.555 bits (436), Expect = 1.607e-43
Identity = 130/448 (29.02%), Postives = 216/448 (48.21%), Query Frame = 2
Query: 1211 RIWNFNMEVWQDFSASVDDTSDISNINFKSNFLGTFSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMW--RKDRRE-----SILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVLL--EIKRDEKFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFK-IDFGLISITWFQFYTGIISVLITYPCIFIASEIF--------------XXXXXXXXXXXED---QEAKMKK-----MFLLPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPI 2458
            + W+   E+W          + +  ++     L  F   + +APN IDF  V+A F ++  N   + +V+ +   L + +V  +W  R D ++        +     L  D  YE    ++++TGS + + T++++F+N++G  G +G   +TD  +  LF  G    FV+  D  LG L  LR+WH+ +G   SW L   +I+++Q +  +IFMC  WL+  K DG  +RVLL   +   + F+ LF     + + D H+   +      S +TRVQ++T  +++ F  M+++AMFF    N+ GD +   +  G ++ +  Q   GI S  I  P   +  +IF              ++    KRR TED   ++A  KK        LP  F++V W+L    ++ S   T  YS+ WG E SNQWL +  V  F   FL+ PI
Sbjct:  168 KYWDKEREMWSTMGCKAGPQTRLEVVHCVCTHLTAFGGGLLVAPNPIDFDKVWAGFKNISDN---LSVVVTIAVALAIYIVCAVWARRMDNKDINKDGVTTITSTNTLHGDHIYE----LTLNTGSWKGSCTTANVFVNIIGDKGQTGPLSLTDSSKQ-LFTEGAANTFVIPLDLSLGQLRYLRVWHDMTGYDSSWFLNFAIIKNLQMDSKWIFMCSRWLALEKDDGLVDRVLLVSTVAELKNFKTLFNTKVSNDLFDGHLWMSVVKKPPRSPFTRVQRLTCCMSLLFTTMMTSAMFF----NIGGDPDTSTVSLGPLTFSVRQLIIGIQSSFIALPVNILVVQIFRNLPLLKAPEDGTHKKKASEKRRKTEDSTHEKAVPKKNNKICPEQLPYWFLYVAWALCVTMILTSAAITLFYSMMWGKEISNQWLASTLVSFFQDAFLTQPI 603          

HSP 2 Score: 147.132 bits (370), Expect = 1.401e-35
Identity = 96/298 (32.21%), Postives = 163/298 (54.70%), Query Frame = 2
Query: 3221 ASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYL-PGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAE 4111
            A LG    QA  II +L+ N WLD LTRA F E TV+N   NLF+++  LFE   +GG  ++   V ++RLY ++ PG  +V+L    +  +T++L  Y+ IKK+ + K EYF   WN+V+L+ I L+LS ++   +R++ T   I  L  N   +VSF  AT W E +  ++GI  F+S +R+L  + FN++IS++  +I R+++ L+      I    +F     ++F  +   F     +  SLF + +    Y D+ +        L + V++   + F+ ++F+ I+ + Y E
Sbjct:  695 ADLGYNTGQADSIIVDLKKNRWLDHLTRATFIEFTVFNAQVNLFSSVTFLFESQGTGG-GIYLLKVETFRLYPHVGPGQTLVILCEITVVVVTLILA-YKNIKKIYRMKMEYFKQTWNIVQLVVICLTLSAVVLFILRMLDTQKTIKKLRENPFVFVSFQYATQWAELNTYIVGIVIFLSTLRLLYLISFNRHISMLYNSISRSFSLLAQFAVEVIIVFTSFAIFTYVVFGSHMDGFGTFQGTLGSLFAMLLGKGYYSDLSQVDVIL-GPLLFAVFTTTMMLFMLNIFVAIVMEPYEE 989          
BLAST of PKD1L-2 vs. Ensembl Nematostella
Match: EDO46983 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNS6])

HSP 1 Score: 151.369 bits (381), Expect = 7.248e-40
Identity = 97/303 (32.01%), Postives = 164/303 (54.13%), Query Frame = 2
Query: 1298 SNFLGTFSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMWRK-DRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTD--GYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVLLEIKRDE--KFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYP 2191
             N L +F A + +APN IDF  VFANFA++ A     ++  +    L  ++ I++ R+ D+R+  ++   P+  +  +  YSY +SV+TG+ R +GT++   + + G    S    +TD  G  + +   G V  F++ T   LG +  + IWHN++G  PSW L ++VIED+QT K   F+   WL+  K +G  E+++    + E  KF+NLF         DKH+   +   + +S +TRVQ+VT  +++    M++NAMF+  D    G ++ +I  G I+++  Q   G  S L+  P
Sbjct:   22 CNHLTSFGAGVMVAPNPIDFDQVFANFANITATGNFSVLFTVCGLFLLYIIAIILARRADKRDKKMVCVSPVPTS--KSGYSYQVSVYTGTFRGSGTTAKASLIISGDHHDSPIIPLTDASGNSEEVLSRGNVAQFIVNTPVCLGPINYIHIWHNNAGDDPSWFLRQVVIEDVQTMKKMFFLLSDWLALDKGEGIVEKIIYTATQKEMGKFKNLFYTHTSKSFSDKHLWISVVLRSPLSPFTRVQRVTCCLSLCLCAMLANAMFYQID----GGSDNEITIGPITLSLRQIMVGAQSSLVIIP 318          
BLAST of PKD1L-2 vs. Ensembl Nematostella
Match: EDO40050 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8E4])

HSP 1 Score: 148.673 bits (374), Expect = 2.640e-39
Identity = 99/308 (32.14%), Postives = 164/308 (53.25%), Query Frame = 2
Query: 1175 LLLSLGVASLTPRIWNFNMEVWQDFSASVDDTSDISNINFKSNFLGTFSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMWRKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDS-----PLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVLLEIKRDE--KFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFF 2077
            L ++L + + + R W+  ME W   +  VD  +         N L +F++ +F+ PN ID+    A     L+  YV    ++ +  LYL+ +I   + D+ ++      P+ DNDP   Y Y I +HTG  R AGTS+D+ I L G    S  R + D  R  +F+TG V  F++T        PLG+L  +R+WHN+ G  PSWNL +++I+D+QT++ + F+C+ WL+  + DG  +RV+    ++E  KF  LF       + D H+   +      S +TRVQ++T  +++    M++N MF+
Sbjct:    1 LNVTLTIFTSSCRYWDNKMEQWSS-AGCVDIRTRTDYTLCLCNHLTSFASGMFVPPNTIDWDKFLA---FDLSQGYVCFATVLTVIGLYLVFLIPARKADKADAEKTGVTPIPDNDPRDTYCYEIHIHTGFIRGAGTSADVSIVLNGAVADSDPRVLKDPKRK-VFKTGGVDAFLLTVPHVYRVFPLGNLKNIRLWHNNGGAYPSWNLLRVMIQDLQTDQRWWFVCDDWLAVDEGDGKIDRVIYPATKNELTKFNVLFATEVRKNLTDGHLWFSVVTRPANSPFTRVQRLTCCLSILLCTMLANLMFY 303          
BLAST of PKD1L-2 vs. Ensembl Medaka
Match: pkd1l2a (polycystin 1 like 2 [Source:NCBI gene;Acc:101162200])

HSP 1 Score: 239.58 bits (610), Expect = 1.940e-63
Identity = 252/1048 (24.05%), Postives = 456/1048 (43.51%), Query Frame = 2
Query: 1211 RIWNFNMEVWQDFSASVDDTSDISNINFKSNFLGTFSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMWRKDRRESILLRYE--PLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVL-LEIKRDEKFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDA-NFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIFXXXXXXXXXXXEDQEAKM--KKMFLL-----------------------------------PKG------------------FIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILLIIFVLAKKLLGAVSTDQEANIDEFVKDDLKKVLGANLNPPDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIK--SNVQTYMDFYDWAQ-GILNE---SYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVP-CNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMVD 4156
            + WN +   W +    V   +         N L  F +  F+ PN++D       FA+  AN+ VV+  +  IF  Y+L+V+   RKD ++S  L+ +   L DNDP  EY Y++++ TG  R A TSS + I L G  G S    +TD  +  +FE G +  F++TT   LG+L ++R+WH++SG  P++ +  ++++D++    + F+C +WL+    +   ++V  +  + D K  NLF         D HI   + +    S +TRVQ+V+   ++    M+++ MF+G   + S    +  I+F     TW Q   GI S +I +P   +   IFR +R  ++    D++     K++ LL                                   P+G                  F+FVGW L+      S +FT +Y L +G ++S  WL +  V  F  +F++ P                                LK    +   PP    +EK++      Q++  ++   + Y+  + +L  +AY  R    +  T+ IR  F K  S+  +  D + WA   +LN     YP +   N    G+                R+RQ+R+++ +C + AL  ++  +VP C+  Y+   EDT S+S  W+PL+ ++ + N                N ++Y++      YP  G             L      A  +++ L  N WLD  T+A+F E TVYN N NLF  + ++ E   +     F   ++S RLY    G  I ++  +++Y L ++  ++ + K + +Q+  YF S WNL+EL  IFLS S +     R ++    ++    NK  +VSF +          L+     ++ +++   +  N  + ++  T+ RA+T +S    +     +A+    N+++      +  LL +  ++  + + I  Y ++    P   + L  +       F I ++FI ++   + +    +    ++E+VD
Sbjct:  393 KYWNESTSSWSEDGCRVGPLTTPLVTQCLCNHLTFFGSSFFVMPNLVDVSRTAELFATF-ANNPVVVCFVATIFAAYVLVVLWARRKDIQDSAKLQVKITDLGDNDPLAEYRYMLTISTGHRRGASTSSQVTITLQGTEGESEPHHLTDPEKP-VFERGGMDMFLLTTHFSLGELQSIRLWHDNSGDHPAY-VNNVMVQDLELGHKWHFLCNSWLAVDVAECTLDKVFPVATETDMKRFNLFFMKTAKDFRDGHIWFSVISRPPCSTFTRVQRVSCCFSLLLCTMLTSIMFWGIPTDPSEQTMDLHIEF-----TWQQVIIGIQSSIIMFPINLLIVSIFRNSRPREKVTKTDRQLHHVEKELGLLGPSRFPNPNNYNRAMQQVQGLKSHLESSLDGDKPSPEGSINGSTKKKQIQRGLPWWFVFVGWILVIATSGVSGYFTMMYGLTYGKDRSISWLISMVVSFFESLFITQP--------------------------------LKDSTCSFYQPPPPTDIEKMRNSMIKEQKVFSLI-KEILYMGFMWVLLLVAYGQRDPNAYFLTRHIRQSFSKGISDTMSIQDVFTWANTTLLNNLFGEYPFITDGNSKLVGNA---------------RLRQVRMQKGSCLV-ALPMQI--SVPDCHALYSWELEDTGSYSPGWSPLSGNNATLNPH--------------NPWIYKSQHKLRAYPICGN----------VKLYRGGGFATDVLQYLYDNIWLDVYTQALFVEFTVYNANVNLFCIVTLILE--TTATAFQFRSELQSVRLYQSTGGLHIFVMASEVVYFLFIIYYMFVQGKLMKRQRLAYFQSKWNLLELAIIFLSWSALSVFIKRTLLGQRDVSQYENNKDRFVSFHETAQADAVLGYLIAFLVLLATVKLWHLLRLNPKLHMITATLQRAWTDISGFLVVIAIMFLAYSVASNLMYGWKLYSYRTLLEAAQTIVSLQLGIFNYEEVLNYNPLLGAFLIGSC-IVFMTFVILNLFISVILVAFTQEQIHHKPSEEEEIVD 1354          
BLAST of PKD1L-2 vs. Ensembl Medaka
Match: pkd1l2a (polycystin 1 like 2 [Source:NCBI gene;Acc:101162200])

HSP 1 Score: 152.14 bits (383), Expect = 2.215e-36
Identity = 157/636 (24.69%), Postives = 293/636 (46.07%), Query Frame = 2
Query: 2288 LPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILLIIFVLAKKLLGAVSTDQ--EANIDEFVKDDLKKVLGAN--------LNPPDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIK--SNVQTYMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVP-CNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMVD 4156
            LP  F+FVGW L+      S +FT +Y L +G ++S  WL +  V  F  +F++ P+ +L        +L  V  D+  E  I+E  K    +V+ A+          PP    +EK++      Q++  ++   + Y+  + +L  +AY  R    +  T+ IR  F K  S+  +  D + WA   L         NN+   G+    I   +    G  R+RQ+R+++ +C + AL  ++  +VP C+  Y+   EDT S+S  W+PL+ ++ + N                N ++Y++      YP  G   +Y GGG+   L +   + + +++ L  N WLD  T+A+F E TVYN N NLF  + ++ E   +     F   ++S RLY    G  I ++  +++Y L ++  ++ + K + +Q+  YF S WNL+EL  IFLS S +     R ++    ++    NK F VSF +          L+     ++ +++   +  N  + ++  T+ RA+T +S    +     +A+    N+++      +  LL +  ++  + + I  Y ++    P   + L  +       F I ++FI ++   + +    +    ++E+VD
Sbjct: 1022 LPWWFVFVGWILVIATSGVSGYFTMMYGLTYGKDRSISWLISMVVSFFESLFITQPLKVLGFAAFFALVLKQVDLDEFGEPQIEENFKRTDPEVVPADRRDSTCSFYQPPPPTDIEKMRNSMIKEQKVFSLI-KEILYMGFMWVLLLVAYGQRDPNAYFLTRHIRQSFSKGISDTMSIQDVFTWANTTL--------LNNL--FGEYPGFITDGNSKLVGNARLRQVRMQKGSCLV-ALPMQI--SVPDCHALYSWELEDTGSYSPGWSPLSGNNATLNPH--------------NPWIYKSQHKLRAYPICGNVKLYRGGGFATDL-LPDLKNSSVLQYLYDNIWLDVYTQALFVEFTVYNANVNLFCIVTLILE--TTATAFQFRSELQSVRLYQSTGGLHIFVMASEVVYFLFIIYYMFVQGKLMKRQRLAYFQSKWNLLELAIIFLSWSALSVFIKRTLLGQRDVSQYENNKDF-VSFHETAQADAVLGYLIAFLVLLATVKLWHLLRLNPKLHMITATLQRAWTDISGFLVVIAIMFLAYSVASNLMYGWKLYSYRTLLEAAQTIVSLQLGIFNYEEVLNYNPLLGAFLIGSC-IVFMTFVILNLFISVILVAFTQEQIHHKPSEEEEIVD 1624          

HSP 2 Score: 137.117 bits (344), Expect = 8.161e-32
Identity = 100/338 (29.59%), Postives = 171/338 (50.59%), Query Frame = 2
Query: 1211 RIWNFNMEVWQDFSASVDDTSDISNINFKSNFLGTFSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMWRKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVL-LEIKRDEKFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDA-NFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIF 2218
            + WN +   W +    V   +         N L  F +  F+ PN++D       FA+  AN+ VV+  +  IF  Y+L+V+   RKD ++S  ++   L DNDP  EY Y++++ TG  R A TSS + I L G  G S    +TD  +  +FE G +  F++TT   LG+L ++R+WH++SG  P++ +  ++++D++    + F+C +WL+    +   ++V  +  + D K  NLF         D HI   + +    S +TRVQ+V+   ++    M+++ MF+G   + S    +  I+F     TW Q   GI S +I +P   +   IF
Sbjct:  576 KYWNESTSSWSEDGCRVGPLTTPLVTQCLCNHLTFFGSSFFVMPNLVDVSRTAELFATF-ANNPVVVCFVATIFAAYVLVVLWARRKDIQDSAKVKITDLGDNDPLAEYRYMLTISTGHRRGASTSSQVTITLQGTEGESEPHHLTDPEKP-VFERGGMDMFLLTTHFSLGELQSIRLWHDNSGDHPAY-VNNVMVQDLELGHKWHFLCNSWLAVDVAECTLDKVFPVATETDMKRFNLFFMKTAKDFRDGHIWFSVISRPPCSTFTRVQRVSCCFSLLLCTMLTSIMFWGIPTDPSEQTMDLHIEF-----TWQQVIIGIQSSIIMFPINLLIVSIF 905          
BLAST of PKD1L-2 vs. Ensembl Medaka
Match: pkd1l2a (polycystin 1 like 2 [Source:NCBI gene;Acc:101162200])

HSP 1 Score: 134.42 bits (337), Expect = 4.226e-31
Identity = 88/292 (30.14%), Postives = 154/292 (52.74%), Query Frame = 2
Query: 1211 RIWNFNMEVWQDFSASVDDTSDISNINFKSNFLGTFSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMWRKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVL-LEIKRD-EKFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFG 2080
            + WN +   W +    V   +         N L  F +  F+ PN++D       FA+  AN+ VV+  +  IF  Y+L+V+   RKD ++S  ++   L DNDP  EY Y++++ TG  R A TSS + I L G  G S    +TD  +  +FE G +  F++TT   LG+L ++R+WH++SG  P+W +  ++++D++    + F+C +WL+    +   ++V  +  + D ++F NLF         D HI   + +    S +TRVQ+V+   ++    M+++ MF+G
Sbjct:  275 KYWNESTSSWSEDGCRVGPLTTPLVTQCLCNHLTFFGSSFFVMPNLVDVSRTAELFATF-ANNPVVVCFVATIFAAYVLVVLWARRKDIQDSAKVKITDLGDNDPLAEYRYMLTISTGHRRGASTSSQVTITLQGTEGESEPHHLTDPEKP-VFERGGMDMFLLTTHFSLGELQSIRLWHDNSGDHPAWYVNNVMVQDLELGHKWHFLCNSWLAVDVAECTLDKVFPVATETDMKRFSNLFFMKTAKDFRDGHIWFSVISRPPCSTFTRVQRVSCCFSLLLCTMLTSIMFWG 564          
BLAST of PKD1L-2 vs. Ensembl Medaka
Match: pkd2 (polycystin 2, transient receptor potential cation channel [Source:NCBI gene;Acc:100192346])

HSP 1 Score: 120.168 bits (300), Expect = 6.601e-27
Identity = 126/515 (24.47%), Postives = 230/515 (44.66%), Query Frame = 2
Query: 2771 NVQTYMDFYDWAQG-ILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISA-LVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLY--QNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMVDHVWNIFNEMMTGF--KSSMKYTVPDALKKKAIVPVDMSDVDMQFASKEN 4297
            ++ T  DF+ + QG  L   Y +VWYNN +  G+   +    + +  G  R+RQ+RV   TC+I   L  +V G   C   Y   +ED   F  +           N + W    +  T++ +NA  +  Q +   GG  ++              L   +E++   ++ L+ + WLD+ TRAIF + +VYNGN NL    ++L E P +GG+ +  +  ++ RL  Y+      + + ++ + L V+  +  E+ ++   +  YF + WN +++L + LS+  II +  R  +  + +  L  N   + SFD   +       +  +  F   +++ K++ FNK +S +  T+ R    L     MF    +A+  +  ++F      F+    S  + F + +    + ++ E  P     +Y+  +     F + ++F+ I+NDTY+E +  ++  +  EM           MT F  K   K  V   LKK  +   D+SD   Q   K N
Sbjct:  214 SLSTMEDFWKYTQGPFLGGMYWEVWYNNQSLPGN--QSFIYYENILLGVPRLRQVRVHNETCSIHEDLRDEVQG---CYGVYTPSNEDNSPFGPQ-----------NGTAW----VHTTESKMNASTHWGQVSKYGGGGYYQ-------------DLSRTREESGLQLQFLKDHLWLDRGTRAIFLDFSVYNGNVNLVCIARLLVEFPATGGV-LTSWQFQTVRLIKYVSSWDYFVGVCEVAFCLFVLYYVVEEVLEIHIHRLHYFKNLWNCLDVLIVTLSVVAIIMSITRAAMGGDLLKGLE-NYTSHTSFDSLANLQVQFNNMAAVIVFFCWVKLFKFINFNKTMSQLSTTMSRCAKDLVGFAIMFFIIFLAYAQLAYLVFGTQVNDFSTFQGSVFTQFRIILGDFDFFEIKEANPVL-GPIYFITFVLFIFFILMNMFLAIINDTYSE-VKADMAQHRSEM----------EMTDFIKKGCTKALVKLRLKKTTV--DDISDSLRQAGGKLN 679          
BLAST of PKD1L-2 vs. Ensembl Medaka
Match: pkd2 (polycystin 2, transient receptor potential cation channel [Source:NCBI gene;Acc:100192346])

HSP 1 Score: 119.398 bits (298), Expect = 1.452e-26
Identity = 126/515 (24.47%), Postives = 230/515 (44.66%), Query Frame = 2
Query: 2771 NVQTYMDFYDWAQG-ILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISA-LVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLY--QNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMVDHVWNIFNEMMTGF--KSSMKYTVPDALKKKAIVPVDMSDVDMQFASKEN 4297
            ++ T  DF+ + QG  L   Y +VWYNN +  G+   +    + +  G  R+RQ+RV   TC+I   L  +V G   C   Y   +ED   F  +           N + W    +  T++ +NA  +  Q +   GG  ++              L   +E++   ++ L+ + WLD+ TRAIF + +VYNGN NL    ++L E P +GG+ +  +  ++ RL  Y+      + + ++ + L V+  +  E+ ++   +  YF + WN +++L + LS+  II +  R  +  + +  L  N   + SFD   +       +  +  F   +++ K++ FNK +S +  T+ R    L     MF    +A+  +  ++F      F+    S  + F + +    + ++ E  P     +Y+  +     F + ++F+ I+NDTY+E +  ++  +  EM           MT F  K   K  V   LKK  +   D+SD   Q   K N
Sbjct:  214 SLSTMEDFWKYTQGPFLGGMYWEVWYNNQSLPGN--QSFIYYENILLGVPRLRQVRVHNETCSIHEDLRDEVQG---CYGVYTPSNEDNSPFGPQ-----------NGTAW----VHTTESKMNASTHWGQVSKYGGGGYYQ-------------DLSRTREESGLQLQFLKDHLWLDRGTRAIFLDFSVYNGNVNLVCIARLLVEFPATGGV-LTSWQFQTVRLIKYVSSWDYFVGVCEVAFCLFVLYYVVEEVLEIHIHRLHYFKNLWNCLDVLIVTLSVVAIIMSITRAAMGGDLLKGLE-NYTSHTSFDSLANLQVQFNNMAAVIVFFCWVKLFKFINFNKTMSQLSTTMSRCAKDLVGFAIMFFIIFLAYAQLAYLVFGTQVNDFSTFQGSVFTQFRIILGDFDFFEIKEANPVL-GPIYFITFVLFIFFILMNMFLAIINDTYSE-VKADMAQHRSEM----------EMTDFIKKGCTKALVKLRLKKTTV--DDISDSLRQAGGKLN 679          
BLAST of PKD1L-2 vs. Planmine SMEST
Match: SMESG000014723.1 (SMESG000014723.1)

HSP 1 Score: 2066.58 bits (5353), Expect = 0.000e+0
Identity = 1085/1094 (99.18%), Postives = 1089/1094 (99.54%), Query Frame = 2
Query: 1346 MIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMWRKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVLLEIKRDEKFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIFXXXXXXXXXXXEDQEAKMKKMFLLPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILLIIFVLAKKLLGAVSTDQEANIDEFVKDDLKKVLGANLNPPDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIKSNVQTYMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMVDHVWNIFNEMMTGFKSSMKYTVPDALKKKAIVPVDMSDVDMQFASKENIRNMVSKRVNPSLRRKLADLNGEKYKTEKRENKPNSENDVYINPISFTDIKVAATGSQILDDKTFAERLPKYRAKQNAVDTNNQPPSYMEPVRPLKPNPKIDLFSKTERK 4627
            MIDFKNVFANFASLLANSYVVLIVIILIFILYLLLVIVMWRKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVLLEIKRDEKFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTG+ISVLITYPCIFIASEIFRRTRRWKRRWTEDQEAKMKKMFLLPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILLIIFVLAKKLLGAVSTDQEANIDEFVKDDLKKVLGANLNPPDQEKLEKIKKDKASGQRLSRVVGDALTYVLSLLLLTALAYDARSQVTFDQTKMIRSRFIKSNVQTYMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCT+SALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFGIYGGGGYIASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVELLSIFLSLSIIICTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMVDHVWNIFNEMMTGFKSSMKYTVPDALKKKAIVPVDMSDVDMQFASKENIRNMVSKRVNPSLRRKLADLNGEKYKTEKRENKPNSENDVYINPISFTDIKVAATGSQILDDKTFAERLPKYRAKQNAVDTNNQPPSYMEPVRPLKPNPKID   +  +K
Sbjct:    1 MIDFKNVFANFASLLANSYVVLIVIILIFILYLLLVIVMWRKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVLLEIKRDEKFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGMISVLITYPCIFIASEIFRRTRRWKRRWTEDQEAKMKKMFLLPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILLIIFVLAKKLLGAVSTDQEANIDEFVKDDLKKVLGANLNPPDQEKLEKIKKDKASGQRLSRVVGDALTYVLSLLLLTALAYDARSQVTFDQTKMIRSRFIKSNVQTYMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTVSALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFGIYGGGGYIASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVELLSIFLSLSIIICTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMVDHVWNIFNEMMTGFKSSMKYTVPDALKKKAIVPVDMSDVDMQFASKENIRNMVSKRVNPSLRRKLADLNGEKYKTEKRENKPNSENDVYINPISFTDIKVAATGSQILDDKTFAERLPKYRAKQNAVDTNNQPPSYMEPVRPLKPNPKIDYILQNRKK 1094          
BLAST of PKD1L-2 vs. Planmine SMEST
Match: SMESG000014723.1 (SMESG000014723.1)

HSP 1 Score: 2040.77 bits (5286), Expect = 0.000e+0
Identity = 1047/1056 (99.15%), Postives = 1051/1056 (99.53%), Query Frame = 2
Query: 1460 MWRKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVLLEIKRDEKFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIFXXXXXXXXXXXEDQEAKMKKMFLLPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILLIIFVLAKKLLGAVSTDQEANIDEFVKDDLKKVLGANLNPPDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIKSNVQTYMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMVDHVWNIFNEMMTGFKSSMKYTVPDALKKKAIVPVDMSDVDMQFASKENIRNMVSKRVNPSLRRKLADLNGEKYKTEKRENKPNSENDVYINPISFTDIKVAATGSQILDDKTFAERLPKYRAKQNAVDTNNQPPSYMEPVRPLKPNPKIDLFSKTERK 4627
            MWRKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVLLEIKRDEKFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTG+ISVLITYPCIFIASEIFRRTRRWKRRWTEDQEAKMKKMFLLPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILLIIFVLAKKLLGAVSTDQEANIDEFVKDDLKKVLGANLNPPDQEKLEKIKKDKASGQRLSRVVGDALTYVLSLLLLTALAYDARSQVTFDQTKMIRSRFIKSNVQTYMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCT+SALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFGIYGGGGYIASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVELLSIFLSLSIIICTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMVDHVWNIFNEMMTGFKSSMKYTVPDALKKKAIVPVDMSDVDMQFASKENIRNMVSKRVNPSLRRKLADLNGEKYKTEKRENKPNSENDVYINPISFTDIKVAATGSQILDDKTFAERLPKYRAKQNAVDTNNQPPSYMEPVRPLKPNPKID   +  +K
Sbjct:    1 MWRKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVLLEIKRDEKFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGMISVLITYPCIFIASEIFRRTRRWKRRWTEDQEAKMKKMFLLPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPIILLIIFVLAKKLLGAVSTDQEANIDEFVKDDLKKVLGANLNPPDQEKLEKIKKDKASGQRLSRVVGDALTYVLSLLLLTALAYDARSQVTFDQTKMIRSRFIKSNVQTYMDFYDWAQGILNESYPKVWYNNMNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTVSALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFGIYGGGGYIASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVELLSIFLSLSIIICTAVRIMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYAETIDENLFDYDKEMVDHVWNIFNEMMTGFKSSMKYTVPDALKKKAIVPVDMSDVDMQFASKENIRNMVSKRVNPSLRRKLADLNGEKYKTEKRENKPNSENDVYINPISFTDIKVAATGSQILDDKTFAERLPKYRAKQNAVDTNNQPPSYMEPVRPLKPNPKIDYILQNRKK 1056          
BLAST of PKD1L-2 vs. Planmine SMEST
Match: SMESG000014725.1 (SMESG000014725.1)

HSP 1 Score: 530.406 bits (1365), Expect = 0.000e+0
Identity = 326/327 (99.69%), Postives = 327/327 (100.00%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNGMXXXXXXXXXXXXXXXXXXXXXXXNCDNPSPLNGGLGCSSCVTVIFGSCGMSDINVENCTWISCSDPQLVAQNIISDTLSKLNISGTNSTMSVQQTMNLAFDVVNKIQSALQNALLNSTGPLMIQTNEVTVGLQSLSPTSGQQNISMVSTDKGKISIGSSLNLTTPTVVTXXXXXXXXXXXXXXXXXXXXXMLSLTIQNVSNTTPVQLSVSIPNSNQQVESDMLSPVKFNVSNQLIQTLQYTSLSTVYKLSMNLSNATDFTIFFSASSLANTTDSSDAFIYLSNQL 1061
            IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNGMWSSWSTWSSCSSSCGFGTRSRTRNCDNPSPLNGGLGCSSCVTVIFGSCGMSDINVENCTWISCSDPQLVAQNIISDTLSKLNISGTNSTMSVQQTMNLAFDVVNKIQSALQNALLNSTGPLMIQTNEVTVGLQSLSPTSGQQNISMVSTDKGKISIGSSLNLTTPTVVTFSALKSSVFFSASSVADTSAAMLSLTIQNVSNTTPVQLSVSIPNSNQQVESDMLSPVKFNVSNQLIQTLQYTSLSTVYKLSMNLSNATDFTIFFSASSLANTTDSSDAFIYLSNQ+
Sbjct:  398 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNGMWSSWSTWSSCSSSCGFGTRSRTRNCDNPSPLNGGLGCSSCVTVIFGSCGMSDINVENCTWISCSDPQLVAQNIISDTLSKLNISGTNSTMSVQQTMNLAFDVVNKIQSALQNALLNSTGPLMIQTNEVTVGLQSLSPTSGQQNISMVSTDKGKISIGSSLNLTTPTVVTFSALKSSVFFSASSVADTSAAMLSLTIQNVSNTTPVQLSVSIPNSNQQVESDMLSPVKFNVSNQLIQTLQYTSLSTVYKLSMNLSNATDFTIFFSASSLANTTDSSDAFIYLSNQV 724          

HSP 2 Score: 136.346 bits (342), Expect = 0.000e+0
Identity = 67/69 (97.10%), Postives = 68/69 (98.55%), Query Frame = 2
Query: 1055 STSWDTSSGMLRITIPSGQVTPPNNMTLVMITSTNTTNGILLLSLGVASLTPRIWNFNMEVWQDFSASV 1261
            S SWDTSSGMLRITIPSGQVTPPNNMTLVMITSTNTTNGILLLSLGVASLTPRIWNF+MEVWQDFSASV
Sbjct:  735 SASWDTSSGMLRITIPSGQVTPPNNMTLVMITSTNTTNGILLLSLGVASLTPRIWNFDMEVWQDFSASV 803          

HSP 3 Score: 93.2041 bits (230), Expect = 1.226e-18
Identity = 63/81 (77.78%), Postives = 66/81 (81.48%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNGMXXXXXXXXXXXXXXXXXXXXXXXN-CDNPSPLNGGLGCS 320
            IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNG WSSWSTWSSCS SCG     +    C+NP+P N G  CS
Sbjct:  278 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNGSWSSWSTWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCS 358          
BLAST of PKD1L-2 vs. Planmine SMEST
Match: SMESG000014725.1 (SMESG000014725.1)

HSP 1 Score: 530.02 bits (1364), Expect = 0.000e+0
Identity = 326/327 (99.69%), Postives = 327/327 (100.00%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNGMXXXXXXXXXXXXXXXXXXXXXXXNCDNPSPLNGGLGCSSCVTVIFGSCGMSDINVENCTWISCSDPQLVAQNIISDTLSKLNISGTNSTMSVQQTMNLAFDVVNKIQSALQNALLNSTGPLMIQTNEVTVGLQSLSPTSGQQNISMVSTDKGKISIGSSLNLTTPTVVTXXXXXXXXXXXXXXXXXXXXXMLSLTIQNVSNTTPVQLSVSIPNSNQQVESDMLSPVKFNVSNQLIQTLQYTSLSTVYKLSMNLSNATDFTIFFSASSLANTTDSSDAFIYLSNQL 1061
            IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNGMWSSWSTWSSCSSSCGFGTRSRTRNCDNPSPLNGGLGCSSCVTVIFGSCGMSDINVENCTWISCSDPQLVAQNIISDTLSKLNISGTNSTMSVQQTMNLAFDVVNKIQSALQNALLNSTGPLMIQTNEVTVGLQSLSPTSGQQNISMVSTDKGKISIGSSLNLTTPTVVTFSALKSSVFFSASSVADTSAAMLSLTIQNVSNTTPVQLSVSIPNSNQQVESDMLSPVKFNVSNQLIQTLQYTSLSTVYKLSMNLSNATDFTIFFSASSLANTTDSSDAFIYLSNQ+
Sbjct:  396 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNGMWSSWSTWSSCSSSCGFGTRSRTRNCDNPSPLNGGLGCSSCVTVIFGSCGMSDINVENCTWISCSDPQLVAQNIISDTLSKLNISGTNSTMSVQQTMNLAFDVVNKIQSALQNALLNSTGPLMIQTNEVTVGLQSLSPTSGQQNISMVSTDKGKISIGSSLNLTTPTVVTFSALKSSVFFSASSVADTSAAMLSLTIQNVSNTTPVQLSVSIPNSNQQVESDMLSPVKFNVSNQLIQTLQYTSLSTVYKLSMNLSNATDFTIFFSASSLANTTDSSDAFIYLSNQV 722          

HSP 2 Score: 136.346 bits (342), Expect = 0.000e+0
Identity = 67/69 (97.10%), Postives = 68/69 (98.55%), Query Frame = 2
Query: 1055 STSWDTSSGMLRITIPSGQVTPPNNMTLVMITSTNTTNGILLLSLGVASLTPRIWNFNMEVWQDFSASV 1261
            S SWDTSSGMLRITIPSGQVTPPNNMTLVMITSTNTTNGILLLSLGVASLTPRIWNF+MEVWQDFSASV
Sbjct:  733 SASWDTSSGMLRITIPSGQVTPPNNMTLVMITSTNTTNGILLLSLGVASLTPRIWNFDMEVWQDFSASV 801          

HSP 3 Score: 92.8189 bits (229), Expect = 1.277e-18
Identity = 63/81 (77.78%), Postives = 66/81 (81.48%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNGMXXXXXXXXXXXXXXXXXXXXXXXN-CDNPSPLNGGLGCS 320
            IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNG WSSWSTWSSCS SCG     +    C+NP+P N G  CS
Sbjct:  276 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNGSWSSWSTWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCS 356          
BLAST of PKD1L-2 vs. Planmine SMEST
Match: SMESG000066980.1 (SMESG000066980.1)

HSP 1 Score: 137.887 bits (346), Expect = 4.105e-32
Identity = 171/706 (24.22%), Postives = 298/706 (42.21%), Query Frame = 2
Query: 2252 EDQEAKMKKMFLLPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIFGMVFLSDPI---ILLIIFVLAKKLLGAVSTDQEANIDEFVKDDL---------KKVLGANL------------NPPDQEKLEKIKKDKASGQRLSRVVGXXXXXXXXXXXXXXXXXXXRSQVTFDQTKMIRSRFIK-------SNVQTYMDFYDWAQGILNESYPK----VWYNN----------MNRTGDLTTAIAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVPCNENYNLLSEDTRSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPFEGTFXXXXXXXXXASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVYNGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVL---------LLMQILYALTVVLNIYREIKKVCKQKKEYFSSNWNLVEXXXXXXXXXXXXCTAVRIMVTINAIT--MLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYMGFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFTNLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVFICILNDTYA---ETIDENLFDYDKEMVDHVWNIFNEMMTG 4192
            +++E  + +  L P       W+ L   L+ +   T  Y +Q+G     +W+ + F+  F  V L  PI    L I F L  K   A   +     DE + D+L         ++ L   L             PP QE++EK ++ +    ++  V+ +   Y+     L  ++Y  R   ++D    +++ FIK       +++ +   F++W   IL    P+    VWYNN           NR   L            G   IRQ+R K+++C ++  V  +  +  C   Y++ ++D +S+   WT L  S  S           SP       FLY N +   G P+ G    Y GGGY+  L          +  L+ N W+D  TRAIF E T +N N NLF     + E P +GGL         + +Y   P N++ L         +  Q+LY + +++ + +EI+   KQK +YFS  WN +EL  I  SL      A  + +  N +T          Y++F +   W E    L+ +  F + I+ ++ + FNK I ++   +    T +     +F    +AF+ +   LF  +  ++ + L +  S   + +    + ++++  P F   ++   +    VF + ++F+ IL + +    E ID  L   D E++  ++  F  M TG
Sbjct: 2137 QEKETPVVRQKLFPWWMRIFAWTFLITLLIVASVLTTFYGIQFGDLACKKWISSMFISFFTSVLLVQPIKVICLAIFFALLCKDSSAFDVEYIGEEDE-IMDELGRRNAIMQNEEYLHQELYTAPIKPHKICFRPPSQEEIEKARELRLKELQMYDVIREVGFYLAFFCTLLFISYSLRHPDSYDLQNELKNVFIKQAPDSSFTDITSETLFWNW---ILLVFVPRIRAPVWYNNDPPIFQRGFISNRNNRLI-----------GYAIIRQVRSKKDSCKVNDYVKHLIKH--CYSQYDIFNQDEKSYGFGWTELNTSDTS----------ESP-------FLYSNESSLDGLPYIGRLSTYSGGGYVYKLKDDVNTLYNDLSALRDNKWIDFQTRAIFIEFTTFNPNINLFAIHTYVAEMPGNGGL---------WTIYRIEPANLLGLYSGGVKAFEIFCQVLYGIFILVIVVKEIRNFLKQKWKYFSQFWNFIELFIIIGSLLSAAGFAY-VTIATNKLTGKFSQYGGSVYLNFAQVAFWNEYFSYLVSLIIFCATIKFIRVLRFNKRIGMLGAVLSYTATDMKQFFIIFFIMFLAFVMMFYSLFMDSLYRYHSFLFAIESSMNIPLGKFGFLELYQKAPIFGPIVFAG-FVLFIVFVLLNMFVAILYNGFTVVKEDID--LQSSDHELMRFIFTKF-VMWTG 2794          

HSP 2 Score: 107.842 bits (268), Expect = 6.445e-23
Identity = 86/310 (27.74%), Postives = 157/310 (50.65%), Query Frame = 2
Query: 1301 NFLGTFSAKIFIAPNMIDFKNVFANFASLLANSXXXXXXXXXXXXXXXXXXXXMWRKDRRESILLRYEPLLDNDPEYEYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETGTVCNFVMTTDSPLGDLMALRIWHNSS--GIKPSWNLEKLVIEDIQTNKMYIFMCETWLSDSKFDGNTERVLLEIKRDE--KFQNLFQRMKVSGVMDKHIIAGITNNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGLISITWFQFYTGIISVLITYPCIFIASEIF 2218
            N L +FS+   +APN IDF  +F+NF      +  +    I I ++++LL++   R+D ++   +   PL  NDP+  Y Y + V T    NAGT+S+++  L G+   +    + D  R  + + G V  F++     LG +  +R+WH++S  G   SW    L I D+QT + + F+   W +  + DG  +R++     +E   FQ +F R   + + + H+   I      S +TRV++V   + + FL M++  MF+  +      +N  +  G  +++  + +TG IS +I +  +F+  E+F
Sbjct: 1756 NHLTSFSSGWLVAPNAIDFNYIFSNFD--FTKNVTLFATEIAIAVVFILLLVWARRQDIKDIEKVGLTPLASNDPKDMYLYEVIVDTSIRNNAGTTSNVYFILSGELNETDPTHLVDSKRK-ILKRGNVDRFLLAVPRSLGAMQFIRLWHDNSGKGTNASWYCNCLGIIDLQTKEKFNFLVNKWFAVEEDDGQIDRIIPVAGINELLYFQEMFSRKMKANLSEDHLWLSIIARPPESRFTRVERVACCLLLLFLTMLTTCMFYQTEGPSKPVSNI-LTIGPFALSAKELWTGFISNIIAFVPLFVLIELF 2061          
The following BLAST results are available for this feature:
BLAST of PKD1L-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PKD1L22.977e-3529.59polycystin 1 like 2 (gene/pseudogene) [Source:HGNC... [more]
PKD1L23.984e-3529.59polycystin 1 like 2 (gene/pseudogene) [Source:HGNC... [more]
PKD1L33.093e-3125.44polycystin 1 like 3, transient receptor potential ... [more]
PKD2L17.301e-2523.06polycystin 2 like 1, transient receptor potential ... [more]
PKDREJ7.189e-2224.69polycystin family receptor for egg jelly [Source:H... [more]
back to top
BLAST of PKD1L-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pkd-24.409e-2024.68Polycystin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U... [more]
lov-14.175e-1737.58Location of vulva defective 1 [Source:UniProtKB/S... [more]
back to top
BLAST of PKD1L-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Pkd25.064e-1922.77gene:FBgn0041195 transcript:FBtr0080365[more]
brv21.440e-624.28gene:FBgn0036712 transcript:FBtr0331846[more]
brv21.997e-624.28gene:FBgn0036712 transcript:FBtr0075242[more]
brv39.203e-621.68gene:FBgn0040333 transcript:FBtr0340092[more]
back to top
BLAST of PKD1L-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkd1l2a1.281e-3926.32polycystic kidney disease 1 like 2a [Source:ZFIN;A... [more]
pkd1l2a6.949e-3825.11polycystic kidney disease 1 like 2a [Source:ZFIN;A... [more]
pkd1l2b5.898e-3424.10polycystic kidney disease 1 like 2b [Source:ZFIN;A... [more]
pkd1l2b1.572e-3224.09polycystic kidney disease 1 like 2b [Source:ZFIN;A... [more]
pkd28.697e-2823.39polycystic kidney disease 2 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of PKD1L-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000038579.13.283e-4225.20polycystin 1 like 2 (gene/pseudogene) [Source:NCBI... [more]
PKD2L16.289e-2826.12polycystic kidney disease 2-like 1 [Source:NCBI ge... [more]
PKD2L11.255e-2726.12polycystic kidney disease 2-like 1 [Source:NCBI ge... [more]
PKD2L12.926e-2626.30polycystic kidney disease 2-like 1 [Source:NCBI ge... [more]
PKD2L13.291e-2625.31polycystic kidney disease 2-like 1 [Source:NCBI ge... [more]
back to top
BLAST of PKD1L-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pkd1l24.394e-3831.07polycystic kidney disease 1 like 2 [Source:MGI Sym... [more]
Pkd1l24.545e-3831.07polycystic kidney disease 1 like 2 [Source:MGI Sym... [more]
Pkd1l33.439e-3027.51polycystic kidney disease 1 like 3 [Source:MGI Sym... [more]
Pkd1l34.771e-3027.51polycystic kidney disease 1 like 3 [Source:MGI Sym... [more]
Pkd1l35.611e-3027.51polycystic kidney disease 1 like 3 [Source:MGI Sym... [more]
back to top
BLAST of PKD1L-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7TN88|PK1L2_MOUSE3.073e-3731.07Polycystic kidney disease protein 1-like 2 OS=Mus ... [more]
sp|Q7Z442|PK1L2_HUMAN1.078e-3429.59Polycystic kidney disease protein 1-like 2 OS=Homo... [more]
sp|Q7Z443|PK1L3_HUMAN1.485e-3025.44Polycystic kidney disease protein 1-like 3 OS=Homo... [more]
sp|Q2EG98|PK1L3_MOUSE3.925e-2927.51Polycystic kidney disease protein 1-like 3 OS=Mus ... [more]
sp|Q6IVV8|PKD2_DANRE6.565e-2723.39Polycystin-2 OS=Danio rerio OX=7955 GN=pkd2 PE=1 S... [more]
back to top
BLAST of PKD1L-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFF89.183e-16099.08PKD1L-2 OS=Schmidtea mediterranea OX=79327 GN=PKD1... [more]
A0A267G7R40.000e+042.31Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8J3950.000e+041.62PKD_channel domain-containing protein OS=Macrostom... [more]
A0A1I8FWM90.000e+040.04PKD_channel domain-containing protein OS=Macrostom... [more]
A0A1I8FX520.000e+040.36Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of PKD1L-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkd1l2a2.590e-3830.00polycystin 1 like 2 [Source:NCBI gene;Acc:10304417... [more]
ENSAMXT00000006495.24.200e-3327.58pep primary_assembly:Astyanax_mexicanus-2.0:5:3500... [more]
pkd24.402e-2724.71polycystin 2, transient receptor potential cation ... [more]
pkd2l13.798e-2524.58polycystic kidney disease 2-like 1 protein [Source... [more]
pkd1a1.910e-1837.31polycystic kidney disease 1a [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of PKD1L-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007306.16.777e-4330.40pep scaffold:Pmarinus_7.0:GL480012:400827:419749:1... [more]
pkd2l11.483e-2622.39polycystic kidney disease 2-like 1 [Source:ZFIN;Ac... [more]
pkd2l12.049e-2626.37polycystic kidney disease 2-like 1 [Source:ZFIN;Ac... [more]
ENSPMAT00000010652.11.545e-2027.72pep scaffold:Pmarinus_7.0:GL477016:137094:159626:-... [more]
ENSPMAT00000010650.11.739e-2027.72pep scaffold:Pmarinus_7.0:GL477016:137070:158392:-... [more]
back to top
BLAST of PKD1L-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PKD1L-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO448842.484e-6923.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431952.574e-5927.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO323241.607e-4329.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469837.248e-4032.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO400502.640e-3932.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PKD1L-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkd1l2a1.940e-6324.05polycystin 1 like 2 [Source:NCBI gene;Acc:10116220... [more]
pkd1l2a2.215e-3624.69polycystin 1 like 2 [Source:NCBI gene;Acc:10116220... [more]
pkd1l2a4.226e-3130.14polycystin 1 like 2 [Source:NCBI gene;Acc:10116220... [more]
pkd26.601e-2724.47polycystin 2, transient receptor potential cation ... [more]
pkd21.452e-2624.47polycystin 2, transient receptor potential cation ... [more]
back to top
BLAST of PKD1L-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014723.10.000e+099.18SMESG000014723.1[more]
SMESG000014723.10.000e+099.15SMESG000014723.1[more]
SMESG000014725.11.226e-1899.69SMESG000014725.1[more]
SMESG000014725.11.277e-1899.69SMESG000014725.1[more]
SMESG000066980.14.105e-3224.22SMESG000066980.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30020654
GenBankAKN21725.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020654 ID=SMED30020654|Name=PKD1L-2|organism=Schmidtea mediterranea sexual|type=transcript|length=4753bp
CATTGAATTGTCCAGTTAATGGAAGTTGGAGTTCATGGAGTACATGGTCA
TCATGCTCGGTTTCGTGTGGATCCAATGGCATTATGCAAAGAAGCCGCCT
ATGTAACAATCCGGCACCGTCAAACGCTGGACAGGACTGTTCTGGTCTTT
CAACTGATACTCAAAGCTGTACAAATGTTCCATTGAATTGTCCAGTAAAT
GGGATGTGGAGTTCATGGAGTACGTGGTCATCTTGTTCTTCTTCATGTGG
CTTTGGGACAAGATCAAGGACAAGAAATTGTGACAACCCTTCGCCATTAA
ATGGTGGATTAGGATGTAGCTCTTGTGTAACAGTTATATTTGGATCATGC
GGCATGAGCGATATCAATGTTGAAAATTGTACTTGGATTTCATGTAGCGA
TCCCCAACTAGTTGCCCAGAATATCATTTCCGATACCTTATCCAAGCTCA
ACATCTCCGGTACAAATAGTACAATGTCGGTTCAACAAACGATGAATTTG
GCATTTGACGTCGTTAATAAGATCCAAAGCGCCTTGCAAAACGCATTGCT
AAACTCAACTGGTCCGTTAATGATTCAAACTAACGAAGTAACGGTCGGGC
TACAGAGCTTGAGTCCCACAAGTGGCCAGCAAAATATTTCGATGGTATCA
ACGGATAAAGGAAAAATCTCAATTGGTTCATCTTTAAATTTGACAACGCC
GACAGTCGTAACATTTTCCGCTCTGAAATCCAGTGTGTTTTTCAGTGCCT
CGTCCGTTGCCGATACTTCAGCGGCTATGCTGAGCTTGACAATCCAAAAC
GTTAGTAACACGACGCCCGTCCAGTTGAGTGTTTCCATACCAAATTCTAA
TCAACAGGTAGAATCAGACATGTTGTCGCCTGTCAAATTCAATGTCAGCA
ATCAGTTGATCCAAACATTACAATACACAAGTTTATCAACCGTATATAAG
CTTTCAATGAATTTGTCAAACGCAACCGATTTTACAATTTTCTTTTCCGC
ATCCTCTTTGGCAAATACAACAGATTCGTCTGACGCTTTCATATACTTAT
CAAATCAACTTCATGGGATACAAGTTCCGGTATGTTGCGTATAACGATTC
CTTCCGGTCAAGTGACGCCACCAAACAATATGACTCTCGTTATGATTACT
TCGACAAATACCACAAATGGGATTCTCTTATTGTCACTTGGAGTCGCGAG
TTTAACTCCGAGAATTTGGAATTTTAACATGGAAGTATGGCAGGACTTTT
CAGCAAGTGTCGACGACACCTCAGATATCAGTAATATCAACTTCAAAAGC
AACTTCCTTGGAACATTTTCGGCAAAGATTTTTATCGCTCCGAATATGAT
TGATTTTAAAAATGTTTTTGCTAACTTTGCGTCACTTTTGGCGAACAGTT
ATGTCGTTCTGATAGTTATTATTCTCATTTTCATTTTATATTTGCTTCTT
GTTATCGTGATGTGGAGGAAAGACCGAAGAGAAAGTATTTTGTTGCGTTA
TGAGCCTCTGCTAGACAACGATCCAGAATATGAATATTCTTACGTAATAA
GTGTACATACTGGTTCATGTCGAAACGCTGGTACAAGTAGTGATATTTTC
ATAAATCTTTTGGGAAAATGGGGTTCAAGCGGCCACAGGAAAATGACTGA
TGGATACAGAGATGGGCTTTTCGAAACTGGAACTGTTTGTAATTTTGTAA
TGACAACTGATTCACCTCTTGGTGACCTCATGGCTCTCAGAATCTGGCAC
AATTCCTCTGGCATTAAACCTTCCTGGAATCTAGAGAAACTTGTTATTGA
AGATATTCAAACCAATAAAATGTACATTTTCATGTGTGAGACGTGGTTAT
CTGATAGTAAATTTGACGGGAATACGGAACGAGTTCTTCTTGAAATCAAG
CGAGATGAGAAATTCCAAAACCTTTTTCAACGGATGAAAGTCTCAGGAGT
AATGGACAAGCACATCATCGCGGGTATCACTAATAATACAGGGGTCTCGT
GCTATACGAGAGTCCAAAAGGTTACGGTTTTTGTGACCATGTTTTTCCTT
ATAATGGTATCGAATGCCATGTTTTTCGGAAAAGATAATAATTTAAGTGG
AGATGCAAATTTCAAGATAGATTTTGGTCTTATATCAATTACATGGTTTC
AGTTTTACACAGGAATAATTTCCGTTCTGATAACCTATCCCTGCATCTTC
ATAGCTTCCGAGATATTCAGACGAACTCGTAGATGGAAACGGCGATGGAC
AGAAGATCAGGAAGCAAAAATGAAAAAAATGTTCCTTCTTCCAAAAGGTT
TCATTTTTGTCGGTTGGAGTTTGCTTTTTGTTGCTTTGGTTGCTTCTGTT
TTTTTCACATTTCTGTACAGCTTACAATGGGGTGGGGAGAAATCTAATCA
GTGGTTACAAACATTTTTCGTTGGAATTTTCGGAATGGTATTCTTATCCG
ATCCAATCATATTATTGATTATATTTGTGCTGGCCAAGAAATTACTTGGG
GCAGTTTCAACTGATCAAGAAGCAAATATCGACGAATTCGTGAAAGATGA
TTTGAAAAAAGTTCTTGGTGCAAATTTAAATCCACCGGACCAGGAAAAAC
TAGAAAAGATTAAAAAGGACAAAGCGAGTGGTCAAAGACTATCAAGAGTT
GTTGGGGACGCATTAACTTATGTATTGTCACTCCTTCTTCTCACCGCGCT
GGCATATGATGCTCGAAGTCAGGTTACTTTTGATCAAACAAAAATGATTC
GATCAAGATTTATAAAATCTAATGTACAAACTTACATGGATTTCTATGAC
TGGGCTCAGGGTATTCTCAATGAATCCTATCCGAAGGTTTGGTATAATAA
CATGAATCGAACTGGAGATCTCACAACAGCTATTGCAATATGTGACTGTT
TAAGACAAGGTCCATTCCGAATAAGACAAATTCGAGTTAAACGAAATACT
TGTACGATTTCTGCTTTGGTTTCAAAAGTATATGGAAATGTTCCATGCAA
TGAGAACTATAATCTACTATCGGAAGATACCAGAAGTTTCAGTGTGAAAT
GGACCCCTTTAGCAAACAGCTCTGTGTCATTCAATGATAGTAATTGGAAT
AGGAATTACCTCTCGCCAACACAAACTGTGATTAACGCATTTCTTTATCA
GAATAATACTATTTCTGGAGGGTATCCCTTCGAAGGAACTTTCGGAATTT
ATGGAGGAGGTGGATATATTGCATCGTTAGGAATGAAACAAGAGCAAGCG
GCGTATATTATAAGAAACCTGCAGGCTAACAACTGGTTGGATAAACTCAC
CCGTGCCATATTTTTTGAAGGGACGGTTTACAATGGAAACACAAATTTAT
TCACAACCATTCAAGTTCTTTTTGAGCAGCCAAATTCTGGTGGTCTTCGA
ATGTTTCCATACGGAGTACGAAGTTACCGTCTATATGATTATCTGCCAGG
AAATATGATTGTTTTACTACTGATGCAAATTCTATATGCTTTGACTGTTG
TTTTAAATATCTATCGGGAAATCAAGAAAGTCTGTAAACAGAAGAAGGAA
TACTTTTCCAGTAACTGGAATCTCGTGGAACTTTTGAGTATTTTTCTGTC
TTTATCCATAATAATCTGCACTGCTGTAAGGATTATGGTCACAATTAATG
CTATTACAATGCTGAATGTTAATAAGGGATTTTATGTATCATTCGACAAA
GCGACCAGCTGGTTGGAAACCTCTTGTATTTTAATGGGAATAAGCTCCTT
CGTTTCCATAATTCGTGTCTTGAAGTATATGGGATTTAACAAGTACATTT
CTATAATGCAAGGAACCATTGTAAGAGCCTATACTCAATTGAGTTCATTG
GGATTCATGTTTATCTGCTTCCTAATTGCATTCCTTACTGTCGGGAACAT
TTTGTTTTCATTGAATAACGTAAAGTTTACAAATCTCTTAACCTCGACGG
TTTCGCTTTTTGGTGTATTTGTCGCAATAGTGAAGTATGGCGACATGTTT
GAGACACCGCCAGCCTTTGATTCTGCTCTGTATTACAACGTTTGGTCAGC
TCTTTCCGTATTTTTTATTACGAGTGTTTTTATTTGTATACTCAATGACA
CATATGCAGAAACGATAGATGAAAACCTTTTCGATTACGACAAAGAAATG
GTGGATCATGTTTGGAACATATTTAACGAGATGATGACTGGGTTCAAAAG
CTCAATGAAATATACGGTTCCTGACGCCCTGAAGAAAAAGGCGATAGTCC
CTGTCGACATGTCTGATGTTGACATGCAATTTGCGTCAAAAGAGAACATC
CGCAATATGGTCAGCAAACGAGTAAATCCGTCATTGAGACGAAAACTTGC
CGATTTGAATGGGGAAAAATACAAAACTGAGAAGAGAGAAAACAAACCAA
ATTCAGAAAATGATGTCTATATCAATCCTATAAGTTTCACAGACATTAAG
GTTGCAGCTACGGGATCTCAAATATTAGACGACAAAACCTTTGCTGAGCG
CCTTCCAAAATATAGAGCAAAACAAAACGCAGTTGATACGAATAATCAAC
CTCCGTCATATATGGAGCCAGTTCGACCCTTGAAGCCTAATCCTAAAATT
GATTTATTCTCCAAAACAGAAAGAAAAATAGACATAGACGAAACAGCAGG
AATAAGCCTTGAATTCTAAAGAATTCCTCGTTTGATTCATATTTTAGTAA
TTGACTTACAGATTACATAACTTGTAGAAACATATTTTTAGAATAAATTT
GGC
back to top

protein sequence of SMED30020654-orf-1

>SMED30020654-orf-1 ID=SMED30020654-orf-1|Name=SMED30020654-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=364bp
LNCPVNGSWSSWSTWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLS
TDTQSCTNVPLNCPVNGMWSSWSTWSSCSSSCGFGTRSRTRNCDNPSPLN
GGLGCSSCVTVIFGSCGMSDINVENCTWISCSDPQLVAQNIISDTLSKLN
ISGTNSTMSVQQTMNLAFDVVNKIQSALQNALLNSTGPLMIQTNEVTVGL
QSLSPTSGQQNISMVSTDKGKISIGSSLNLTTPTVVTFSALKSSVFFSAS
SVADTSAAMLSLTIQNVSNTTPVQLSVSIPNSNQQVESDMLSPVKFNVSN
QLIQTLQYTSLSTVYKLSMNLSNATDFTIFFSASSLANTTDSSDAFIYLS
NQLHGIQVPVCCV*
back to top

protein sequence of SMED30020654-orf-2

>SMED30020654-orf-2 ID=SMED30020654-orf-2|Name=SMED30020654-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1196bp
MLRITIPSGQVTPPNNMTLVMITSTNTTNGILLLSLGVASLTPRIWNFNM
EVWQDFSASVDDTSDISNINFKSNFLGTFSAKIFIAPNMIDFKNVFANFA
SLLANSYVVLIVIILIFILYLLLVIVMWRKDRRESILLRYEPLLDNDPEY
EYSYVISVHTGSCRNAGTSSDIFINLLGKWGSSGHRKMTDGYRDGLFETG
TVCNFVMTTDSPLGDLMALRIWHNSSGIKPSWNLEKLVIEDIQTNKMYIF
MCETWLSDSKFDGNTERVLLEIKRDEKFQNLFQRMKVSGVMDKHIIAGIT
NNTGVSCYTRVQKVTVFVTMFFLIMVSNAMFFGKDNNLSGDANFKIDFGL
ISITWFQFYTGIISVLITYPCIFIASEIFRRTRRWKRRWTEDQEAKMKKM
FLLPKGFIFVGWSLLFVALVASVFFTFLYSLQWGGEKSNQWLQTFFVGIF
GMVFLSDPIILLIIFVLAKKLLGAVSTDQEANIDEFVKDDLKKVLGANLN
PPDQEKLEKIKKDKASGQRLSRVVGDALTYVLSLLLLTALAYDARSQVTF
DQTKMIRSRFIKSNVQTYMDFYDWAQGILNESYPKVWYNNMNRTGDLTTA
IAICDCLRQGPFRIRQIRVKRNTCTISALVSKVYGNVPCNENYNLLSEDT
RSFSVKWTPLANSSVSFNDSNWNRNYLSPTQTVINAFLYQNNTISGGYPF
EGTFGIYGGGGYIASLGMKQEQAAYIIRNLQANNWLDKLTRAIFFEGTVY
NGNTNLFTTIQVLFEQPNSGGLRMFPYGVRSYRLYDYLPGNMIVLLLMQI
LYALTVVLNIYREIKKVCKQKKEYFSSNWNLVELLSIFLSLSIIICTAVR
IMVTINAITMLNVNKGFYVSFDKATSWLETSCILMGISSFVSIIRVLKYM
GFNKYISIMQGTIVRAYTQLSSLGFMFICFLIAFLTVGNILFSLNNVKFT
NLLTSTVSLFGVFVAIVKYGDMFETPPAFDSALYYNVWSALSVFFITSVF
ICILNDTYAETIDENLFDYDKEMVDHVWNIFNEMMTGFKSSMKYTVPDAL
KKKAIVPVDMSDVDMQFASKENIRNMVSKRVNPSLRRKLADLNGEKYKTE
KRENKPNSENDVYINPISFTDIKVAATGSQILDDKTFAERLPKYRAKQNA
VDTNNQPPSYMEPVRPLKPNPKIDLFSKTERKIDIDETAGISLEF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0001822kidney development
GO:0006260DNA replication
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0007520dorsal-ventral axis of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR003133T_Ag_DNA-bd
IPR000884TSP1_rpt
IPR001024PLAT/LH2_dom
IPR013122PKD1_2_channel
Vocabulary: molecular function
TermDefinition
GO:0003688DNA replication origin binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane