Eukaryotic translation initiation factor 4G

Overview
NameEukaryotic translation initiation factor 4G
Smed IDSMED30020652
Length (bp)2651
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Eukaryotic translation initiation factor 4G (SMED30020652) t-SNE clustered cells

Violin plots show distribution of expression levels for Eukaryotic translation initiation factor 4G (SMED30020652) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Eukaryotic translation initiation factor 4G (SMED30020652) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Eukaryotic translation initiation factor 4G (SMED30020652) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020652

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30020652SMESG000040165.1 SMESG000013648.1 SMESG000000064.1 Contig800GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30020652SMESG000060566.1 SMESG000060556.1 Contig800GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30020652SMESG000045255.1 SmedASXL_012164SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
muscle cellSMED30020652SMESG000045255.1 dd_Smed_v4_10618_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
posterior region of the whole animalSMED30020652SMESG000045255.1 dd_Smed_v4_10618_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020652SMESG000045255.1 dd_Smed_v4_10618_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30020652SMESG000045255.1 dd_Smed_v4_10618_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020652SMESG000045255.1 dd_Smed_v4_10618_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30020652SMESG000060566.1 SMESG000060556.1 SMESG000060487.1 dd_Smed_v6_4002_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Human
Match: EIF4G3 (eukaryotic translation initiation factor 4 gamma 3 [Source:HGNC Symbol;Acc:HGNC:3298])

HSP 1 Score: 132.109 bits (331), Expect = 1.441e-30
Identity = 101/294 (34.35%), Postives = 151/294 (51.36%), Query Frame = 2
Query:  263 RLIRTENGYLPPQLRKADED-----KLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCS-------EMSNARVGNYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
             L + EN + P Q R +  D     K Q L R ++SILNK+TP+ F   +  +  L +D EE ++ +ID +F KAI E S+S  YA  C         M++      +F+ LLL  CQ  F+K         K   E +AA+  +ER  RL++ ++EE   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +  K++ +   E K ++Q+E
Sbjct:  445 HLKKAENAWKPSQKRDSQADDPENIKTQELFRKVRSILNKLTPQMFNQLMKQVSGLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNRCQKEFEKDKADDDVFEKKQKELEAASAPEERT-RLHD-ELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLK-NHDEESLECLCRLLTTIGKDLD-FEKAKPRMDQYF----NQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSRRADQGPKTIEQIHKEAKIEEQEE 730          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Human
Match: EIF4G3 (eukaryotic translation initiation factor 4 gamma 3 [Source:HGNC Symbol;Acc:HGNC:3298])

HSP 1 Score: 131.724 bits (330), Expect = 2.144e-30
Identity = 101/294 (34.35%), Postives = 151/294 (51.36%), Query Frame = 2
Query:  263 RLIRTENGYLPPQLRKADED-----KLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCS-------EMSNARVGNYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
             L + EN + P Q R +  D     K Q L R ++SILNK+TP+ F   +  +  L +D EE ++ +ID +F KAI E S+S  YA  C         M++      +F+ LLL  CQ  F+K         K   E +AA+  +ER  RL++ ++EE   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +  K++ +   E K ++Q+E
Sbjct:  725 HLKKAENAWKPSQKRDSQADDPENIKTQELFRKVRSILNKLTPQMFNQLMKQVSGLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNRCQKEFEKDKADDDVFEKKQKELEAASAPEERT-RLHD-ELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLK-NHDEESLECLCRLLTTIGKDLD-FEKAKPRMDQYF----NQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSRRADQGPKTIEQIHKEAKIEEQEE 1010          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Human
Match: EIF4G3 (eukaryotic translation initiation factor 4 gamma 3 [Source:HGNC Symbol;Acc:HGNC:3298])

HSP 1 Score: 131.339 bits (329), Expect = 2.281e-30
Identity = 101/294 (34.35%), Postives = 151/294 (51.36%), Query Frame = 2
Query:  263 RLIRTENGYLPPQLRKADED-----KLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCS-------EMSNARVGNYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
             L + EN + P Q R +  D     K Q L R ++SILNK+TP+ F   +  +  L +D EE ++ +ID +F KAI E S+S  YA  C         M++      +F+ LLL  CQ  F+K         K   E +AA+  +ER  RL++ ++EE   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +  K++ +   E K ++Q+E
Sbjct:  731 HLKKAENAWKPSQKRDSQADDPENIKTQELFRKVRSILNKLTPQMFNQLMKQVSGLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNRCQKEFEKDKADDDVFEKKQKELEAASAPEERT-RLHD-ELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLK-NHDEESLECLCRLLTTIGKDLD-FEKAKPRMDQYF----NQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSRRADQGPKTIEQIHKEAKIEEQEE 1016          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Human
Match: EIF4G3 (eukaryotic translation initiation factor 4 gamma 3 [Source:HGNC Symbol;Acc:HGNC:3298])

HSP 1 Score: 131.339 bits (329), Expect = 2.284e-30
Identity = 101/294 (34.35%), Postives = 151/294 (51.36%), Query Frame = 2
Query:  263 RLIRTENGYLPPQLRKADED-----KLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCS-------EMSNARVGNYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
             L + EN + P Q R +  D     K Q L R ++SILNK+TP+ F   +  +  L +D EE ++ +ID +F KAI E S+S  YA  C         M++      +F+ LLL  CQ  F+K         K   E +AA+  +ER  RL++ ++EE   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +  K++ +   E K ++Q+E
Sbjct:  761 HLKKAENAWKPSQKRDSQADDPENIKTQELFRKVRSILNKLTPQMFNQLMKQVSGLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNRCQKEFEKDKADDDVFEKKQKELEAASAPEERT-RLHD-ELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLK-NHDEESLECLCRLLTTIGKDLD-FEKAKPRMDQYF----NQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSRRADQGPKTIEQIHKEAKIEEQEE 1046          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Human
Match: EIF4G3 (eukaryotic translation initiation factor 4 gamma 3 [Source:HGNC Symbol;Acc:HGNC:3298])

HSP 1 Score: 131.339 bits (329), Expect = 2.785e-30
Identity = 102/296 (34.46%), Postives = 154/296 (52.03%), Query Frame = 2
Query:  263 RLIRTENGYLPPQLRKADED-----KLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCS-------EMSNARVGNYSFKALLLKSCQTMFDKPLHLQLEEV--KTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
             L + EN + P Q R +  D     K Q L R ++SILNK+TP+ F   +  +  L +D EE ++ +ID +F KAI E S+S  YA  C         M++      +F+ LLL  CQ  F+K      ++V  K   E +AA+  +ER  RL++ ++EE   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +  K++ +   E K ++Q+E
Sbjct:  914 HLKKAENAWKPSQKRDSQADDPENIKTQELFRKVRSILNKLTPQMFNQLMKQVSGLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNRCQKEFEK--DKADDDVFEKKQKELEAASAPEERT-RLHD-ELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLK-NHDEESLECLCRLLTTIGKDLD-FEKAKPRMDQYF----NQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSRRADQGPKTIEQIHKEAKIEEQEE 1199          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Celegans
Match: ifg-1 (Initiation Factor 4G (eIF4G) family [Source:UniProtKB/TrEMBL;Acc:B5BM23])

HSP 1 Score: 60.077 bits (144), Expect = 6.458e-9
Identity = 63/273 (23.08%), Postives = 125/273 (45.79%), Query Frame = 2
Query:  341 RNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEI-FSKAIQEVSYSSIYARFCSEMSNARV----GNYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNN---------SLEAACRLMEICGKQLEKLEKERTNG-DKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKEDL 1114
            + ++S++NK+TP +      + ++  +   +     + EI F KA++E  + ++YA  C   +N  +    G  +F+  +L   Q  F     +  +++     A    E+D   K L    + E+ +K + + FG + F   L+ +  LS KI+  C   L    KD +         S+    +L+E  G  L+K +   T   D+ F ++       S       ++RF + +++++R+  W  R   K+ +S PK +DEI +D ++E +
Sbjct:  519 KKVRSLMNKVTPTSQRPLTEEFISYNVSSNDAQLAQVVEIVFDKAVEEPKFCALYAEMCKAQANHELSQTGGKSAFRNKVLTRTQMTFQDKKDIDADKL-----AIIEKEEDPVKKELM---LAEEKQKFRRRKFGVMTFMGYLYRNQLLSTKIVQTCTFELFNSIKDQDIKKEDVDEESIHCGLQLIETVGVMLDKSKDSTTVFLDQWFQKLEAAKPYCS------NKIRFMIMNLMELRKDKWIPR---KSTESGPKKIDEIHKDIRQEKI 774          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Celegans
Match: ifg-1 (Initiation Factor 4G (eIF4G) family [Source:UniProtKB/TrEMBL;Acc:B5BM23])

HSP 1 Score: 60.077 bits (144), Expect = 6.512e-9
Identity = 63/273 (23.08%), Postives = 125/273 (45.79%), Query Frame = 2
Query:  341 RNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEI-FSKAIQEVSYSSIYARFCSEMSNARV----GNYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNN---------SLEAACRLMEICGKQLEKLEKERTNG-DKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKEDL 1114
            + ++S++NK+TP +      + ++  +   +     + EI F KA++E  + ++YA  C   +N  +    G  +F+  +L   Q  F     +  +++     A    E+D   K L    + E+ +K + + FG + F   L+ +  LS KI+  C   L    KD +         S+    +L+E  G  L+K +   T   D+ F ++       S       ++RF + +++++R+  W  R   K+ +S PK +DEI +D ++E +
Sbjct:  518 KKVRSLMNKVTPTSQRPLTEEFISYNVSSNDAQLAQVVEIVFDKAVEEPKFCALYAEMCKAQANHELSQTGGKSAFRNKVLTRTQMTFQDKKDIDADKL-----AIIEKEEDPVKKELM---LAEEKQKFRRRKFGVMTFMGYLYRNQLLSTKIVQTCTFELFNSIKDQDIKKEDVDEESIHCGLQLIETVGVMLDKSKDSTTVFLDQWFQKLEAAKPYCS------NKIRFMIMNLMELRKDKWIPR---KSTESGPKKIDEIHKDIRQEKI 773          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Celegans
Match: ifg-1 (Initiation Factor 4G (eIF4G) family [Source:UniProtKB/TrEMBL;Acc:B5BM23])

HSP 1 Score: 60.077 bits (144), Expect = 6.658e-9
Identity = 64/274 (23.36%), Postives = 126/274 (45.99%), Query Frame = 2
Query:  341 RNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEI-FSKAIQEVSYSSIYARFCSEMSNARV----GNYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNN---------SLEAACRLMEICGKQLEKLEKERTNG--DKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKEDL 1114
            + ++S++NK+TP +      + ++  +   +     + EI F KA++E  + ++YA  C   +N  +    G  +F+  +L   Q  F     +  +++     A    E+D   K L    + E+ +K + + FG + F   L+ +  LS KI+  C   L    KD +         S+    +L+E  G  L+K  K+ T    D+ F ++       S       ++RF + +++++R+  W  R   K+ +S PK +DEI +D ++E +
Sbjct:  405 KKVRSLMNKVTPTSQRPLTEEFISYNVSSNDAQLAQVVEIVFDKAVEEPKFCALYAEMCKAQANHELSQTGGKSAFRNKVLTRTQMTFQDKKDIDADKL-----AIIEKEEDPVKKELM---LAEEKQKFRRRKFGVMTFMGYLYRNQLLSTKIVQTCTFELFNSIKDQDIKKEDVDEESIHCGLQLIETVGVMLDK-SKDSTTVFLDQWFQKLEAAKPYCS------NKIRFMIMNLMELRKDKWIPR---KSTESGPKKIDEIHKDIRQEKI 660          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Celegans
Match: ifg-1 (Initiation Factor 4G (eIF4G) family [Source:UniProtKB/TrEMBL;Acc:B5BM23])

HSP 1 Score: 60.077 bits (144), Expect = 6.658e-9
Identity = 64/274 (23.36%), Postives = 126/274 (45.99%), Query Frame = 2
Query:  341 RNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEI-FSKAIQEVSYSSIYARFCSEMSNARV----GNYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNN---------SLEAACRLMEICGKQLEKLEKERTNG--DKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKEDL 1114
            + ++S++NK+TP +      + ++  +   +     + EI F KA++E  + ++YA  C   +N  +    G  +F+  +L   Q  F     +  +++     A    E+D   K L    + E+ +K + + FG + F   L+ +  LS KI+  C   L    KD +         S+    +L+E  G  L+K  K+ T    D+ F ++       S       ++RF + +++++R+  W  R   K+ +S PK +DEI +D ++E +
Sbjct:  405 KKVRSLMNKVTPTSQRPLTEEFISYNVSSNDAQLAQVVEIVFDKAVEEPKFCALYAEMCKAQANHELSQTGGKSAFRNKVLTRTQMTFQDKKDIDADKL-----AIIEKEEDPVKKELM---LAEEKQKFRRRKFGVMTFMGYLYRNQLLSTKIVQTCTFELFNSIKDQDIKKEDVDEESIHCGLQLIETVGVMLDK-SKDSTTVFLDQWFQKLEAAKPYCS------NKIRFMIMNLMELRKDKWIPR---KSTESGPKKIDEIHKDIRQEKI 660          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Celegans
Match: ifg-1 (Initiation Factor 4G (eIF4G) family [Source:UniProtKB/TrEMBL;Acc:B5BM23])

HSP 1 Score: 60.077 bits (144), Expect = 6.658e-9
Identity = 64/274 (23.36%), Postives = 126/274 (45.99%), Query Frame = 2
Query:  341 RNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEI-FSKAIQEVSYSSIYARFCSEMSNARV----GNYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNN---------SLEAACRLMEICGKQLEKLEKERTNG--DKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKEDL 1114
            + ++S++NK+TP +      + ++  +   +     + EI F KA++E  + ++YA  C   +N  +    G  +F+  +L   Q  F     +  +++     A    E+D   K L    + E+ +K + + FG + F   L+ +  LS KI+  C   L    KD +         S+    +L+E  G  L+K  K+ T    D+ F ++       S       ++RF + +++++R+  W  R   K+ +S PK +DEI +D ++E +
Sbjct:  405 KKVRSLMNKVTPTSQRPLTEEFISYNVSSNDAQLAQVVEIVFDKAVEEPKFCALYAEMCKAQANHELSQTGGKSAFRNKVLTRTQMTFQDKKDIDADKL-----AIIEKEEDPVKKELM---LAEEKQKFRRRKFGVMTFMGYLYRNQLLSTKIVQTCTFELFNSIKDQDIKKEDVDEESIHCGLQLIETVGVMLDK-SKDSTTVFLDQWFQKLEAAKPYCS------NKIRFMIMNLMELRKDKWIPR---KSTESGPKKIDEIHKDIRQEKI 660          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Fly
Match: eIF4G1 (gene:FBgn0023213 transcript:FBtr0112904)

HSP 1 Score: 105.916 bits (263), Expect = 1.029e-22
Identity = 87/322 (27.02%), Postives = 153/322 (47.52%), Query Frame = 2
Query:  263 RLIRTENGYLPPQLRKADED--------KLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEM------------SNARVGNYSFKALLLKSCQTMF----------DKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFS--RVMNQFVVLSKNVD-----IEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKEDLS 1117
            +L   EN + P  L K+D D        K +L++R ++ ILNK+TPE F+  + +++ L+ID  + +  +I  +F KAI E ++S  YAR C  +            S  +  +  F+  LL   +  F          +K L   ++++K   +   ANEK E    L E + + + +       G +RF  ELF  + L+ KII +C + LL      + LE  C+L+   G + EK      +  + +S  + + +   ++   D     +  R+RF L+DV+D+R+  W     Q +    PKT+ +I+++ + E LS
Sbjct:  971 KLSENENAWRPRVLNKSDGDSDAKSALEKDELVRR-VRGILNKLTPERFDTLVEEIIKLKIDTPDKVDEVIVLVFEKAIDEPNFSVSYARLCQRLAAEVKVIDERMESETKSNSAHFRNALLDKTEQEFTQNVSQSTAKEKKLQPIVDKIK---KCTDANEKAELEAFLEEEERKIRRRSG-----GTVRFIGELFKISMLTGKIIYSCIDTLLN-PHSEDMLECLCKLLTTVGAKFEKTPVNSKDPSRCYSLEKSITRMQAIASKTDKDGARVSSRVRFMLQDVIDLRKNKW-----QTSRNEAPKTMGQIEKEAKNEQLS 1277          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Fly
Match: eIF4G2 (gene:FBgn0260634 transcript:FBtr0089623)

HSP 1 Score: 104.375 bits (259), Expect = 2.756e-22
Identity = 82/303 (27.06%), Postives = 146/303 (48.18%), Query Frame = 2
Query:  221 YLDFTRRHYNIRPK-RLIRTENGYLPPQLRKA-------DEDKLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEM-SNARVGNYS-FKALLLKSCQTMFD----------KPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKE----RTNGDKGFSRVMNQFVVLSK--------NVDIEQRLRFKLKDVVDMRERNWE 1033
            ++D  R   +++ + +L   EN + P  LR+        ++D ++ + + ++ ILNK+TP+NFEV L ++ ++++D E  M  ++  IF K I E +++  YARFC  +    +  N S F + L+   Q  F+          K L   +E +    +     E    M+     D+E Q ++   + +G +RF  ELF    L+   ++ C E LL    +   LE  C+L+   G  LE    E    R   +K F R+ +  +  S+        ++ I  R+RF ++DV+D+R RNW+
Sbjct: 1227 HMDIIRVQLSLKEEIKLSECENAWQPGTLRRVSMAGGQDEDDDVEGVLKKVRGILNKLTPDNFEVLLKEMSSIKMDNEAKMTNVMLLIFEKTISEPNFAPTYARFCKVLFHEIKAENKSLFTSSLITRIQHEFESNVNDANAKSKKLQPTMERINQCSDPAKKAELRAEME-----DLEYQFRR---RAWGTVRFIGELFKLQSLTNDRVLNCVESLLEHGCEEK-LEYMCKLLTTVGHLLESSLPEHYQLRDRIEKIFRRIQD-IINRSRGTSHRQQVHIKISSRVRFMMQDVLDLRLRNWD 1519          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Fly
Match: eIF4G2 (gene:FBgn0260634 transcript:FBtr0344335)

HSP 1 Score: 104.375 bits (259), Expect = 2.756e-22
Identity = 82/303 (27.06%), Postives = 146/303 (48.18%), Query Frame = 2
Query:  221 YLDFTRRHYNIRPK-RLIRTENGYLPPQLRKA-------DEDKLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEM-SNARVGNYS-FKALLLKSCQTMFD----------KPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKE----RTNGDKGFSRVMNQFVVLSK--------NVDIEQRLRFKLKDVVDMRERNWE 1033
            ++D  R   +++ + +L   EN + P  LR+        ++D ++ + + ++ ILNK+TP+NFEV L ++ ++++D E  M  ++  IF K I E +++  YARFC  +    +  N S F + L+   Q  F+          K L   +E +    +     E    M+     D+E Q ++   + +G +RF  ELF    L+   ++ C E LL    +   LE  C+L+   G  LE    E    R   +K F R+ +  +  S+        ++ I  R+RF ++DV+D+R RNW+
Sbjct: 1227 HMDIIRVQLSLKEEIKLSECENAWQPGTLRRVSMAGGQDEDDDVEGVLKKVRGILNKLTPDNFEVLLKEMSSIKMDNEAKMTNVMLLIFEKTISEPNFAPTYARFCKVLFHEIKAENKSLFTSSLITRIQHEFESNVNDANAKSKKLQPTMERINQCSDPAKKAELRAEME-----DLEYQFRR---RAWGTVRFIGELFKLQSLTNDRVLNCVESLLEHGCEEK-LEYMCKLLTTVGHLLESSLPEHYQLRDRIEKIFRRIQD-IINRSRGTSHRQQVHIKISSRVRFMMQDVLDLRLRNWD 1519          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Fly
Match: eIF4G1 (gene:FBgn0023213 transcript:FBtr0289951)

HSP 1 Score: 98.2117 bits (243), Expect = 2.358e-20
Identity = 89/323 (27.55%), Postives = 155/323 (47.99%), Query Frame = 2
Query:  263 RLIRTENGYLPPQLRKADED--------KLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEM------------SNARVGNYSFKALLLKSCQTMF----------DKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLL-MFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFS--RVMNQFVVLSKNVD-----IEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKEDLS 1117
            +L   EN + P  L K+D D        K +L++R ++ ILNK+TPE F+  + +++ L+ID  + +  +I  +F KAI E ++S  YAR C  +            S  +  +  F+  LL   +  F          +K L   ++++K   +   ANEK E    L E + + + +       G +RF  ELF  + L+ KII +C + LL   S+D   LE  C+L+   G + EK      +  + +S  + + +   ++   D     +  R+RF L+DV+D+R+  W     Q +    PKT+ +I+++ + E LS
Sbjct:  718 KLSENENAWRPRVLNKSDGDSDAKSALEKDELVRR-VRGILNKLTPERFDTLVEEIIKLKIDTPDKVDEVIVLVFEKAIDEPNFSVSYARLCQRLAAEVKVIDERMESETKSNSAHFRNALLDKTEQEFTQNVSQSTAKEKKLQPIVDKIK---KCTDANEKAELEAFLEEEERKIRRRSG-----GTVRFIGELFKISMLTGKIIYSCIDTLLNPHSED--MLECLCKLLTTVGAKFEKTPVNSKDPSRCYSLEKSITRMQAIASKTDKDGARVSSRVRFMLQDVIDLRKNKW-----QTSRNEAPKTMGQIEKEAKNEQLS 1024          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Fly
Match: eIF4G1 (gene:FBgn0023213 transcript:FBtr0089243)

HSP 1 Score: 98.2117 bits (243), Expect = 2.358e-20
Identity = 89/323 (27.55%), Postives = 155/323 (47.99%), Query Frame = 2
Query:  263 RLIRTENGYLPPQLRKADED--------KLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEM------------SNARVGNYSFKALLLKSCQTMF----------DKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLL-MFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFS--RVMNQFVVLSKNVD-----IEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKEDLS 1117
            +L   EN + P  L K+D D        K +L++R ++ ILNK+TPE F+  + +++ L+ID  + +  +I  +F KAI E ++S  YAR C  +            S  +  +  F+  LL   +  F          +K L   ++++K   +   ANEK E    L E + + + +       G +RF  ELF  + L+ KII +C + LL   S+D   LE  C+L+   G + EK      +  + +S  + + +   ++   D     +  R+RF L+DV+D+R+  W     Q +    PKT+ +I+++ + E LS
Sbjct:  718 KLSENENAWRPRVLNKSDGDSDAKSALEKDELVRR-VRGILNKLTPERFDTLVEEIIKLKIDTPDKVDEVIVLVFEKAIDEPNFSVSYARLCQRLAAEVKVIDERMESETKSNSAHFRNALLDKTEQEFTQNVSQSTAKEKKLQPIVDKIK---KCTDANEKAELEAFLEEEERKIRRRSG-----GTVRFIGELFKISMLTGKIIYSCIDTLLNPHSED--MLECLCKLLTTVGAKFEKTPVNSKDPSRCYSLEKSITRMQAIASKTDKDGARVSSRVRFMLQDVIDLRKNKW-----QTSRNEAPKTMGQIEKEAKNEQLS 1024          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Zebrafish
Match: eif4g3a (eukaryotic translation initiation factor 4 gamma, 3a [Source:ZFIN;Acc:ZDB-GENE-120810-2])

HSP 1 Score: 136.346 bits (342), Expect = 4.708e-32
Identity = 97/296 (32.77%), Postives = 154/296 (52.03%), Query Frame = 2
Query:  263 RLIRTENGYLPPQLRKA-DED----KLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARV-------GNYSFKALLLKSCQTMF--DKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
            +L + EN + P   R+   ED    + Q L R ++SILNK+TP+ F   +  + +L I+ EE ++ +ID +F KAI E S+S  YA  C  ++  +V          +F+ LLL  CQ  F  DK   + LE  +   ++  +  + ER+    + ++EE   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D+ SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +  K++ +   E K ++Q+E
Sbjct:  846 QLKKAENAWKPGMKREGVAEDPETIRTQELFRKVRSILNKLTPQMFHQLMKQVTDLTINTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLATLKVPTADKPNTTVNFRKLLLNRCQKEFERDKVDDVVLERKQKEIDSATSPTEKERL----QEELEEAKDKARRRSTGNIKFIGELFKLKMLTEPIMHDCVVKLLK-NHDDESLECLCRLLTTIGKDLD-FEKAKPRMDQYF----NQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSRRADQGPKTIEQIHKEAKLEEQEE 1131          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Zebrafish
Match: CABZ01085052.1 (pep scaffold:GRCz11:KN150670.1:733:23795:-1 gene:ENSDARG00000101256.2 transcript:ENSDART00000159240.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01085052.1)

HSP 1 Score: 126.716 bits (317), Expect = 2.693e-29
Identity = 100/298 (33.56%), Postives = 156/298 (52.35%), Query Frame = 2
Query:  263 RLIRTENGYLPPQLRKADEDKLQL----LKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARVGN-------YSFKALLLKSCQTMFDKPLHLQLEEVKTFW----EAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKED 1111
            +L + E  + P   R  DED+ +L    L + ++SILNK+TP+ F+  +  +  L I  EE ++ +ID IF KAI E ++S  YA  C  +   +V          +F+ LLL  CQ  F+K      ++ +TF     E  AA  ++ER +RL E ++E+   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW    + +     PKT+++I ++ Q E+
Sbjct:  435 QLNKAEQAWKPSVKRSTDEDQPELQTQELFKRVRSILNKLTPQMFQPLMKQVTELSIHTEERLKGVIDLIFEKAISEPNFSVAYANMCRCLMGLKVPTADKPGVFVNFRKLLLNRCQKEFEK----DKDDDETFEKKQKELDAATVEEER-QRLKE-ELEDAKDKARRRSLGNIKFIGELFKLKMLTENIMHDCIVKLLK-NHDEESLECLCRLLATIGKDLD-FEKAKPRMDQYF----NQMEKIIKERKTSSRIRFMLQDVLDLRRSNW----VPRRGDQGPKTIEQIHKEAQLEE 716          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Zebrafish
Match: eif4g3a (eukaryotic translation initiation factor 4 gamma, 3a [Source:ZFIN;Acc:ZDB-GENE-120810-2])

HSP 1 Score: 126.331 bits (316), Expect = 5.740e-29
Identity = 118/406 (29.06%), Postives = 191/406 (47.04%), Query Frame = 2
Query:   47 GRLTYYRDNLLALR---GCQTLPDQLFLDPVLLEIITAKM------------QLINFLKKKEIFVPVKPSRTDYLDFTRRHYNIR-----------PKRLI------------RTENGYLPPQLRKA-DED----KLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARVG-------NYSFKALLLKSCQTMF--DKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
            G+  Y RD LL  +    C   P+ L   P + +++  KM            +LI+    ++ F P       + DF+R+    R           P+++I            + EN + P   R+   ED    + Q L R ++SILNK+TP+ F   +  + +L I+ EE ++ +ID +F KAI E S+S  YA  C  ++  +V          +F+ LLL  CQ  F  DK   + LE  +   ++  +  + ER++     ++EE   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D+ SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +  K++ +   E K ++Q+E
Sbjct:  354 GKRQYDRDFLLGFQFMPACVQKPEGL---PPISDVVLDKMNQNKLPLRSVDPRLISRGTPQD-FTPA------FADFSRQMAGGRGAPLLNVRRLPPRKIIVNLSVSDDVQLKKAENAWKPGMKREGVAEDPETIRTQELFRKVRSILNKLTPQMFHQLMKQVTDLTINTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLATLKVPTADKPNTTVNFRKLLLNRCQKEFERDKVDDVVLERKQKEIDSATSPTEKERLQE----ELEEAKDKARRRSTGNIKFIGELFKLKMLTEPIMHDCVVKLLK-NHDDESLECLCRLLTTIGKDLD-FEKAKPRMDQYF----NQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSRRADQGPKTIEQIHKEAKLEEQEE 739          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Zebrafish
Match: eif4g3a (eukaryotic translation initiation factor 4 gamma, 3a [Source:ZFIN;Acc:ZDB-GENE-120810-2])

HSP 1 Score: 125.946 bits (315), Expect = 6.192e-29
Identity = 118/406 (29.06%), Postives = 191/406 (47.04%), Query Frame = 2
Query:   47 GRLTYYRDNLLALR---GCQTLPDQLFLDPVLLEIITAKM------------QLINFLKKKEIFVPVKPSRTDYLDFTRRHYNIR-----------PKRLI------------RTENGYLPPQLRKA-DED----KLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARVG-------NYSFKALLLKSCQTMF--DKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
            G+  Y RD LL  +    C   P+ L   P + +++  KM            +LI+    ++ F P       + DF+R+    R           P+++I            + EN + P   R+   ED    + Q L R ++SILNK+TP+ F   +  + +L I+ EE ++ +ID +F KAI E S+S  YA  C  ++  +V          +F+ LLL  CQ  F  DK   + LE  +   ++  +  + ER++     ++EE   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D+ SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +  K++ +   E K ++Q+E
Sbjct:  351 GKRQYDRDFLLGFQFMPACVQKPEGL---PPISDVVLDKMNQNKLPLRSVDPRLISRGTPQD-FTPA------FADFSRQMAGGRGAPLLNVRRLPPRKIIVNLSVSDDVQLKKAENAWKPGMKREGVAEDPETIRTQELFRKVRSILNKLTPQMFHQLMKQVTDLTINTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLATLKVPTADKPNTTVNFRKLLLNRCQKEFERDKVDDVVLERKQKEIDSATSPTEKERLQE----ELEEAKDKARRRSTGNIKFIGELFKLKMLTEPIMHDCVVKLLK-NHDDESLECLCRLLTTIGKDLD-FEKAKPRMDQYF----NQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSRRADQGPKTIEQIHKEAKLEEQEE 736          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Zebrafish
Match: eif4g1a (eukaryotic translation initiation factor 4 gamma, 1a [Source:ZFIN;Acc:ZDB-GENE-070112-702])

HSP 1 Score: 123.25 bits (308), Expect = 5.395e-28
Identity = 93/274 (33.94%), Postives = 148/274 (54.01%), Query Frame = 2
Query:  323 KLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARVG-------NYSFKALLLKSCQTMFDKPLHLQLEEVKTFW----EAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKED 1111
            K Q L R ++S+LNK+TP+ F+  +  +  L ID EE ++ +ID IF KAI E ++S  YA  C  +   +V          +F+ LLL  CQ  F+K      ++ + F     E  AA E++ER +RL + ++++   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D +SLE  CRL+   GK L+  EK +   D+ F    +Q   + K      R+RF L+DV+D+R+ NW  R   +     PKT+D+I ++ + E+
Sbjct:  775 KTQELFRRVRSVLNKLTPQMFQQLMKQVTELAIDTEERLKGVIDLIFEKAISEPNFSVAYANMCRCLMGLKVPTSDKPGVTVNFRKLLLNRCQKEFEK----DKDDDEIFEQKQKELDAATEEEER-QRLND-ELQDAKDKARKRSLGNIKFIGELFKLKMLTEPIMHDCIVKLLK-NHDEDSLECLCRLLSTIGKDLD-FEKAKPRMDQYF----HQMEKIIKEKKTSSRIRFMLQDVLDLRKNNWVPRRGDQG----PKTIDQIHKEAELEE 1032          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Xenopus
Match: eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:NCBI gene;Acc:100216088])

HSP 1 Score: 129.413 bits (324), Expect = 9.306e-30
Identity = 120/402 (29.85%), Postives = 184/402 (45.77%), Query Frame = 2
Query:   35 ESEMGRLTYYRDNLLALR---GCQTLPDQL--FLDPVLLEIITAKMQL----INFLKKKEIFVPVKPSRTDYLDFTRRHYNIR---------PKRLI------------RTENGYLPPQLRKA-----DEDKLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCS-------EMSNARVGNYSFKALLLKSCQTMF--DKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
            +S  G+  Y RD LL  +    C   P+ L    D VL +I   K+ +       L++   F P       Y DF R     R         P+++I            ++EN + P   R +     D  + Q L R ++SILNK+TP+ F   +  + +L +D EE ++ +ID +F KAI E S+S  YA  C         M++      +F+ LLL  CQ  F  DK      E+ +   E     E+  R+    + ++EE   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +  K++ +   E K ++Q+E
Sbjct:  524 QSADGKRQYDRDFLLGFQYMPACVQKPEGLPPISDVVLDKINQPKLPIRALDARMLQRGPDFTPA------YADFGRPAPGGRGMPPGQRREPRKIIMNISVSDDVHLKKSENAWKPSVKRDSLPEDPDSIRTQALFRKVRSILNKLTPQMFNQLMKQVTDLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLATLKVPMADKPGSTVNFRKLLLNRCQKEFEKDKADDDVFEKKQKDLELATTPEEKSRL----QDELEESKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLK-NHDEESLECLCRLLTTIGKDLD-FEKAKPRMDQYF----NQMEKIVKERKTSSRIRFMLQDVIDLRLSNWVSRRAYQGPKTIEQIHKEAKIEEQEE 909          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Xenopus
Match: eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:NCBI gene;Acc:100216088])

HSP 1 Score: 125.561 bits (314), Expect = 1.349e-28
Identity = 120/412 (29.13%), Postives = 184/412 (44.66%), Query Frame = 2
Query:   35 ESEMGRLTYYRDNLLALR---GCQTLPDQL--FLDPVLLEIITAKMQL----INFLKKKEIFVPVKPSRTDYLDFTRRHYNIR-------------------PKRLI------------RTENGYLPPQLRKA-----DEDKLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCS-------EMSNARVGNYSFKALLLKSCQTMF--DKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
            +S  G+  Y RD LL  +    C   P+ L    D VL +I   K+ +       L++   F P       Y DF R     R                   P+++I            ++EN + P   R +     D  + Q L R ++SILNK+TP+ F   +  + +L +D EE ++ +ID +F KAI E S+S  YA  C         M++      +F+ LLL  CQ  F  DK      E+ +   E     E+  R+    + ++EE   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +  K++ +   E K ++Q+E
Sbjct:  541 QSADGKRQYDRDFLLGFQYMPACVQKPEGLPPISDVVLDKINQPKLPIRALDARMLQRGPDFTPA------YADFGRPAPGGRGMPLLSVGPRRSQPGQRREPRKIIMNISVSDDVHLKKSENAWKPSVKRDSLPEDPDSIRTQALFRKVRSILNKLTPQMFNQLMKQVTDLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLATLKVPMADKPGSTVNFRKLLLNRCQKEFEKDKADDDVFEKKQKDLELATTPEEKSRL----QDELEESKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLK-NHDEESLECLCRLLTTIGKDLD-FEKAKPRMDQYF----NQMEKIVKERKTSSRIRFMLQDVIDLRLSNWVSRRAYQGPKTIEQIHKEAKIEEQEE 936          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Xenopus
Match: eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:NCBI gene;Acc:100216088])

HSP 1 Score: 125.561 bits (314), Expect = 1.377e-28
Identity = 120/412 (29.13%), Postives = 184/412 (44.66%), Query Frame = 2
Query:   35 ESEMGRLTYYRDNLLALR---GCQTLPDQL--FLDPVLLEIITAKMQL----INFLKKKEIFVPVKPSRTDYLDFTRRHYNIR-------------------PKRLI------------RTENGYLPPQLRKA-----DEDKLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCS-------EMSNARVGNYSFKALLLKSCQTMF--DKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
            +S  G+  Y RD LL  +    C   P+ L    D VL +I   K+ +       L++   F P       Y DF R     R                   P+++I            ++EN + P   R +     D  + Q L R ++SILNK+TP+ F   +  + +L +D EE ++ +ID +F KAI E S+S  YA  C         M++      +F+ LLL  CQ  F  DK      E+ +   E     E+  R+    + ++EE   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +  K++ +   E K ++Q+E
Sbjct:  598 QSADGKRQYDRDFLLGFQYMPACVQKPEGLPPISDVVLDKINQPKLPIRALDARMLQRGPDFTPA------YADFGRPAPGGRGMPLLSVGPRRSQPGQRREPRKIIMNISVSDDVHLKKSENAWKPSVKRDSLPEDPDSIRTQALFRKVRSILNKLTPQMFNQLMKQVTDLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLATLKVPMADKPGSTVNFRKLLLNRCQKEFEKDKADDDVFEKKQKDLELATTPEEKSRL----QDELEESKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLK-NHDEESLECLCRLLTTIGKDLD-FEKAKPRMDQYF----NQMEKIVKERKTSSRIRFMLQDVIDLRLSNWVSRRAYQGPKTIEQIHKEAKIEEQEE 993          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Xenopus
Match: eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:NCBI gene;Acc:100216088])

HSP 1 Score: 125.561 bits (314), Expect = 1.467e-28
Identity = 120/412 (29.13%), Postives = 184/412 (44.66%), Query Frame = 2
Query:   35 ESEMGRLTYYRDNLLALR---GCQTLPDQL--FLDPVLLEIITAKMQL----INFLKKKEIFVPVKPSRTDYLDFTRRHYNIR-------------------PKRLI------------RTENGYLPPQLRKA-----DEDKLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCS-------EMSNARVGNYSFKALLLKSCQTMF--DKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
            +S  G+  Y RD LL  +    C   P+ L    D VL +I   K+ +       L++   F P       Y DF R     R                   P+++I            ++EN + P   R +     D  + Q L R ++SILNK+TP+ F   +  + +L +D EE ++ +ID +F KAI E S+S  YA  C         M++      +F+ LLL  CQ  F  DK      E+ +   E     E+  R+    + ++EE   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +  K++ +   E K ++Q+E
Sbjct:  632 QSADGKRQYDRDFLLGFQYMPACVQKPEGLPPISDVVLDKINQPKLPIRALDARMLQRGPDFTPA------YADFGRPAPGGRGMPLLSVGPRRSQPGQRREPRKIIMNISVSDDVHLKKSENAWKPSVKRDSLPEDPDSIRTQALFRKVRSILNKLTPQMFNQLMKQVTDLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLATLKVPMADKPGSTVNFRKLLLNRCQKEFEKDKADDDVFEKKQKDLELATTPEEKSRL----QDELEESKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLK-NHDEESLECLCRLLTTIGKDLD-FEKAKPRMDQYF----NQMEKIVKERKTSSRIRFMLQDVIDLRLSNWVSRRAYQGPKTIEQIHKEAKIEEQEE 1027          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Xenopus
Match: eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:NCBI gene;Acc:100216088])

HSP 1 Score: 125.561 bits (314), Expect = 1.499e-28
Identity = 120/412 (29.13%), Postives = 184/412 (44.66%), Query Frame = 2
Query:   35 ESEMGRLTYYRDNLLALR---GCQTLPDQL--FLDPVLLEIITAKMQL----INFLKKKEIFVPVKPSRTDYLDFTRRHYNIR-------------------PKRLI------------RTENGYLPPQLRKA-----DEDKLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCS-------EMSNARVGNYSFKALLLKSCQTMF--DKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
            +S  G+  Y RD LL  +    C   P+ L    D VL +I   K+ +       L++   F P       Y DF R     R                   P+++I            ++EN + P   R +     D  + Q L R ++SILNK+TP+ F   +  + +L +D EE ++ +ID +F KAI E S+S  YA  C         M++      +F+ LLL  CQ  F  DK      E+ +   E     E+  R+    + ++EE   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +  K++ +   E K ++Q+E
Sbjct:  550 QSADGKRQYDRDFLLGFQYMPACVQKPEGLPPISDVVLDKINQPKLPIRALDARMLQRGPDFTPA------YADFGRPAPGGRGMPLLSVGPRRSQPGQRREPRKIIMNISVSDDVHLKKSENAWKPSVKRDSLPEDPDSIRTQALFRKVRSILNKLTPQMFNQLMKQVTDLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLATLKVPMADKPGSTVNFRKLLLNRCQKEFEKDKADDDVFEKKQKDLELATTPEEKSRL----QDELEESKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLK-NHDEESLECLCRLLTTIGKDLD-FEKAKPRMDQYF----NQMEKIVKERKTSSRIRFMLQDVIDLRLSNWVSRRAYQGPKTIEQIHKEAKIEEQEE 945          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Mouse
Match: Eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:MGI Symbol;Acc:MGI:1923935])

HSP 1 Score: 139.043 bits (349), Expect = 8.381e-33
Identity = 103/293 (35.15%), Postives = 153/293 (52.22%), Query Frame = 2
Query:  266 LIRTENGYLPPQLRKADED-----KLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARV------GN-YSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
            L + EN + P Q R +  D     K Q L R ++SILNK+TP+ F   +  +  L +D EE ++ +ID +F KAI E S+S  YA  C  +   +V      GN  +F+ LLL  CQ  F+K         K   E +AA+  +ER  RL++ ++EE   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +  K++ +   E K ++Q+E
Sbjct:  904 LRKAENAWKPSQKRDSHADDPESIKTQELFRKVRSILNKLTPQMFNQLMKQVSALTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNRCQKEFEKDKADDDVFEKKQKELEAASAPEER-TRLHD-ELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLK-NHDEESLECLCRLLTTIGKDLD-FEKAKPRMDQYF----NQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSRRADQGPKTIEQIHKEAKIEEQEE 1188          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Mouse
Match: Eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:MGI Symbol;Acc:MGI:1923935])

HSP 1 Score: 130.954 bits (328), Expect = 1.445e-30
Identity = 103/294 (35.03%), Postives = 153/294 (52.04%), Query Frame = 2
Query:  263 RLIRTENGYLPPQLRKADED-----KLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARV------GN-YSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
             L + EN + P Q R +  D     K Q L R ++SILNK+TP+ F   +  +  L +D EE ++ +ID +F KAI E S+S  YA  C  +   +V      GN  +F+ LLL  CQ  F+K         K   E +AA+  +ER  RL++ ++EE   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +  K++ +   E K ++Q+E
Sbjct:  162 HLRKAENAWKPSQKRDSHADDPESIKTQELFRKVRSILNKLTPQMFNQLMKQVSALTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNRCQKEFEKDKADDDVFEKKQKELEAASAPEERT-RLHD-ELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLK-NHDEESLECLCRLLTTIGKDLD-FEKAKPRMDQYF----NQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSRRADQGPKTIEQIHKEAKIEEQEE 447          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Mouse
Match: Eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:MGI Symbol;Acc:MGI:1923935])

HSP 1 Score: 130.568 bits (327), Expect = 2.896e-30
Identity = 101/294 (34.35%), Postives = 151/294 (51.36%), Query Frame = 2
Query:  263 RLIRTENGYLPPQLRKADED-----KLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCS-------EMSNARVGNYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
             L + EN + P Q R +  D     K Q L R ++SILNK+TP+ F   +  +  L +D EE ++ +ID +F KAI E S+S  YA  C         M++      +F+ LLL  CQ  F+K         K   E +AA+  +ER  RL++ ++EE   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +  K++ +   E K ++Q+E
Sbjct:  720 HLRKAENAWKPSQKRDSHADDPESIKTQELFRKVRSILNKLTPQMFNQLMKQVSALTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNRCQKEFEKDKADDDVFEKKQKELEAASAPEERT-RLHD-ELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLK-NHDEESLECLCRLLTTIGKDLD-FEKAKPRMDQYF----NQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSRRADQGPKTIEQIHKEAKIEEQEE 1005          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Mouse
Match: Eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:MGI Symbol;Acc:MGI:1923935])

HSP 1 Score: 130.568 bits (327), Expect = 3.155e-30
Identity = 101/294 (34.35%), Postives = 151/294 (51.36%), Query Frame = 2
Query:  263 RLIRTENGYLPPQLRKADED-----KLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCS-------EMSNARVGNYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
             L + EN + P Q R +  D     K Q L R ++SILNK+TP+ F   +  +  L +D EE ++ +ID +F KAI E S+S  YA  C         M++      +F+ LLL  CQ  F+K         K   E +AA+  +ER  RL++ ++EE   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +  K++ +   E K ++Q+E
Sbjct:  738 HLRKAENAWKPSQKRDSHADDPESIKTQELFRKVRSILNKLTPQMFNQLMKQVSALTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNRCQKEFEKDKADDDVFEKKQKELEAASAPEERT-RLHD-ELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLK-NHDEESLECLCRLLTTIGKDLD-FEKAKPRMDQYF----NQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSRRADQGPKTIEQIHKEAKIEEQEE 1023          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Mouse
Match: Eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:MGI Symbol;Acc:MGI:1923935])

HSP 1 Score: 130.183 bits (326), Expect = 3.638e-30
Identity = 101/294 (34.35%), Postives = 151/294 (51.36%), Query Frame = 2
Query:  263 RLIRTENGYLPPQLRKADED-----KLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCS-------EMSNARVGNYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
             L + EN + P Q R +  D     K Q L R ++SILNK+TP+ F   +  +  L +D EE ++ +ID +F KAI E S+S  YA  C         M++      +F+ LLL  CQ  F+K         K   E +AA+  +ER  RL++ ++EE   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +  K++ +   E K ++Q+E
Sbjct:  727 HLRKAENAWKPSQKRDSHADDPESIKTQELFRKVRSILNKLTPQMFNQLMKQVSALTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNRCQKEFEKDKADDDVFEKKQKELEAASAPEERT-RLHD-ELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLK-NHDEESLECLCRLLTTIGKDLD-FEKAKPRMDQYF----NQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSRRADQGPKTIEQIHKEAKIEEQEE 1012          
BLAST of Eukaryotic translation initiation factor 4G vs. UniProt/SwissProt
Match: sp|O43432|IF4G3_HUMAN (Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3 PE=1 SV=2)

HSP 1 Score: 131.724 bits (330), Expect = 1.030e-29
Identity = 101/294 (34.35%), Postives = 151/294 (51.36%), Query Frame = 2
Query:  263 RLIRTENGYLPPQLRKADED-----KLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCS-------EMSNARVGNYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
             L + EN + P Q R +  D     K Q L R ++SILNK+TP+ F   +  +  L +D EE ++ +ID +F KAI E S+S  YA  C         M++      +F+ LLL  CQ  F+K         K   E +AA+  +ER  RL++ ++EE   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +  K++ +   E K ++Q+E
Sbjct:  725 HLKKAENAWKPSQKRDSQADDPENIKTQELFRKVRSILNKLTPQMFNQLMKQVSGLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNRCQKEFEKDKADDDVFEKKQKELEAASAPEERT-RLHD-ELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLK-NHDEESLECLCRLLTTIGKDLD-FEKAKPRMDQYF----NQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSRRADQGPKTIEQIHKEAKIEEQEE 1010          
BLAST of Eukaryotic translation initiation factor 4G vs. UniProt/SwissProt
Match: sp|Q80XI3|IF4G3_MOUSE (Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus OX=10090 GN=Eif4g3 PE=1 SV=2)

HSP 1 Score: 130.568 bits (327), Expect = 2.061e-29
Identity = 101/294 (34.35%), Postives = 151/294 (51.36%), Query Frame = 2
Query:  263 RLIRTENGYLPPQLRKADED-----KLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCS-------EMSNARVGNYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
             L + EN + P Q R +  D     K Q L R ++SILNK+TP+ F   +  +  L +D EE ++ +ID +F KAI E S+S  YA  C         M++      +F+ LLL  CQ  F+K         K   E +AA+  +ER  RL++ ++EE   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +  K++ +   E K ++Q+E
Sbjct:  720 HLRKAENAWKPSQKRDSHADDPESIKTQELFRKVRSILNKLTPQMFNQLMKQVSALTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNRCQKEFEKDKADDDVFEKKQKELEAASAPEERT-RLHD-ELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLK-NHDEESLECLCRLLTTIGKDLD-FEKAKPRMDQYF----NQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSRRADQGPKTIEQIHKEAKIEEQEE 1005          
BLAST of Eukaryotic translation initiation factor 4G vs. UniProt/SwissProt
Match: sp|Q04637|IF4G1_HUMAN (Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=4)

HSP 1 Score: 124.79 bits (312), Expect = 1.152e-27
Identity = 99/279 (35.48%), Postives = 143/279 (51.25%), Query Frame = 2
Query:  311 ADEDKLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARVG-------NYSFKALLLKSCQTMFDKPLHLQLEEV-----KTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKED 1111
            AD  K Q L R ++SILNK+TP+ F+  +  +  L ID EE ++ +ID IF KAI E ++S  YA  C  +   +V          +F+ LLL  CQ  F+K      +EV     K   EA  A E+     RL E ++EE    A+ +  GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +     PKT+D+I ++ + E+
Sbjct:  752 ADGSKTQDLFRRVRSILNKLTPQMFQQLMKQVTQLAIDTEERLKGVIDLIFEKAISEPNFSVAYANMCRCLMALKVPTTEKPTVTVNFRKLLLNRCQKEFEK--DKDDDEVFEKKQKEMDEAATAEERG----RLKE-ELEEARDIARRRSLGNIKFIGELFKLKMLTEAIMHDCVVKLLK-NHDEESLECLCRLLTTIGKDLD-FEKAKPRMDQYF----NQMEKIIKEKKTSSRIRFMLQDVLDLRGSNWVPRRGDQG----PKTIDQIHKEAEMEE 1013          
BLAST of Eukaryotic translation initiation factor 4G vs. UniProt/SwissProt
Match: sp|Q6NZJ6|IF4G1_MOUSE (Eukaryotic translation initiation factor 4 gamma 1 OS=Mus musculus OX=10090 GN=Eif4g1 PE=1 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 2.047e-27
Identity = 98/279 (35.13%), Postives = 143/279 (51.25%), Query Frame = 2
Query:  311 ADEDKLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARVG-------NYSFKALLLKSCQTMFDKPLHLQLEEV-----KTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKED 1111
            AD  K Q L R ++SILNK+TP+ F+  +  +  L ID EE ++ +ID IF KAI E ++S  YA  C  +   +V          +F+ LLL  CQ  F+K      +EV     K   EA  A E+     RL E ++EE    A+ +  GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+   K +   D+ F    NQ   + K      R+RF L+DV+D+R+ NW  R   +     PKT+D+I ++ + E+
Sbjct:  756 ADGSKTQDLFRRVRSILNKLTPQMFQQLMKQVTQLAIDTEERLKGVIDLIFEKAISEPNFSVAYANMCRCLMALKVPTTEKPTVTVNFRKLLLNRCQKEFEK--DKDDDEVFEKKQKEMDEAATAEERG----RLKE-ELEEARDIARRRSLGNIKFIGELFKLKMLTEAIMHDCVVKLLK-NHDEESLECLCRLLTTIGKDLD-FAKAKPRMDQYF----NQMEKIIKEKKTSSRIRFMLQDVLDLRQSNWVPRRGDQG----PKTIDQIHKEAEMEE 1017          
BLAST of Eukaryotic translation initiation factor 4G vs. UniProt/SwissProt
Match: sp|B9FXV5|IF4G_ORYSJ (Eukaryotic translation initiation factor 4G OS=Oryza sativa subsp. japonica OX=39947 GN=Os07g0555200 PE=2 SV=2)

HSP 1 Score: 122.094 bits (305), Expect = 8.480e-27
Identity = 85/288 (29.51%), Postives = 147/288 (51.04%), Query Frame = 2
Query:  272 RTENGYLPPQLRKADEDKLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARVGNYS-------FKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLL--MFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
            + E  Y+  ++   +E K    +R +K+ILNK+TP+NFE     +  + ID    +  +I +IF KA+ E ++  +YA FC  ++ A + ++S       FK LLL  CQ  F++    + E  KT  E +    K+ER         EE+  +A+ +  GNIR   EL+    L+ +I+  C ++LL    + D  ++EA C+LM   G+ ++   K + + D  F  ++     LS +  +  R+RF L+D +D+R+  W+    Q+     PK +DE+  D  +E
Sbjct: 1165 KAEKKYVVGKVSDEEEAK----QRQLKAILNKLTPQNFEKLFEKVKEVNIDNVATLTGVISQIFDKALMEPTFCEMYANFCFHLAGA-LPDFSEDNEKITFKRLLLNKCQEEFERGEREEAEADKTEEEGEIKQTKEER---------EEKRIRARRRMLGNIRLIGELYKKRMLTERIMHECIKKLLGNYQNPDEENIEALCKLMSTIGEMIDH-AKAKEHMDAYFDIMLK----LSTSQQLSSRVRFMLRDSIDLRKNKWQ----QRRKVEGPKKIDEVHRDAAQE 1429          
BLAST of Eukaryotic translation initiation factor 4G vs. TrEMBL
Match: A0A267HB46 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013413g3 PE=4 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 4.330e-43
Identity = 113/309 (36.57%), Postives = 180/309 (58.25%), Query Frame = 2
Query:  266 LIRTENGYLPPQLRKADEDKLQL----LKRNIKSILNKMTPENFEVCLNDLVNL-EIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARVGNY-----------SFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLL--------MFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKEDLSK 1120
            L ++++ Y+P  L+K  +D+ QL    ++RNI+SILNK+ P+NFE C + L    +I   + +   +D IF KA +E SYSS++A  C  ++  +V N+            F++LLLK CQ MF+ PL  Q+E+    W+ K   E+ E  K+  E + +EQ+KKAKD+Y+GNIRF  ELF+ + L+  II  C    L        MF++   SLE  C L++  GK+LE     +   D+ F R+      L  + +IE ++RF+L+D+V+MR+RNWE R+++  +   P T +E+ E K ++D S+
Sbjct:  600 LHKSDSAYVPGFLQKKPDDQEQLKKVEIERNIRSILNKIAPQNFESCFSQLTTTCDIGSIQGLNACVDIIFDKATREKSYSSVFAEICKRLAFLKV-NFPEQSQENKQFIGFRSLLLKKCQEMFETPLKEQMEQKGAQWQEKIDAEEKEDKKKALEEERDEQMKKAKDQYYGNIRFIGELFMKDILTANIIHQCIVSQLKSDHSSKSMFTE---SLECLCELLKTVGKKLESENNAKARIDQYFERIKK----LINSKEIESKVRFRLQDIVEMRQRNWERREMEIRLHERPMTKEEL-EQKARQDESR 899          
BLAST of Eukaryotic translation initiation factor 4G vs. TrEMBL
Match: A0A1I8IB86 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 4.493e-43
Identity = 113/309 (36.57%), Postives = 180/309 (58.25%), Query Frame = 2
Query:  266 LIRTENGYLPPQLRKADEDKLQL----LKRNIKSILNKMTPENFEVCLNDLVNL-EIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARVGNY-----------SFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLL--------MFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKEDLSK 1120
            L ++++ Y+P  L+K  +D+ QL    ++RNI+SILNK+ P+NFE C + L    +I   + +   +D IF KA +E SYSS++A  C  ++  +V N+            F++LLLK CQ MF+ PL  Q+E+    W+ K   E+ E  K+  E + +EQ+KKAKD+Y+GNIRF  ELF+ + L+  II  C    L        MF++   SLE  C L++  GK+LE     +   D+ F R+      L  + +IE ++RF+L+D+V+MR+RNWE R+++  +   P T +E+ E K ++D S+
Sbjct:  589 LHKSDSAYVPGFLQKKPDDQEQLKKVEIERNIRSILNKIAPQNFESCFSQLTTTCDIGSIQGLNACVDIIFDKATREKSYSSVFAEICKRLAFLKV-NFPEQSQENKQFIGFRSLLLKKCQEMFETPLKEQMEQKGAQWQEKIDAEEKEDKKKALEEERDEQMKKAKDQYYGNIRFIGELFMKDILTANIIHQCIVSQLKSDHSSKSMFTE---SLECLCELLKTVGKKLESENNAKARIDQYFERIKK----LINSKEIESKVRFRLQDIVEMRQRNWERREMEIRLHERPMTKEEL-EQKARQDESR 888          
BLAST of Eukaryotic translation initiation factor 4G vs. TrEMBL
Match: A0A267EEF6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013413g1 PE=4 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 4.526e-43
Identity = 113/309 (36.57%), Postives = 180/309 (58.25%), Query Frame = 2
Query:  266 LIRTENGYLPPQLRKADEDKLQL----LKRNIKSILNKMTPENFEVCLNDLVNL-EIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARVGNY-----------SFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLL--------MFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKEDLSK 1120
            L ++++ Y+P  L+K  +D+ QL    ++RNI+SILNK+ P+NFE C + L    +I   + +   +D IF KA +E SYSS++A  C  ++  +V N+            F++LLLK CQ MF+ PL  Q+E+    W+ K   E+ E  K+  E + +EQ+KKAKD+Y+GNIRF  ELF+ + L+  II  C    L        MF++   SLE  C L++  GK+LE     +   D+ F R+      L  + +IE ++RF+L+D+V+MR+RNWE R+++  +   P T +E+ E K ++D S+
Sbjct:  600 LHKSDSAYVPGFLQKKPDDQEQLKKVEIERNIRSILNKIAPQNFESCFSQLTTTCDIGSIQGLNACVDIIFDKATREKSYSSVFAEICKRLAFLKV-NFPEQSQENKQFIGFRSLLLKKCQEMFETPLKEQMEQKGAQWQEKIDAEEKEDKKKALEEERDEQMKKAKDQYYGNIRFIGELFMKDILTANIIHQCIVSQLKSDHSSKSMFTE---SLECLCELLKTVGKKLESENNAKARIDQYFERIKK----LINSKEIESKVRFRLQDIVEMRQRNWERREMEIRLHERPMTKEEL-EQKARQDESR 899          
BLAST of Eukaryotic translation initiation factor 4G vs. TrEMBL
Match: A0A1I8G5C8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 4.526e-43
Identity = 113/309 (36.57%), Postives = 180/309 (58.25%), Query Frame = 2
Query:  266 LIRTENGYLPPQLRKADEDKLQL----LKRNIKSILNKMTPENFEVCLNDLVNL-EIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARVGNY-----------SFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLL--------MFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKEDLSK 1120
            L ++++ Y+P  L+K  +D+ QL    ++RNI+SILNK+ P+NFE C + L    +I   + +   +D IF KA +E SYSS++A  C  ++  +V N+            F++LLLK CQ MF+ PL  Q+E+    W+ K   E+ E  K+  E + +EQ+KKAKD+Y+GNIRF  ELF+ + L+  II  C    L        MF++   SLE  C L++  GK+LE     +   D+ F R+      L  + +IE ++RF+L+D+V+MR+RNWE R+++  +   P T +E+ E K ++D S+
Sbjct:  600 LHKSDSAYVPGFLQKKPDDQEQLKKVEIERNIRSILNKIAPQNFESCFSQLTTTCDIGSIQGLNACVDIIFDKATREKSYSSVFAEICKRLAFLKV-NFPEQSQENKQFIGFRSLLLKKCQEMFETPLKEQMEQKGAQWQEKIDAEEKEDKKKALEEERDEQMKKAKDQYYGNIRFIGELFMKDILTANIIHQCIVSQLKSDHSSKSMFTE---SLECLCELLKTVGKKLESENNAKARIDQYFERIKK----LINSKEIESKVRFRLQDIVEMRQRNWERREMEIRLHERPMTKEEL-EQKARQDESR 899          
BLAST of Eukaryotic translation initiation factor 4G vs. TrEMBL
Match: A0A1I8GD32 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 4.647e-43
Identity = 113/309 (36.57%), Postives = 180/309 (58.25%), Query Frame = 2
Query:  266 LIRTENGYLPPQLRKADEDKLQL----LKRNIKSILNKMTPENFEVCLNDLVNL-EIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARVGNY-----------SFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLL--------MFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKEDLSK 1120
            L ++++ Y+P  L+K  +D+ QL    ++RNI+SILNK+ P+NFE C + L    +I   + +   +D IF KA +E SYSS++A  C  ++  +V N+            F++LLLK CQ MF+ PL  Q+E+    W+ K   E+ E  K+  E + +EQ+KKAKD+Y+GNIRF  ELF+ + L+  II  C    L        MF++   SLE  C L++  GK+LE     +   D+ F R+      L  + +IE ++RF+L+D+V+MR+RNWE R+++  +   P T +E+ E K ++D S+
Sbjct:  600 LHKSDSAYVPGFLQKKPDDQEQLKKVEIERNIRSILNKIAPQNFESCFSQLTTTCDIGSIQGLNACVDIIFDKATREKSYSSVFAEICKRLAFLKV-NFPEQSQENKQFIGFRSLLLKKCQEMFETPLKEQMEQKGAQWQEKIDAEEKEDKKKALEEERDEQMKKAKDQYYGNIRFIGELFMKDILTANIIHQCIVSQLKSDHSSKSMFTE---SLECLCELLKTVGKKLESENNAKARIDQYFERIKK----LINSKEIESKVRFRLQDIVEMRQRNWERREMEIRLHERPMTKEEL-EQKARQDESR 899          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Cavefish
Match: eif4g3b (eukaryotic translation initiation factor 4 gamma 3 [Source:NCBI gene;Acc:103031287])

HSP 1 Score: 130.954 bits (328), Expect = 1.991e-30
Identity = 99/294 (33.67%), Postives = 148/294 (50.34%), Query Frame = 2
Query:  263 RLIRTENGYLPPQLRKADED-----KLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARV-------GNYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
            +L + EN + P   R A  D     K Q L R ++SILNK+TP+ F   +  + +L ID EE ++ +ID +F KAI E S+S  Y   CS ++  +V          +F+ LLL  CQ  F+K         K   E +AA+   ER +   E +  +   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +  K++ +   E K ++Q+E
Sbjct:  911 QLKKAENAWKPGMKRDAAIDDPENLKTQELFRKVRSILNKLTPQMFNQLMKQVTDLTIDTEERLKGVIDLVFEKAIDEPSFSVAYGNMCSCLATLKVPMADKPTSTVNFRKLLLNRCQKEFEKDKMDDDVFEKKQRELEAASSATERERLQEELEEAKD--KARRRSIGNIKFIGELFKLRMLTEAIMHDCVVKLLK-NHDEESLECLCRLLTTIGKDLD-FEKAKPRMDQYF----NQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSRRADQGPKTIEQIHKEAKIEEQEE 1196          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Cavefish
Match: eif4g3b (eukaryotic translation initiation factor 4 gamma 3 [Source:NCBI gene;Acc:103031287])

HSP 1 Score: 130.568 bits (327), Expect = 2.500e-30
Identity = 99/294 (33.67%), Postives = 148/294 (50.34%), Query Frame = 2
Query:  263 RLIRTENGYLPPQLRKADED-----KLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARV-------GNYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
            +L + EN + P   R A  D     K Q L R ++SILNK+TP+ F   +  + +L ID EE ++ +ID +F KAI E S+S  Y   CS ++  +V          +F+ LLL  CQ  F+K         K   E +AA+   ER +   E +  +   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +  K++ +   E K ++Q+E
Sbjct:  895 QLKKAENAWKPGMKRDAAIDDPENLKTQELFRKVRSILNKLTPQMFNQLMKQVTDLTIDTEERLKGVIDLVFEKAIDEPSFSVAYGNMCSCLATLKVPMADKPTSTVNFRKLLLNRCQKEFEKDKMDDDVFEKKQRELEAASSATERERLQEELEEAKD--KARRRSIGNIKFIGELFKLRMLTEAIMHDCVVKLLK-NHDEESLECLCRLLTTIGKDLD-FEKAKPRMDQYF----NQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSRRADQGPKTIEQIHKEAKIEEQEE 1180          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Cavefish
Match: eif4g3b (eukaryotic translation initiation factor 4 gamma 3 [Source:NCBI gene;Acc:103031287])

HSP 1 Score: 130.183 bits (326), Expect = 3.220e-30
Identity = 99/294 (33.67%), Postives = 148/294 (50.34%), Query Frame = 2
Query:  263 RLIRTENGYLPPQLRKADED-----KLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARV-------GNYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
            +L + EN + P   R A  D     K Q L R ++SILNK+TP+ F   +  + +L ID EE ++ +ID +F KAI E S+S  Y   CS ++  +V          +F+ LLL  CQ  F+K         K   E +AA+   ER +   E +  +   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +  K++ +   E K ++Q+E
Sbjct:  877 QLKKAENAWKPGMKRDAAIDDPENLKTQELFRKVRSILNKLTPQMFNQLMKQVTDLTIDTEERLKGVIDLVFEKAIDEPSFSVAYGNMCSCLATLKVPMADKPTSTVNFRKLLLNRCQKEFEKDKMDDDVFEKKQRELEAASSATERERLQEELEEAKD--KARRRSIGNIKFIGELFKLRMLTEAIMHDCVVKLLK-NHDEESLECLCRLLTTIGKDLD-FEKAKPRMDQYF----NQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSRRADQGPKTIEQIHKEAKIEEQEE 1162          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Cavefish
Match: eif4g3b (eukaryotic translation initiation factor 4 gamma 3 [Source:NCBI gene;Acc:103031287])

HSP 1 Score: 129.413 bits (324), Expect = 5.734e-30
Identity = 99/294 (33.67%), Postives = 148/294 (50.34%), Query Frame = 2
Query:  263 RLIRTENGYLPPQLRKADED-----KLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARV-------GNYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
            +L + EN + P   R A  D     K Q L R ++SILNK+TP+ F   +  + +L ID EE ++ +ID +F KAI E S+S  Y   CS ++  +V          +F+ LLL  CQ  F+K         K   E +AA+   ER +   E +  +   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +  K++ +   E K ++Q+E
Sbjct:  852 QLKKAENAWKPGMKRDAAIDDPENLKTQELFRKVRSILNKLTPQMFNQLMKQVTDLTIDTEERLKGVIDLVFEKAIDEPSFSVAYGNMCSCLATLKVPMADKPTSTVNFRKLLLNRCQKEFEKDKMDDDVFEKKQRELEAASSATERERLQEELEEAKD--KARRRSIGNIKFIGELFKLRMLTEAIMHDCVVKLLK-NHDEESLECLCRLLTTIGKDLD-FEKAKPRMDQYF----NQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSRRADQGPKTIEQIHKEAKIEEQEE 1137          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Cavefish
Match: EIF4G1 (eukaryotic translation initiation factor 4 gamma 1 [Source:NCBI gene;Acc:103035001])

HSP 1 Score: 129.028 bits (323), Expect = 7.355e-30
Identity = 96/289 (33.22%), Postives = 149/289 (51.56%), Query Frame = 2
Query:  296 PQLRKA----DED----KLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARVG-------NYSFKALLLKSCQTMF--DKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKED 1111
            P L++A    D+D    + Q L R ++SILNK+TP+ F+  +  +  L ID EE ++ +ID IF KAI E ++S  YA  C  +   +V          +F+ LLL  CQ  F  DK      E+ +   +A    E+ +R+K     ++EE   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    +Q   + K      R+RF L+DV+D+R  NW  R   +     PKT+++I ++ + E+
Sbjct:  910 PTLKRAGRAEDDDPETIRTQELFRRVRSILNKLTPQMFQSLMKQVTELTIDTEERLKGVIDLIFEKAISEPNFSVAYANMCRCLLGLKVPTTDKPGVTVNFRKLLLNRCQKEFEKDKDDDEIFEKKQKELDAATVGEEKQRLKE----ELEEAKDKARRRSLGNIKFIGELFKLKMLTENIMHDCIVKLLK-NHDEESLECLCRLLSTIGKDLD-FEKAKPRMDQYF----HQMEKIIKERKTSSRIRFMLQDVIDLRRCNWVPRRGDQG----PKTIEQIHKEAELEE 1184          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Sea Lamprey
Match: eif4g2a (eukaryotic translation initiation factor 4, gamma 2a [Source:ZFIN;Acc:ZDB-GENE-030131-2173])

HSP 1 Score: 88.1965 bits (217), Expect = 4.336e-18
Identity = 88/288 (30.56%), Postives = 143/288 (49.65%), Query Frame = 2
Query:  311 ADEDKLQLLKRNIKSILNKMTPENFE-VCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCS--------------EMSNARVGNYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLL-----MFSKD-NNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMK-SVPKTLDEIKEDKQKE 1108
            A  D+ + + R ++ ILNK+TPE F+ +CL +L+N+ ID +  ++ +I  IF KA++E  YSS+Y++ C               E       N SF+ LL+   Q  F+     + ++++ F         D R   L   + +EQ   AK K  GNI+F  EL   + L   I+  C + LL     +  KD    LE  C++M   G +L+  +K R+  D+ F R+ +    L  N D+  R+RF L+D V++R   W  R   KA   + PK + +I++D  K+
Sbjct:   63 ATPDRNEAIFRKVRGILNKLTPEKFDKLCL-ELLNVGIDSKLILKGIILLIFEKALEEPKYSSLYSQLCQRLAEDAPNFDGPPLEGPGRHKHNSSFRRLLIAKLQDEFEN----RTKKLEGF---------DNRDSPLSPEE-DEQRTIAKLKMLGNIKFIGELGKLDLLHESILHRCIKTLLEKKKRVALKDMAEDLECLCQIMRTVGPRLDH-DKARSLMDQYFLRMQS----LMANKDLPARIRFLLQDTVELRLNKWVPR---KAFSDNGPKPISQIRQDAIKD 327          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Yeast
Match: TIF4631 (Translation initiation factor eIF4G; subunit of the mRNA cap-binding protein complex (eIF4F) that also contains eIF4E (Cdc33p); interacts with Pab1p and with eIF4A (Tif1p); also has a role in biogenesis of the large ribosomal subunit; TIF4631 has a paralog, TIF4632, that arose from the whole genome duplication [Source:SGD;Acc:S000003394])

HSP 1 Score: 70.8626 bits (172), Expect = 6.783e-13
Identity = 75/297 (25.25%), Postives = 132/297 (44.44%), Query Frame = 2
Query:  311 ADEDKLQLL-----KRNIKSILNKMTPENFEVCLNDL---VNLEIDEE--ENMRCLIDEIFSKAIQEVSYSSIYARFCS------------EMSNARVGNYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAK-AANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERL---LMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNV----DIEQRLRFKLKDVVDMR-ERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
            A + K +LL     +R +KS+LNK+T E F+   +++    N+ + E   E ++ +I++IF KA  E  +SS+YA+ C             E +  + G       L+  C   FDK            W  K   NE    ++    S+       AK +  G +RF   L+  N L+ K++  C  RL   L  S    +LE+   L+   G+Q E             S++++    +  N+     I  R++FKL D+ ++R ++NW          + PKT+ +I E+++++
Sbjct:  593 APDGKTELLDKDEVERKMKSLLNKLTLEMFDAISSEILAIANISVWETNGETLKAVIEQIFLKACDEPHWSSMYAQLCGKVVKELNPDITDETNEGKTGPKLVLHYLVARCHAEFDK-----------GWTDKLPTNEDGTPLEPEMMSEEYYAAASAKRRGLGLVRFIGFLYRLNLLTGKMMFECFRRLMKDLTDSPSEETLESVVELLNTVGEQFETDSFRTGQATLEGSQLLDSLFGILDNIIQTAKISSRIKFKLIDIKELRHDKNWN----SDKKDNGPKTIQQIHEEEERQ 874          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Yeast
Match: TIF4632 (Translation initiation factor eIF4G; subunit of the mRNA cap-binding protein complex (eIF4F) that also contains eIF4E (Cdc33p); associates with the poly(A)-binding protein Pab1p, also interacts with eIF4A (Tif1p); TIF4632 has a paralog, TIF4631, that arose from the whole genome duplication [Source:SGD;Acc:S000003017])

HSP 1 Score: 68.9366 bits (167), Expect = 2.276e-12
Identity = 86/315 (27.30%), Postives = 151/315 (47.94%), Query Frame = 2
Query:  266 LIRTENGYLPPQLRKADEDKL-----------QLLKRNIKSILNKMTPENFEVCLNDLVNLEI-----DEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARVGNYSFKALLLKSCQTMFDKPLHLQL----EEVKTFWEAK-AANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKD-NN-----SLEAACRLMEICGKQLEK---LEKERTNGDKGFSRVMNQFVVLSKNVD---IEQRLRFKLKDVVDMRE-RNWELRDIQKAMKSV-PKTLDEIKEDKQK 1105
            L+ + N ++P    K  E KL           + ++R +KS+LNK+T E F+   ++++++       D+ E ++ +I++IF KA  E  +SS+YA+ C ++      N   K    K+   +    LH  +    EE +  W  K  A E    ++    SD       AK +  G +RF   L+  N L+ K++  C  RL+   KD NN     +LE+   L+   G+Q E    +  + T   +G   + N F++L   +D   I  R++FKL DV ++RE ++W       A K   PKT+ +I +++++
Sbjct:  532 LVPSANRWIPKSRVKKTEKKLAPDGKTELFDKEEVERKMKSLLNKLTLEMFDSISSEILDIANQSKWEDDGETLKIVIEQIFHKACDEPHWSSMYAQLCGKVVKDLDPNIKDKENEGKNGPKLV---LHYLVARCHEEFEKGWADKLPAGEDGNPLEPEMMSDEYYIAAAAKRRGLGLVRFIGYLYCLNLLTGKMMFECFRRLM---KDLNNDPSEETLESVIELLNTVGEQFEHDKFVTPQAT--LEGSVLLDNLFMLLQHIIDGGTISNRIKFKLIDVKELREIKHW-----NSAKKDAGPKTIQQIHQEEEQ 833          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Nematostella
Match: EDO33172 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST03])

HSP 1 Score: 110.153 bits (274), Expect = 1.012e-24
Identity = 85/267 (31.84%), Postives = 141/267 (52.81%), Query Frame = 2
Query:  341 RNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARV--GNYS--FKALLLKSCQTMFDKP------LHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKED 1111
            R  + ILNK+TP+ F+     ++ LEID  E +  +ID IF KAI E  +S  YA  C  +   +V  GN    F+ +LL  CQ  F+K       +H +++++      +  +E+D ++K+   +++EE+    K +  GNIRF  ELF    L+  I+  C  +L+  S D  SLE  C+L+   GK L+  E  +   D+ FS+ M++ +   K      R+RF L+D+ D+R  NW    + +   + PKT+D+I ++   E+
Sbjct:    4 RKFRGILNKLTPQKFKKLTEQVMELEIDTSEKLEGIIDIIFEKAISEPGFSVAYANLCRCLLPIKVSTGNKELVFRTILLNKCQKEFEKEKTDENRIHEKIDQLVN----EGLSEEDYKIKK---AELEEEEMFGKRRTLGNIRFIGELFKLKILTENIMHTCVMKLIK-SMDEESLECFCKLLSTIGKDLDH-EVAKPRMDQYFSQ-MDKIIASKKT---SSRVRFMLQDLRDLRLSNW----VPRRDDNNPKTIDQIHKEAADEE 253          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Nematostella
Match: EDO32341 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVB3])

HSP 1 Score: 97.8265 bits (242), Expect = 7.860e-23
Identity = 77/248 (31.05%), Postives = 118/248 (47.58%), Query Frame = 2
Query:  341 RNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARVG----NYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERM----------KRLYESDIEEQVKKAKDKYFGNIRFFSELF-LSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQR---LRFKLKDVVDMRERNW 1030
            R  + ILNK+TP+NF+  +  ++NLEID  E +  +ID +F KAI+E  Y  +YA  C  +   +V        FK +LL  CQ  FDK            +E K  N  D+ +          K+ + S+ EE     + +  GNI F  ELF L   L+  I+  C  +L+  + D+ SLE  C L+   GK L+         D    R+   F   +K +D ++    +RF ++D+ D+R  NW
Sbjct:    4 RKFRGILNKITPQNFKKLVEQVMNLEIDTAEKLEGIIDIVFEKAIREPRYCVVYANLCHCLLPIKVSFENKELVFKTILLNKCQKKFDKT-----------YEHKTHNNTDQLVNEGLSPMFSRKKKHPSEQEEYEMWERRRTLGNIIFIGELFILKKILTENIMHTCVWKLINRT-DDESLECLCELLSTVGKDLDH--------DIAKPRMDQYFRQFNKIIDSKKTSSCVRFMIQDLRDLRLSNW 231          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Nematostella
Match: EDO31711 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX49])

HSP 1 Score: 98.5969 bits (244), Expect = 4.624e-21
Identity = 73/273 (26.74%), Postives = 140/273 (51.28%), Query Frame = 2
Query:  320 DKLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSN--------ARVGNYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLL------MFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKED 1096
            D+ +L+ R ++ ILNK+TP+ F+    +L+++ ++ +  ++ +I  +F KA+ E +YSS+YA+ C  +S          + GN +F+ LLLK C+  F+               +KA+   D++     E   EE+    K K  GNIRF  EL   + L   I+  C ++LL        +  +  +E  C LM+  G +++   K +   D+ F R+   + + S++ D+  R+RF L+ + ++R   W  R + + +   PK +++I+++
Sbjct:   63 DENELVFRRVRGILNKLTPDKFDKLFYELLHVGVETKYILKGVILLVFEKALDEPAYSSMYAQLCLRLSEEAPNFDDPGKTGNSTFRRLLLKQCEEEFNN-------------RSKASQAFDKKDDLTQEE--EEERGSTKRKMLGNIRFIGELAKLDMLHETILHKCIKQLLDKKKRASVADTSEDMECLCHLMKTVGSRIDG-PKAKPLVDQYFERI---YQIRSRS-DLPSRIRFMLEGIEELRTNKWIPRKVARDVG--PKPINQIRQE 313          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Medaka
Match: eif4g3a (eukaryotic translation initiation factor 4 gamma 3 [Source:NCBI gene;Acc:105354159])

HSP 1 Score: 129.028 bits (323), Expect = 8.357e-30
Identity = 93/298 (31.21%), Postives = 147/298 (49.33%), Query Frame = 2
Query:  263 RLIRTENGYLPPQLRKA-----DEDKLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCS-------EMSNARVGNYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDK----YFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
            +L + EN + P   R+      +  + Q L R ++SILNK+TP+ F   +  + +L ID EE ++ +ID +F KAI E  +S  Y   C        +M++      +F+ LLL  CQ  F+K      ++V      +   E D          ++E++++AKDK      GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +  K++ +   E K ++Q+E
Sbjct:  872 QLKKAENAWKPGMKRETLPEDPEAQRTQELFRRVRSILNKLTPQKFNQLMKQVTDLTIDTEERLKGVIDLVFEKAIDEPGFSVAYGNMCRCLATLKVQMTDKPNSTVNFRKLLLNRCQKEFEK------DKVDDVVFERKQKELDSAASTTERERLQEELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLK-NHDEESLECLCRLLTTIGKDLD-FEKAKPRMDQYF----NQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSRRADQGPKTIEQIHKEAKIEEQEE 1157          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Medaka
Match: eif4g3a (eukaryotic translation initiation factor 4 gamma 3 [Source:NCBI gene;Acc:105354159])

HSP 1 Score: 128.642 bits (322), Expect = 1.061e-29
Identity = 93/298 (31.21%), Postives = 147/298 (49.33%), Query Frame = 2
Query:  263 RLIRTENGYLPPQLRKA-----DEDKLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCS-------EMSNARVGNYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDK----YFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
            +L + EN + P   R+      +  + Q L R ++SILNK+TP+ F   +  + +L ID EE ++ +ID +F KAI E  +S  Y   C        +M++      +F+ LLL  CQ  F+K      ++V      +   E D          ++E++++AKDK      GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +  K++ +   E K ++Q+E
Sbjct:  865 QLKKAENAWKPGMKRETLPEDPEAQRTQELFRRVRSILNKLTPQKFNQLMKQVTDLTIDTEERLKGVIDLVFEKAIDEPGFSVAYGNMCRCLATLKVQMTDKPNSTVNFRKLLLNRCQKEFEK------DKVDDVVFERKQKELDSAASTTERERLQEELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLK-NHDEESLECLCRLLTTIGKDLD-FEKAKPRMDQYF----NQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSRRADQGPKTIEQIHKEAKIEEQEE 1150          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Medaka
Match: EIF4G1 (eukaryotic translation initiation factor 4 gamma 1 [Source:NCBI gene;Acc:101158873])

HSP 1 Score: 122.865 bits (307), Expect = 5.518e-28
Identity = 95/271 (35.06%), Postives = 144/271 (53.14%), Query Frame = 2
Query:  323 KLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARV-------GNYSFKALLLKSCQTMFDKPLHLQLEEV--KTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
            K Q L + ++SILNK+TP+ F+  +  ++ L ID EE ++ +ID  F KAI E  +S  YA  C  +S  +V          +F+ LLL  CQ  F+K      +E+  K   E  AA+  +E+ +RL E ++E+   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +     PKT+D+I ++ + E
Sbjct:  844 KTQELFKRVRSILNKLTPQKFQQLMKQVMELTIDTEERLKGVIDLTFEKAISEPDFSVAYANMCRCLSGLKVQTTDKPGATANFRKLLLNRCQKEFEK--DKDDDEIFEKKQKELDAASGGEEK-QRLTE-ELEDAKDKARRRSLGNIKFIGELFKLKMLTEVIMHDCIVKLLK-NHDEESLECLCRLLSTIGKDLD-FEKAKPRMDQYF----NQMEKIIKERKTTSRIRFMLQDVLDLRRNNWVPRRGDQG----PKTIDQIHKEAELE 1100          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Medaka
Match: EIF4G1 (eukaryotic translation initiation factor 4 gamma 1 [Source:NCBI gene;Acc:101158873])

HSP 1 Score: 122.865 bits (307), Expect = 5.994e-28
Identity = 95/271 (35.06%), Postives = 144/271 (53.14%), Query Frame = 2
Query:  323 KLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARV-------GNYSFKALLLKSCQTMFDKPLHLQLEEV--KTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
            K Q L + ++SILNK+TP+ F+  +  ++ L ID EE ++ +ID  F KAI E  +S  YA  C  +S  +V          +F+ LLL  CQ  F+K      +E+  K   E  AA+  +E+ +RL E ++E+   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +     PKT+D+I ++ + E
Sbjct:  833 KTQELFKRVRSILNKLTPQKFQQLMKQVMELTIDTEERLKGVIDLTFEKAISEPDFSVAYANMCRCLSGLKVQTTDKPGATANFRKLLLNRCQKEFEK--DKDDDEIFEKKQKELDAASGGEEK-QRLTE-ELEDAKDKARRRSLGNIKFIGELFKLKMLTEVIMHDCIVKLLK-NHDEESLECLCRLLSTIGKDLD-FEKAKPRMDQYF----NQMEKIIKERKTTSRIRFMLQDVLDLRRNNWVPRRGDQG----PKTIDQIHKEAELE 1089          
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Medaka
Match: EIF4G1 (eukaryotic translation initiation factor 4 gamma 1 [Source:NCBI gene;Acc:101158873])

HSP 1 Score: 122.865 bits (307), Expect = 5.994e-28
Identity = 95/271 (35.06%), Postives = 144/271 (53.14%), Query Frame = 2
Query:  323 KLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARV-------GNYSFKALLLKSCQTMFDKPLHLQLEEV--KTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKE 1108
            K Q L + ++SILNK+TP+ F+  +  ++ L ID EE ++ +ID  F KAI E  +S  YA  C  +S  +V          +F+ LLL  CQ  F+K      +E+  K   E  AA+  +E+ +RL E ++E+   KA+ +  GNI+F  ELF    L+  I+  C  +LL  + D  SLE  CRL+   GK L+  EK +   D+ F    NQ   + K      R+RF L+DV+D+R  NW  R   +     PKT+D+I ++ + E
Sbjct:  833 KTQELFKRVRSILNKLTPQKFQQLMKQVMELTIDTEERLKGVIDLTFEKAISEPDFSVAYANMCRCLSGLKVQTTDKPGATANFRKLLLNRCQKEFEK--DKDDDEIFEKKQKELDAASGGEEK-QRLTE-ELEDAKDKARRRSLGNIKFIGELFKLKMLTEVIMHDCIVKLLK-NHDEESLECLCRLLSTIGKDLD-FEKAKPRMDQYF----NQMEKIIKERKTTSRIRFMLQDVLDLRRNNWVPRRGDQG----PKTIDQIHKEAELE 1089          
BLAST of Eukaryotic translation initiation factor 4G vs. Planmine SMEST
Match: SMESG000045255.1 (SMESG000045255.1)

HSP 1 Score: 779.245 bits (2011), Expect = 0.000e+0
Identity = 375/375 (100.00%), Postives = 375/375 (100.00%), Query Frame = 2
Query:    2 TKTEMRDMKMVESEMGRLTYYRDNLLALRGCQTLPDQLFLDPVLLEIITAKMQLINFLKKKEIFVPVKPSRTDYLDFTRRHYNIRPKRLIRTENGYLPPQLRKADEDKLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARVGNYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKEDLSKIK 1126
            TKTEMRDMKMVESEMGRLTYYRDNLLALRGCQTLPDQLFLDPVLLEIITAKMQLINFLKKKEIFVPVKPSRTDYLDFTRRHYNIRPKRLIRTENGYLPPQLRKADEDKLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARVGNYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKEDLSKIK
Sbjct:  923 TKTEMRDMKMVESEMGRLTYYRDNLLALRGCQTLPDQLFLDPVLLEIITAKMQLINFLKKKEIFVPVKPSRTDYLDFTRRHYNIRPKRLIRTENGYLPPQLRKADEDKLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLIDEIFSKAIQEVSYSSIYARFCSEMSNARVGNYSFKALLLKSCQTMFDKPLHLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFSELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKERTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQKAMKSVPKTLDEIKEDKQKEDLSKIK 1297          
BLAST of Eukaryotic translation initiation factor 4G vs. Planmine SMEST
Match: SMESG000060487.1 (SMESG000060487.1)

HSP 1 Score: 646.736 bits (1667), Expect = 0.000e+0
Identity = 306/313 (97.76%), Postives = 308/313 (98.40%), Query Frame = 3
Query: 1365 MKIEFRGKEYHSTLSELCGCVTCKYKIIDLRVVITDRINIQCNEQPNKICSYSNQKFINTAYPIMKMSGKFQVILWLVNTPSHGQHYPNPAQLGGCIHEISFNGKPLQMEIFGKAISTKCPKVCANDVCNAGVCNETYDREPFCDCTDSFLNGPYCNSSGSDGMDPNWKYPFETFRSKFIKISWQNHSGFIFGIGNMNTSLNVHSTRHCLYLLYHSRMEKFFINKTITDKYHPDQISRLYFTLGENIIIKFVQLNYTIFTNSPVPRDLSKEDFTSISLLSSPGFIDIVHKLRPSQYQWLPFPSKFFVNQTDRS 2303
            MKIEFRGKEYHSTLSELCGCVTCKYKIIDLRVVITDRINIQCNEQPNKICSYSNQKFINTAYPIMKMSGKFQVILWLVNTPSHGQHYPNPAQLGGCIHEISFNGKPLQMEIFGKAISTKCPKVCANDVCNAGVCNETYDREPFCDCTDSFLNGPYCNSSGSDGMDPNWKYPFETFRSKFIKISWQNHSGFIFGIGNMNTSLNVHSTRHCLYLLYHSRMEKFFINKTITDKYHPDQISRLYFTLGENIIIKFVQLNYTIFTNSPVPRDLSKEDFTSIS+LS PGFIDIVHKLRPSQYQWLPF  KFFV +TD S
Sbjct:    1 MKIEFRGKEYHSTLSELCGCVTCKYKIIDLRVVITDRINIQCNEQPNKICSYSNQKFINTAYPIMKMSGKFQVILWLVNTPSHGQHYPNPAQLGGCIHEISFNGKPLQMEIFGKAISTKCPKVCANDVCNAGVCNETYDREPFCDCTDSFLNGPYCNSSGSDGMDPNWKYPFETFRSKFIKISWQNHSGFIFGIGNMNTSLNVHSTRHCLYLLYHSRMEKFFINKTITDKYHPDQISRLYFTLGENIIIKFVQLNYTIFTNSPVPRDLSKEDFTSISVLSGPGFIDIVHKLRPSQYQWLPFHRKFFVIKTDLS 313          
BLAST of Eukaryotic translation initiation factor 4G vs. Planmine SMEST
Match: SMESG000060487.1 (SMESG000060487.1)

HSP 1 Score: 642.114 bits (1655), Expect = 0.000e+0
Identity = 302/306 (98.69%), Postives = 303/306 (99.02%), Query Frame = 3
Query: 1365 MKIEFRGKEYHSTLSELCGCVTCKYKIIDLRVVITDRINIQCNEQPNKICSYSNQKFINTAYPIMKMSGKFQVILWLVNTPSHGQHYPNPAQLGGCIHEISFNGKPLQMEIFGKAISTKCPKVCANDVCNAGVCNETYDREPFCDCTDSFLNGPYCNSSGSDGMDPNWKYPFETFRSKFIKISWQNHSGFIFGIGNMNTSLNVHSTRHCLYLLYHSRMEKFFINKTITDKYHPDQISRLYFTLGENIIIKFVQLNYTIFTNSPVPRDLSKEDFTSISLLSSPGFIDIVHKLRPSQYQWLPFPSKFF 2282
            MKIEFRGKEYHSTLSELCGCVTCKYKIIDLRVVITDRINIQCNEQPNKICSYSNQKFINTAYPIMKMSGKFQVILWLVNTPSHGQHYPNPAQLGGCIHEISFNGKPLQMEIFGKAISTKCPKVCANDVCNAGVCNETYDREPFCDCTDSFLNGPYCNSSGSDGMDPNWKYPFETFRSKFIKISWQNHSGFIFGIGNMNTSLNVHSTRHCLYLLYHSRMEKFFINKTITDKYHPDQISRLYFTLGENIIIKFVQLNYTIFTNSPVPRDLSKEDFTSIS+LS PGFIDIVHKLRPSQYQWLPF  KFF
Sbjct:    1 MKIEFRGKEYHSTLSELCGCVTCKYKIIDLRVVITDRINIQCNEQPNKICSYSNQKFINTAYPIMKMSGKFQVILWLVNTPSHGQHYPNPAQLGGCIHEISFNGKPLQMEIFGKAISTKCPKVCANDVCNAGVCNETYDREPFCDCTDSFLNGPYCNSSGSDGMDPNWKYPFETFRSKFIKISWQNHSGFIFGIGNMNTSLNVHSTRHCLYLLYHSRMEKFFINKTITDKYHPDQISRLYFTLGENIIIKFVQLNYTIFTNSPVPRDLSKEDFTSISVLSGPGFIDIVHKLRPSQYQWLPFHRKFF 306          
BLAST of Eukaryotic translation initiation factor 4G vs. Planmine SMEST
Match: SMESG000060566.1 (SMESG000060566.1)

HSP 1 Score: 603.208 bits (1554), Expect = 0.000e+0
Identity = 344/492 (69.92%), Postives = 377/492 (76.63%), Query Frame = 3
Query: 1164 QSISAENHIKQSHGDSYLYNEIKYVNETNYQIKLKITLNKIEGTLLYLFDKYDNQFIISLSDDLEERMKIEFRGKEYHSTLSELCGCVTCKYKIIDLRVVITDRINIQCNEQPNKICSYSNQKFINT----------------AYPIMKMSGKFQVILWLVNTPSHGQHYPNPAQLGGCIHEISFNGKPLQMEIFGKAISTKCPKVCANDVCNAGVCNETYDREPFCDCTDSFLNGPYCNSSGSDGMDPNWKYPFETFRSKFIKISWQNHSGFIFGIGNMNTSLNVHSTRHCLYLLYHSRMEKFFINKTITDKYHPDQISRLYFTLGENII-IKFVQLNYTIFTNSPVPRDLSKEDFTSISLLSSPGFIDIVHKLRPSQYQWLPFPSKFFVNQTDRSAIPKKTSIVFQTPQDXXXXXXXXXXDXXXXXXXXXXXXXXXXXXXXXVKYFRNKNEMKHDKPDLSTSNLLENLKDKESISKRSFSKSCNFDCFYT 2588
            Q I  E HI      SYL   I    E + QI+ K+TLN++EGTLLY++DKYDNQ IISLSDDLEERMKIEFRGKE+H TL ELCGC+ C+Y++I+L V ITDRINIQCN QP KI SYSNQK IN                  YPI+      Q  LWLVNTP+HG  YPNP+QL GCIH++  NG P +ME  G  IST+CPK C NDVCNAGVC+ETYDR+PFCDCTDSFLNGP+CNSS    MD N KY   TFRSK IKISW+ HS  I GI     SL +   R+ LYLLY  ++   FI KTIT+KY P+Q   +Y +   N I IKFVQ N TI T  PVP+DLSKEDFTSISLLSSPGFIDIVHKLRPSQYQWLPFPSKFFVNQTDRSAIPKKTSIV QTPQDSKRKRLSSSRDIAIGILSFLLLIFIILAAVFAVKYFRNKNEMKHDKPDLSTSNLLENLKDKESISKRSFSKSCNFDCFYT
Sbjct:   24 QLIYTEYHISSKESPSYLTRGIPERYEKHNQIEFKMTLNRMEGTLLYMYDKYDNQLIISLSDDLEERMKIEFRGKEHHLTLYELCGCIRCRYRLIELTVSITDRINIQCNNQPYKIFSYSNQKLINNENKAFVVHLLWDSAVCTYPIVMTFENSQARLWLVNTPAHGYFYPNPSQLAGCIHDVIINGVPSEMERCGIEISTECPKACVNDVCNAGVCHETYDRDPFCDCTDSFLNGPFCNSSSITQMDSNKKYHSNTFRSKLIKISWRAHSDDILGIWKEKISLKIQVKRNHLYLLYEEKI--LFIKKTITNKYQPNQNDCVYLSFDANFIEIKFVQNNSTIITKLPVPKDLSKEDFTSISLLSSPGFIDIVHKLRPSQYQWLPFPSKFFVNQTDRSAIPKKTSIVLQTPQDSKRKRLSSSRDIAIGILSFLLLIFIILAAVFAVKYFRNKNEMKHDKPDLSTSNLLENLKDKESISKRSFSKSCNFDCFYT 513          
BLAST of Eukaryotic translation initiation factor 4G vs. Planmine SMEST
Match: SMESG000060556.1 (SMESG000060556.1)

HSP 1 Score: 584.719 bits (1506), Expect = 0.000e+0
Identity = 329/480 (68.54%), Postives = 365/480 (76.04%), Query Frame = 3
Query: 1164 QSISAENHIKQSHGDSYLYNEIKYVNETNYQIKLKITLNKIEGTLLYLFDKYDNQFIISLSDDLEERMKIEFRGKEYHSTLSELCGCVTCKYKIIDLRVVITDRINIQCNEQPNKICSYSNQKFINTAYPIMKMSGKFQVILWLVNTPSHGQHYPNPAQLGGCIHEISFNGKPLQMEIFGKAISTKCPKVCANDVCNAGVCNETYDREPFCDCTDSFLNGPYCNSSGSDGMDPNWKYPFETFRSKFIKISWQNHSGFIFGIGNMNTSLNVHSTRHCLYLLYHSRMEKF-FINKTITDKYHPDQISRLYFTLGENII-IKFVQLNYTIFTNSPVPRDLSKEDFTSISLLSSPGFIDIVHKLRPSQYQWLPFPSKFFVNQTDRSAIPKKTSIVFQTPQ-DXXXXXXXXXXDXXXXXXXXXXXXXXXXXXXXXVKYFRNKNEMKHDKPDLSTSNLLENLKDKESISKRSFSKSCNFDCFYT*D 2594
            Q I AE HI      SYL   I    E + Q + K+TLN++EGTLLY++DKYDNQ IISLSDDLEERMKIEFRGKE+H TL ELCGCV C+Y++IDL V ITDRINIQCN QP KI SYSNQK IN AYPI+      Q  LWLVNTP+HG  YPNP+QL GCIH++  NG P +ME  G  IST+CPK C NDVCNAGVC+ETYDREPFCDCTDSFLNGP+CNSS    MD N KY   TFRSK IK SW+ HS  I GI     SL +   R+ LY LY    EKF FI KTIT+KY P+Q   +Y +   N I IKFVQ + TI T  PVP+DLSKEDFTSISLLSSPGFIDIVHKLRPSQYQWLPFPSKFFVNQTDRSAIPKKTS+V QTPQ   ++   S SR+I IGILSFLLLIFIILAAV+AVK FR +NEMKH KPDLSTSNLLENLKDKESISKRSFSKSCNFD   + D
Sbjct:   24 QLIYAEYHISSKESLSYLTRGIPERYEIHNQFEFKMTLNRMEGTLLYMYDKYDNQLIISLSDDLEERMKIEFRGKEHHLTLYELCGCVRCRYRLIDLTVSITDRINIQCNNQPYKIFSYSNQKLINNAYPIVMTFENSQAKLWLVNTPAHGYFYPNPSQLAGCIHDVIINGVPSEMERSGIEISTECPKACVNDVCNAGVCHETYDREPFCDCTDSFLNGPFCNSSSITQMDSNRKYHSNTFRSKLIKTSWRAHSDDILGIWKEKISLKIQVKRNHLYFLYE---EKFLFIKKTITNKYQPNQNDCVYLSFDTNFIGIKFVQNDSTIITKLPVPKDLSKEDFTSISLLSSPGFIDIVHKLRPSQYQWLPFPSKFFVNQTDRSAIPKKTSMVLQTPQYSKRKDSGSISREIVIGILSFLLLIFIILAAVYAVKIFRKRNEMKHHKPDLSTSNLLENLKDKESISKRSFSKSCNFDSLQSYD 500          
The following BLAST results are available for this feature:
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EIF4G31.441e-3034.35eukaryotic translation initiation factor 4 gamma 3... [more]
EIF4G32.144e-3034.35eukaryotic translation initiation factor 4 gamma 3... [more]
EIF4G32.281e-3034.35eukaryotic translation initiation factor 4 gamma 3... [more]
EIF4G32.284e-3034.35eukaryotic translation initiation factor 4 gamma 3... [more]
EIF4G32.785e-3034.46eukaryotic translation initiation factor 4 gamma 3... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ifg-16.458e-923.08Initiation Factor 4G (eIF4G) family [Source:UniPr... [more]
ifg-16.512e-923.08Initiation Factor 4G (eIF4G) family [Source:UniPr... [more]
ifg-16.658e-923.36Initiation Factor 4G (eIF4G) family [Source:UniPr... [more]
ifg-16.658e-923.36Initiation Factor 4G (eIF4G) family [Source:UniPr... [more]
ifg-16.658e-923.36Initiation Factor 4G (eIF4G) family [Source:UniPr... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eIF4G11.029e-2227.02gene:FBgn0023213 transcript:FBtr0112904[more]
eIF4G22.756e-2227.06gene:FBgn0260634 transcript:FBtr0089623[more]
eIF4G22.756e-2227.06gene:FBgn0260634 transcript:FBtr0344335[more]
eIF4G12.358e-2027.55gene:FBgn0023213 transcript:FBtr0289951[more]
eIF4G12.358e-2027.55gene:FBgn0023213 transcript:FBtr0089243[more]
back to top
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4g3a4.708e-3232.77eukaryotic translation initiation factor 4 gamma, ... [more]
CABZ01085052.12.693e-2933.56pep scaffold:GRCz11:KN150670.1:733:23795:-1 gene:E... [more]
eif4g3a5.740e-2929.06eukaryotic translation initiation factor 4 gamma, ... [more]
eif4g3a6.192e-2929.06eukaryotic translation initiation factor 4 gamma, ... [more]
eif4g1a5.395e-2833.94eukaryotic translation initiation factor 4 gamma, ... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4g39.306e-3029.85eukaryotic translation initiation factor 4 gamma, ... [more]
eif4g31.349e-2829.13eukaryotic translation initiation factor 4 gamma, ... [more]
eif4g31.377e-2829.13eukaryotic translation initiation factor 4 gamma, ... [more]
eif4g31.467e-2829.13eukaryotic translation initiation factor 4 gamma, ... [more]
eif4g31.499e-2829.13eukaryotic translation initiation factor 4 gamma, ... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eif4g38.381e-3335.15eukaryotic translation initiation factor 4 gamma, ... [more]
Eif4g31.445e-3035.03eukaryotic translation initiation factor 4 gamma, ... [more]
Eif4g32.896e-3034.35eukaryotic translation initiation factor 4 gamma, ... [more]
Eif4g33.155e-3034.35eukaryotic translation initiation factor 4 gamma, ... [more]
Eif4g33.638e-3034.35eukaryotic translation initiation factor 4 gamma, ... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4G vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O43432|IF4G3_HUMAN1.030e-2934.35Eukaryotic translation initiation factor 4 gamma 3... [more]
sp|Q80XI3|IF4G3_MOUSE2.061e-2934.35Eukaryotic translation initiation factor 4 gamma 3... [more]
sp|Q04637|IF4G1_HUMAN1.152e-2735.48Eukaryotic translation initiation factor 4 gamma 1... [more]
sp|Q6NZJ6|IF4G1_MOUSE2.047e-2735.13Eukaryotic translation initiation factor 4 gamma 1... [more]
sp|B9FXV5|IF4G_ORYSJ8.480e-2729.51Eukaryotic translation initiation factor 4G OS=Ory... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4G vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267HB464.330e-4336.57Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IB864.493e-4336.57Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EEF64.526e-4336.57Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8G5C84.526e-4336.57Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GD324.647e-4336.57Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4g3b1.991e-3033.67eukaryotic translation initiation factor 4 gamma 3... [more]
eif4g3b2.500e-3033.67eukaryotic translation initiation factor 4 gamma 3... [more]
eif4g3b3.220e-3033.67eukaryotic translation initiation factor 4 gamma 3... [more]
eif4g3b5.734e-3033.67eukaryotic translation initiation factor 4 gamma 3... [more]
EIF4G17.355e-3033.22eukaryotic translation initiation factor 4 gamma 1... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eif4g2a4.336e-1830.56eukaryotic translation initiation factor 4, gamma ... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
TIF46316.783e-1325.25Translation initiation factor eIF4G; subunit of th... [more]
TIF46322.276e-1227.30Translation initiation factor eIF4G; subunit of th... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO331721.012e-2431.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO323417.860e-2331.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317114.624e-2126.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4G vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4g3a8.357e-3031.21eukaryotic translation initiation factor 4 gamma 3... [more]
eif4g3a1.061e-2931.21eukaryotic translation initiation factor 4 gamma 3... [more]
EIF4G15.518e-2835.06eukaryotic translation initiation factor 4 gamma 1... [more]
EIF4G15.994e-2835.06eukaryotic translation initiation factor 4 gamma 1... [more]
EIF4G15.994e-2835.06eukaryotic translation initiation factor 4 gamma 1... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4G vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045255.10.000e+0100.00SMESG000045255.1[more]
SMESG000060487.10.000e+097.76SMESG000060487.1[more]
SMESG000060487.10.000e+098.69SMESG000060487.1[more]
SMESG000060566.10.000e+069.92SMESG000060566.1[more]
SMESG000060556.10.000e+068.54SMESG000060556.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020652 ID=SMED30020652|Name=Eukaryotic translation initiation factor 4G|organism=Schmidtea mediterranea sexual|type=transcript|length=2651bp
AACGAAGACGGAAATGAGAGACATGAAAATGGTAGAGAGTGAAATGGGAC
GGCTGACGTATTACCGGGATAATTTACTGGCGTTGCGCGGCTGCCAAACA
TTACCGGATCAATTATTCCTCGATCCGGTTCTACTGGAAATCATCACTGC
CAAAATGCAACTGATCAATTTCCTGAAAAAGAAAGAGATCTTCGTCCCAG
TCAAGCCATCGAGAACCGATTATCTCGACTTCACAAGGCGACATTACAAT
ATCCGTCCGAAACGGTTGATTCGCACAGAAAACGGATATTTGCCGCCGCA
ACTGAGAAAGGCCGATGAGGACAAATTGCAACTGTTGAAGCGAAACATCA
AATCGATCCTGAACAAAATGACACCGGAAAACTTCGAAGTCTGTTTGAAC
GATCTCGTGAACCTGGAAATCGATGAGGAAGAGAACATGCGGTGCTTGAT
TGATGAAATCTTTTCCAAGGCTATCCAAGAAGTCAGCTACAGCTCGATTT
ATGCGAGATTCTGCTCGGAAATGTCGAATGCCCGAGTCGGGAATTATTCA
TTCAAAGCTCTGTTGCTGAAGAGCTGCCAGACAATGTTTGATAAACCTTT
GCATTTACAATTAGAAGAAGTAAAAACCTTCTGGGAAGCAAAAGCTGCTA
ACGAAAAAGATGAAAGAATGAAAAGACTTTACGAATCGGATATAGAAGAG
CAAGTTAAGAAAGCCAAAGACAAATATTTCGGAAATATCAGATTTTTCTC
TGAATTGTTTCTGTCAAATCAACTTTCATGGAAAATCATAATCGCATGCG
CTGAGAGATTGTTAATGTTTTCGAAAGACAACAATTCTCTAGAAGCAGCC
TGCCGATTAATGGAGATCTGTGGAAAACAATTAGAAAAACTGGAAAAAGA
ACGAACGAATGGTGACAAAGGATTTTCTAGAGTCATGAATCAATTCGTAG
TTTTATCCAAAAATGTTGATATCGAACAAAGATTAAGATTCAAACTGAAA
GATGTTGTCGATATGCGTGAAAGAAATTGGGAATTACGTGATATTCAAAA
GGCTATGAAAAGTGTTCCTAAAACTTTAGATGAAATCAAAGAAGATAAAC
AGAAAGAAGATTTAAGCAAAATTAAAACGAATTATAATAATAATAATAAT
AATACTAATCTGTCAGTCAATATCTGCTGAGAACCACATAAAGCAGAGCC
ACGGTGACAGTTACTTATACAATGAAATCAAATATGTAAATGAAACGAAT
TATCAAATCAAATTAAAAATCACTCTCAATAAGATAGAAGGAACTTTATT
ATACTTGTTTGATAAATACGACAATCAGTTTATAATTTCTCTTTCTGATG
ATTTGGAGGAGAGAATGAAAATAGAATTCAGAGGTAAAGAATATCATTCA
ACTCTATCTGAATTGTGTGGATGTGTAACATGCAAATATAAAATTATAGA
TTTGAGGGTGGTCATCACTGATCGGATCAACATCCAATGCAATGAACAGC
CAAATAAAATTTGCAGCTATTCTAATCAGAAATTTATTAATACTGCGTAT
CCAATCATGAAGATGTCCGGTAAATTCCAGGTCATATTATGGCTGGTAAA
CACTCCCAGTCACGGTCAGCATTACCCGAACCCAGCCCAATTGGGGGGCT
GCATCCATGAAATATCATTCAATGGCAAACCATTGCAAATGGAGATATTT
GGCAAAGCAATATCCACAAAATGCCCGAAGGTGTGCGCCAATGACGTATG
CAATGCTGGAGTATGCAATGAAACATATGATAGAGAACCATTCTGTGATT
GCACTGATTCCTTCTTGAACGGCCCATACTGCAATTCAAGCGGATCAGAT
GGAATGGATCCGAATTGGAAATATCCCTTTGAAACATTCCGATCTAAATT
TATCAAAATCTCGTGGCAGAATCATTCTGGTTTCATTTTTGGCATCGGCA
ACATGAACACTTCGTTGAATGTCCACAGTACTAGACACTGTCTTTACCTT
TTATATCACAGCAGAATGGAAAAGTTCTTTATAAATAAAACGATAACTGA
TAAATACCATCCAGATCAAATTAGTCGACTGTATTTTACTCTTGGTGAAA
ATATCATTATAAAATTCGTACAACTAAATTATACAATATTTACAAATTCA
CCTGTTCCTAGAGATTTATCCAAAGAGGATTTCACATCAATCTCATTGCT
AAGCAGTCCAGGATTCATTGACATCGTCCACAAATTGCGGCCTTCTCAAT
ACCAATGGCTGCCCTTCCCTAGCAAATTCTTTGTCAACCAAACTGATCGA
TCCGCCATTCCCAAAAAAACCAGCATAGTTTTTCAAACACCGCAAGATTC
TAAGAGAAAGAGGTTATCAAGTAGCAGAGACATCGCCATTGGAATTTTAT
CTTTTCTTTTGTTGATATTTATTATTTTGGCTGCCGTTTTCGCTGTGAAA
TACTTTAGGAATAAGAATGAGATGAAACATGATAAGCCTGATCTGTCGAC
AAGTAATTTACTGGAGAACCTTAAAGATAAAGAAAGCATTTCCAAGAGAT
CTTTCTCCAAAAGTTGCAATTTTGATTGCTTTTATACATGAGATTTTGAT
AGAAATTATTTGTATTTTATACTTGTTTCTTATTATTATGATCAAACAGA
T
back to top

protein sequence of SMED30020652-orf-1

>SMED30020652-orf-1 ID=SMED30020652-orf-1|Name=SMED30020652-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=409bp
MKIEFRGKEYHSTLSELCGCVTCKYKIIDLRVVITDRINIQCNEQPNKIC
SYSNQKFINTAYPIMKMSGKFQVILWLVNTPSHGQHYPNPAQLGGCIHEI
SFNGKPLQMEIFGKAISTKCPKVCANDVCNAGVCNETYDREPFCDCTDSF
LNGPYCNSSGSDGMDPNWKYPFETFRSKFIKISWQNHSGFIFGIGNMNTS
LNVHSTRHCLYLLYHSRMEKFFINKTITDKYHPDQISRLYFTLGENIIIK
FVQLNYTIFTNSPVPRDLSKEDFTSISLLSSPGFIDIVHKLRPSQYQWLP
FPSKFFVNQTDRSAIPKKTSIVFQTPQDSKRKRLSSSRDIAIGILSFLLL
IFIILAAVFAVKYFRNKNEMKHDKPDLSTSNLLENLKDKESISKRSFSKS
CNFDCFYT*
back to top

protein sequence of SMED30020652-orf-2

>SMED30020652-orf-2 ID=SMED30020652-orf-2|Name=SMED30020652-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=393bp
TKTEMRDMKMVESEMGRLTYYRDNLLALRGCQTLPDQLFLDPVLLEIITA
KMQLINFLKKKEIFVPVKPSRTDYLDFTRRHYNIRPKRLIRTENGYLPPQ
LRKADEDKLQLLKRNIKSILNKMTPENFEVCLNDLVNLEIDEEENMRCLI
DEIFSKAIQEVSYSSIYARFCSEMSNARVGNYSFKALLLKSCQTMFDKPL
HLQLEEVKTFWEAKAANEKDERMKRLYESDIEEQVKKAKDKYFGNIRFFS
ELFLSNQLSWKIIIACAERLLMFSKDNNSLEAACRLMEICGKQLEKLEKE
RTNGDKGFSRVMNQFVVLSKNVDIEQRLRFKLKDVVDMRERNWELRDIQK
AMKSVPKTLDEIKEDKQKEDLSKIKTNYNNNNNNTNLSVNIC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR003890MIF4G-like_typ-3
IPR016021MIF4-like_sf
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003723RNA binding
GO:0005488binding
GO:0000339RNA cap binding
GO:0003743translation initiation factor activity
GO:0008135translation factor activity, RNA binding
Vocabulary: cellular component
TermDefinition
GO:0005829cytosol
GO:0016281eukaryotic translation initiation factor 4F complex
Vocabulary: biological process
TermDefinition
GO:0006412translation
GO:0006413translational initiation
GO:0006417regulation of translation
GO:0006446regulation of translational initiation
GO:0016032viral process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 102..122
NoneNo IPR availableCOILSCoilCoilcoord: 280..300
NoneNo IPR availablePANTHERPTHR23253EUKARYOTIC TRANSLATION INITIATION FACTOR 4 GAMMAcoord: 77..370
IPR003890MIF4G-like, type 3SMARTSM00543if4_15coord: 113..342
e-value: 2.5E-20
score: 83.5
IPR003890MIF4G-like, type 3PFAMPF02854MIF4Gcoord: 115..341
e-value: 1.2E-26
score: 93.6
IPR016021MIF4G-like domain superfamilyGENE3DG3DSA:1.25.40.180coord: 104..344
e-value: 9.5E-53
score: 180.9
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 104..343