Chromosome 11 open reading frame 58

Overview
NameChromosome 11 open reading frame 58
Smed IDSMED30020643
Uniprot Best hitUncharacterized protein C1orf158 homolog OS=Mus musculus OX=10090 PE=2 SV=2 (E=6.30287e-20)
Length (bp)620
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Chromosome 11 open reading frame 58 (SMED30020643) t-SNE clustered cells

Violin plots show distribution of expression levels for Chromosome 11 open reading frame 58 (SMED30020643) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Chromosome 11 open reading frame 58 (SMED30020643) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Chromosome 11 open reading frame 58 (SMED30020643) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020643

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30020643SMESG000030362.1 SmedASXL_001748SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30020643SMESG000030362.1 dd_Smed_v4_6127_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30020643SMESG000030362.1 dd_Smed_v4_6127_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30020643SMESG000030362.1 dd_Smed_v4_6127_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30020643SMESG000030362.1 dd_Smed_v4_6127_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30020643SMESG000030362.1 dd_Smed_v4_6127_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020643SMESG000030362.1 dd_Smed_v4_6127_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30020643SMESG000030362.1 dd_Smed_v4_6127_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30020643SMESG000030362.1 dd_Smed_v6_6127_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30020643SMESG000030362.1 dd_Smed_v4_6127_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30020643SMESG000030362.1 dd_Smed_v4_6127_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30020643SMESG000030362.1 dd_Smed_v4_6127_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Chromosome 11 open reading frame 58 vs. Ensembl Human
Match: C1orf158 (chromosome 1 open reading frame 158 [Source:HGNC Symbol;Acc:HGNC:28567])

HSP 1 Score: 85.8853 bits (211), Expect = 1.896e-20
Identity = 61/187 (32.62%), Postives = 89/187 (47.59%), Query Frame = 2
Query:   44 STHGWNITKDYKPGVLVNNWFEERLNYNKENIKHNTTYRTNYSATSLPFPD----VILRRKNWLRGDGIGTHFMLRHHGHVYDDSLITLYDQEINHRERKGRNV-LPPLRKWDSTTISWIPEKSDFPIYDEPTNWGLLNEKKLRWNNQMKDMAKPDLLTTYTDSFHTPSIDSYSRLRFSKPLKA*RI 589
            ST  W I   Y   VL  NW EER  + ++  K   T ++ Y    +PFPD     I R     + +G+    ++ HH       LI+ YD   +H  R G N  LPPLR W+   + W+PEKSDFP+   PTN+GL  + K R       + +    +TYT S+  P + + S    + P+   R+
Sbjct:   12 STPSWQIETKYSTKVLTGNWMEERRKFTRDTDK---TPQSIYRKEYIPFPDHRPDQISRWYGKRKVEGLPYKHLITHHQEPPHRYLISTYD---DHYNRHGYNPGLPPLRTWNGQKLLWLPEKSDFPLLAPPTNYGLYEQLKQRQLTPKAGLKQ----STYTSSYPRPPLCAMSWREHAVPVPPHRL 188          
BLAST of Chromosome 11 open reading frame 58 vs. Ensembl Human
Match: C1orf158 (chromosome 1 open reading frame 158 [Source:HGNC Symbol;Acc:HGNC:28567])

HSP 1 Score: 67.3958 bits (163), Expect = 9.618e-14
Identity = 54/183 (29.51%), Postives = 74/183 (40.44%), Query Frame = 2
Query:   44 STHGWNITKDYKPGVLVNNWFEERLNYNKENIKHNTTYRTNYSATSLPFPDVILRRKNWLRGDGIGTHFMLRHHGHVYDDSLITLYDQEINHRERKGRNV-LPPLRKWDSTTISWIPEKSDFPIYDEPTNWGLLNEKKLRWNNQMKDMAKPDLLTTYTDSFHTPSIDSYSRLRFSKPLKA*RI 589
            ST  W I   Y   VL  NW EER                               RK      G+    ++ HH       LI+ YD   +H  R G N  LPPLR W+   + W+PEKSDFP+   PTN+GL  + K R       + +    +TYT S+  P + + S    + P+   R+
Sbjct:   12 STPSWQIETKYSTKVLTGNWMEER-------------------------------RK------GLPYKHLITHHQEPPHRYLISTYD---DHYNRHGYNPGLPPLRTWNGQKLLWLPEKSDFPLLAPPTNYGLYEQLKQRQLTPKAGLKQ----STYTSSYPRPPLCAMSWREHAVPVPPHRL 150          
BLAST of Chromosome 11 open reading frame 58 vs. Ensembl Zebrafish
Match: si:ch211-226m7.4 (si:ch211-226m7.4 [Source:ZFIN;Acc:ZDB-GENE-080919-1])

HSP 1 Score: 98.9821 bits (245), Expect = 2.443e-25
Identity = 57/172 (33.14%), Postives = 86/172 (50.00%), Query Frame = 2
Query:   44 STHGWNITKDYKPGVLVNNWFEERLNYNKENIKHNTTYRTNYSATSLPFPDVILRRKNWLRGDGIGTHFMLRHHGHVYDDSLITLYDQEINHRERKGRNVLPPLRKWDSTTISWIPEKSDFPIYDEPTNWGLLNEKKLRWNNQMKDMAKPDLLTTYTDSFHTPSIDSYSRLR 559
            S  GW I + Y   VL+ NW EE+L + +E    N++ R +Y    L  PDV++RRK   R +G+ +  +L HH       L++LYD+      R+  + LP LR W    ++W+PE+SD P+   PT +GL    + R   Q    A    L+ Y  S+    I S+   R
Sbjct:   12 SQPGWKIEQKYGNKVLIGNWVEEKLQFARECKTANSSNRLDYIPHMLHRPDVVMRRKALRRSEGVPSRQLLSHHDVPSSHYLVSLYDESYG---RQTSSSLPTLRSWHHDKLAWVPERSDHPVQGPPTKFGLAECWRTRVEQQ---RAVVPTLSLYKASYPLHPISSFCHSR 177          
BLAST of Chromosome 11 open reading frame 58 vs. Ensembl Xenopus
Match: c11orf58 (chromosome 11 open reading frame 58 [Source:Xenbase;Acc:XB-GENE-5721736])

HSP 1 Score: 105.916 bits (263), Expect = 8.413e-28
Identity = 57/171 (33.33%), Postives = 89/171 (52.05%), Query Frame = 2
Query:   53 GWNITKDYKPGVLVNNWFEERLNY-NKENIKHNTTYRTNYSATSLPFPDVILRRKNWLRGDGIGTHFMLRHHGHVYDDSLITLYDQEINHRERKGRNVLPPLRKWDSTTISWIPEKSDFPIYDEPTNWGLLNEKKLRWNNQMKDMAKPDLLTTYTDSFHTPSIDSYSRLRF 562
            GW I   Y   VL+ NW EER  +  +   K ++ Y  ++ +     PD I  R    + +G+    +L HHG      L++LYD   +H  R G++ LP LR +D   ++W+PE+SD+P  D PTN+GL   K+ +W  Q  +    D  + Y+ S+  P   +YS +RF
Sbjct:    6 GWKIEPKYSDKVLIGNWVEERRKFRTRYQPKQDSCYNIDFVSFPDSKPDRIFTRSIVKKLEGLPKCHLLSHHGEPKHKHLVSLYD---DHYLRSGKSKLPTLRSYDGNRLAWVPEQSDYPTADPPTNFGLFQAKEKQWREQFSE----DHKSLYSASYKQPPTSAYSTVRF 169          
BLAST of Chromosome 11 open reading frame 58 vs. Ensembl Mouse
Match: 1700012P22Rik (RIKEN cDNA 1700012P22 gene [Source:MGI Symbol;Acc:MGI:1916614])

HSP 1 Score: 86.6557 bits (213), Expect = 9.011e-21
Identity = 60/185 (32.43%), Postives = 87/185 (47.03%), Query Frame = 2
Query:   44 STHGWNITKDYKPGVLVNNWFEERLNYNKENIKH--NTTYRTNYSATSLPFPDVILRRKNWLRGDGIGTHFMLRHHGHVYDDSLITLYDQEIN-HRERKGRNVLPPLRKWDSTTISWIPEKSDFPIYDEPTNWGLLNEKKLRWNNQMKDMAKPDLLTTYTDSFHTPSIDSYSRLRFSKPLKA*RI 589
            ST GW I K Y   VL+ NW EER  + K  I H     YR  Y       PD + R  +  + +G+    ++ HH       LI+ YD   N H    G   LP LR W+   + W+PEKSDFP+   PTN+GLL + + +W      + +    + YT S+    + + SR   + P+   R+
Sbjct:   14 STPGWQIEKKYSTKVLLGNWVEERGKFTKA-IDHTPQCIYRKEYVPMPDHRPDFVSRWYSKSKMEGLPYKHLITHHQEPSHRYLISTYDDHYNRHNYNPG---LPALRTWNGQKLLWLPEKSDFPLVAPPTNYGLLEQLQQKWLASKTSLKE----SIYTTSYPRLPVCAMSRREHAIPVPHPRL 190          
BLAST of Chromosome 11 open reading frame 58 vs. UniProt
Match: sp|Q4KKZ1|CA158_MOUSE (Uncharacterized protein C1orf158 homolog OS=Mus musculus OX=10090 PE=2 SV=2)

HSP 1 Score: 86.6557 bits (213), Expect = 6.303e-20
Identity = 60/185 (32.43%), Postives = 87/185 (47.03%), Query Frame = 2
Query:   44 STHGWNITKDYKPGVLVNNWFEERLNYNKENIKH--NTTYRTNYSATSLPFPDVILRRKNWLRGDGIGTHFMLRHHGHVYDDSLITLYDQEIN-HRERKGRNVLPPLRKWDSTTISWIPEKSDFPIYDEPTNWGLLNEKKLRWNNQMKDMAKPDLLTTYTDSFHTPSIDSYSRLRFSKPLKA*RI 589
            ST GW I K Y   VL+ NW EER  + K  I H     YR  Y       PD + R  +  + +G+    ++ HH       LI+ YD   N H    G   LP LR W+   + W+PEKSDFP+   PTN+GLL + + +W      + +    + YT S+    + + SR   + P+   R+
Sbjct:   14 STPGWQIEKKYSTKVLLGNWVEERGKFTKA-IDHTPQCIYRKEYVPMPDHRPDFVSRWYSKSKMEGLPYKHLITHHQEPSHRYLISTYDDHYNRHNYNPG---LPALRTWNGQKLLWLPEKSDFPLVAPPTNYGLLEQLQQKWLASKTSLKE----SIYTTSYPRLPVCAMSRREHAIPVPHPRL 190          
BLAST of Chromosome 11 open reading frame 58 vs. UniProt
Match: sp|Q8N1D5|CA158_HUMAN (Uncharacterized protein C1orf158 OS=Homo sapiens OX=9606 GN=C1orf158 PE=2 SV=2)

HSP 1 Score: 85.8853 bits (211), Expect = 9.905e-20
Identity = 61/187 (32.62%), Postives = 89/187 (47.59%), Query Frame = 2
Query:   44 STHGWNITKDYKPGVLVNNWFEERLNYNKENIKHNTTYRTNYSATSLPFPD----VILRRKNWLRGDGIGTHFMLRHHGHVYDDSLITLYDQEINHRERKGRNV-LPPLRKWDSTTISWIPEKSDFPIYDEPTNWGLLNEKKLRWNNQMKDMAKPDLLTTYTDSFHTPSIDSYSRLRFSKPLKA*RI 589
            ST  W I   Y   VL  NW EER  + ++  K   T ++ Y    +PFPD     I R     + +G+    ++ HH       LI+ YD   +H  R G N  LPPLR W+   + W+PEKSDFP+   PTN+GL  + K R       + +    +TYT S+  P + + S    + P+   R+
Sbjct:   12 STPSWQIETKYSTKVLTGNWMEERRKFTRDTDK---TPQSIYRKEYIPFPDHRPDQISRWYGKRKVEGLPYKHLITHHQEPPHRYLISTYD---DHYNRHGYNPGLPPLRTWNGQKLLWLPEKSDFPLLAPPTNYGLYEQLKQRQLTPKAGLKQ----STYTSSYPRPPLCAMSWREHAVPVPPHRL 188          
BLAST of Chromosome 11 open reading frame 58 vs. UniProt
Match: sp|Q2TA11|CA158_BOVIN (Uncharacterized protein C1orf158 homolog OS=Bos taurus OX=9913 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.463e-18
Identity = 60/187 (32.09%), Postives = 84/187 (44.92%), Query Frame = 2
Query:   44 STHGWNITKDYKPGVLVNNWFEERLNYNKENIK-HNTTYRTNYSATSLPFPDVILRRKNWLRGDGIGTHFMLRHHGHVYDDSLITLYDQEIN-HRERKGRNVLPPLRKWDSTTISWIPEKSDFPIYDEPTNWGLLNEKKLRWNNQMKDMAKPDLLTTYTDSFHTPSIDSYSRLRFSKPLKA*RIIIV 598
            ST  W I   Y   VL  NW EER  + K   K   T YR  Y       PD I R  +    +G+   +++ HH       LI+ YD   N H    G   LP LR W+   + W+PEK+DFP+   PTN+GL  + K +W    +   +  +   YT S+  P   + SR   + P+   R+  V
Sbjct:   13 STPSWKIETKYSTRVLTGNWTEERRKFIKATEKTPQTIYRKEYVPFPGHRPDQISRWYSKRTVEGLPYKYLITHHQEPSQRYLISTYDDHYNRHNYHPG---LPELRTWNRHKLLWLPEKADFPLLGPPTNYGLYEQLKQKWLPPPEATLRESI---YTSSYPRPPAGAMSRREHAIPVPPPRLQPV 193          
BLAST of Chromosome 11 open reading frame 58 vs. TrEMBL
Match: gnl|BL_ORD_ID|23481876 (tr|A0A210PL41|A0A210PL41_MIZYE Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT21288 PE=4 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 1.469e-40
Identity = 72/179 (40.22%), Postives = 112/179 (62.57%), Query Frame = 2
Query:   35 MKKSTHGWNITKDYKPGVLVNNWFEERLNYNKENIKHNTTYRTNYSATSLPFPDVILRRKNWLRGDGIGTHFMLRHHGHVYDDSLITLYDQEINHRERKGRNVLPPLRKWDSTTISWIPEKSDFPIYDEPTNWGLLNEKKLRWNNQMKDMAKPDLLTTYTDSFHTPSIDSYSRLRFSKP 571
            MK    GW I + + PGVL+ NW EER  +NK + KHN+T+RT++       PDV++RRK  L+ +G+G   +  HHG  Y ++ ++ YD+  N R  +  N LP LR W+   +SW PEKSD+P+  +PTN+GLL + + +W+N++ D  + D L+TY ++FH    D+  + RF+ P
Sbjct:    7 MKWHLPGWRIEQRFAPGVLIGNWSEERYTFNKGDQKHNSTHRTDFRNFKGHRPDVMVRRKALLKNNGLGPEHIFHHHGKRYSNNAVSWYDEHYNGRWTEN-NDLPGLRDWNGHKLSWAPEKSDYPLQGKPTNFGLLQKLENKWSNEIADETRGDYLSTYQNTFHQHPTDTMVKARFAIP 184          
BLAST of Chromosome 11 open reading frame 58 vs. TrEMBL
Match: gnl|BL_ORD_ID|20539276 (tr|A0A0B7BTB7|A0A0B7BTB7_9EUPU Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF208140 PE=4 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 9.023e-39
Identity = 69/171 (40.35%), Postives = 105/171 (61.40%), Query Frame = 2
Query:   53 GWNITKDYKPGVLVNNWFEERLNYNKENIKHNTTYRTNYSATSLPFPDVILRRKNWLRGDGIGTHFMLRHHGHVYDDSLITLYDQEINHRERKGRNVLPPLRKWDSTTISWIPEKSDFPIYDEPTNWGLLNEKKLRWNNQMKDMAKPDLLTTYTDSFHTPSIDSYSRLRFS 565
            GW I + Y PGVL+ NW E+   ++    KHN+TYR ++  T    PDV++RRK  L  +G     +LRHHG  YD+ LI+LYD+  N R R+  N LPPLRK+D+ T+ W+PE+SD+P+  + TNWGL  +++ +   + ++M  P+  +TY  S+    I+     RF+
Sbjct:   18 GWRIEQKYSPGVLIGNWSEDMNKFSDSKYKHNSTYRLDFQNTGGIHPDVMIRRKTKLGDEGKHADMLLRHHGDAYDNMLISLYDESYNGRWRE--NCLPPLRKFDNQTLKWLPERSDYPLKGDATNWGLKEQRQAKLLKRQQEMYFPEFESTYMGSYQDKPINVRQFPRFA 186          
BLAST of Chromosome 11 open reading frame 58 vs. TrEMBL
Match: gnl|BL_ORD_ID|15729244 (tr|R7V944|R7V944_CAPTE Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_19088 PE=4 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 1.298e-38
Identity = 66/171 (38.60%), Postives = 103/171 (60.23%), Query Frame = 2
Query:   53 GWNITKDYKPGVLVNNWFEERLNYNKENIKHNTTYRTNYSATSLPFPDVILRRKNWLRGDGIGTHFMLRHHGHVYDDSLITLYDQEINHRERKGRNVLPPLRKWDSTTISWIPEKSDFPIYDEPTNWGLLNEKKLRWNNQMKDMAKPDLLTTYTDSFHTPSIDSYSRLRFS 565
            GW I + Y PGVL+ NW E R N+ K N + N+TYR ++       PD+I+RRK  +R +G+    ++ HHG  Y  ++I+ YD++ N R+R+  + LP LRKWD   ++W+PEK+D P+   PTN+GLLN++   W+N        D  TTY+ SF      + + +R++
Sbjct:   13 GWRIEQKYAPGVLIGNWSEGRYNFVKGNSRGNSTYRVDFMNFGNHRPDIIIRRKGQIRNEGLPAEHLIHHHGKAYSKNMISWYDEDYNKRKRELGDELPMLRKWDGNELAWLPEKTDHPMQGAPTNYGLLNKRAADWSNHQTQETHSDYNTTYSASFKRQDNSAMAPVRYA 183          
BLAST of Chromosome 11 open reading frame 58 vs. TrEMBL
Match: gnl|BL_ORD_ID|18265737 (tr|A0A267E257|A0A267E257_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028821g3 PE=4 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 2.075e-38
Identity = 70/169 (41.42%), Postives = 97/169 (57.40%), Query Frame = 2
Query:   35 MKKSTHGWNITKDYKPGVLVNNWFEERLNYNKENIKHNTTYRTNYSATSLPFPDVILRRKNWLRGDGIGTHFMLRHHGHVYDDSLITLYDQEINHRERKGRNVLPPLRKWDSTTISWIPEKSDFPIYDEPTNWGLLNEKKLRWNNQMKD---MAKPDLLTTYTDSFHTP 532
            M      W+++K YK  VLV NWFEERL Y+++N  H ++Y  ++       PDV+LRR  W+R +G+G   +L HHG  Y  + IT YD++ N R   G    PPLR W S  ++W PE+SDFP+   PTNWGL      RWN  +++    +K D  TTY  S+  P
Sbjct:    1 MDPGASNWDVSKRYKTDVLVGNWFEERLVYDRKNHTHPSSYSIDFQQRGYQQPDVVLRRNGWIRSNGVGKEILLAHHGDAYKKNWITWYDEDFNGR---GLPRNPPLRDWHSGNMAWSPERSDFPVQGSPTNWGLKERLDKRWNTSLQERSTTSKNDFSTTYNASYLKP 166          
BLAST of Chromosome 11 open reading frame 58 vs. TrEMBL
Match: gnl|BL_ORD_ID|18197874 (tr|A0A267G3E5|A0A267G3E5_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028821g4 PE=4 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 2.287e-38
Identity = 70/169 (41.42%), Postives = 97/169 (57.40%), Query Frame = 2
Query:   35 MKKSTHGWNITKDYKPGVLVNNWFEERLNYNKENIKHNTTYRTNYSATSLPFPDVILRRKNWLRGDGIGTHFMLRHHGHVYDDSLITLYDQEINHRERKGRNVLPPLRKWDSTTISWIPEKSDFPIYDEPTNWGLLNEKKLRWNNQMKD---MAKPDLLTTYTDSFHTP 532
            M      W+++K YK  VLV NWFEERL Y+++N  H ++Y  ++       PDV+LRR  W+R +G+G   +L HHG  Y  + IT YD++ N R   G    PPLR W S  ++W PE+SDFP+   PTNWGL      RWN  +++    +K D  TTY  S+  P
Sbjct:    1 MDHGASNWDVSKRYKTDVLVGNWFEERLVYDRKNHTHPSSYSIDFQQRGYQQPDVVLRRNGWIRSNGVGKEILLAHHGDAYKKNWITWYDEDFNGR---GLPRNPPLRDWHSGNMAWSPERSDFPVQGSPTNWGLKERLDKRWNTSLQERSTTSKNDFSTTYNASYLKP 166          
BLAST of Chromosome 11 open reading frame 58 vs. Ensembl Cavefish
Match: aadacl4 (chromosome 22 C1orf158 homolog [Source:NCBI gene;Acc:103033413])

HSP 1 Score: 97.0561 bits (240), Expect = 9.261e-25
Identity = 50/130 (38.46%), Postives = 71/130 (54.62%), Query Frame = 2
Query:   53 GWNITKDYKPGVLVNNWFEERLNYNKENIKHNTTYRTNYSATSLPFPDVILRRKNWLRGDGIGTHFMLRHHGHVYDDSLITLYDQEINHRERKGRNVLPPLRKWDSTTISWIPEKSDFPIYDEPTNWGLL 442
            GW I   Y   VL+ NW EE+L + +E     +TYR ++       PDVI+RR    R +G+  H ++ HH       L++LYD+      R+  + LP LR W S  + WIPE+SD P+   PTN+GLL
Sbjct:   15 GWRIEPRYSNRVLIGNWVEEKLQFTRECNTATSTYRLDFRPQLGHRPDVIMRRHALRRSEGLPPHQLMYHHSTPTAHYLVSLYDESYG---RQHTSDLPTLRTWHSDKLGWIPERSDHPVQGPPTNYGLL 141          
BLAST of Chromosome 11 open reading frame 58 vs. Ensembl Cavefish
Match: aadacl4 (chromosome 22 C1orf158 homolog [Source:NCBI gene;Acc:103033413])

HSP 1 Score: 60.077 bits (144), Expect = 1.657e-10
Identity = 29/82 (35.37%), Postives = 46/82 (56.10%), Query Frame = 2
Query:  203 LRRKNWLRGDGIGTHFMLRHHGHVYDDSLITLYDQEINHRERKGRNVLPPLRKWDSTTISWIPEKSDFPIYDEPTNWGLLNE 448
             R +++ + +G+  H ++ HH       L++LYD+      R+  + LP LR W S  + WIPE+SD P+   PTN+GLL  
Sbjct:  304 FRERSYQKPEGLPPHQLMYHHSTPTAHYLVSLYDESYG---RQHTSDLPTLRTWHSDKLGWIPERSDHPVQGPPTNYGLLES 382          
BLAST of Chromosome 11 open reading frame 58 vs. Ensembl Nematostella
Match: EDO31004 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ59])

HSP 1 Score: 119.783 bits (299), Expect = 7.696e-34
Identity = 58/142 (40.85%), Postives = 83/142 (58.45%), Query Frame = 2
Query:   53 GWNITKDYKPGVLVNNWFEERLNYNKENIKHNTTYRTNYSATSLPFPDVILRRKNWLRGDGIGTHFMLRHHGHVYDDSLITLYDQEINHRERKGRNVLPPLRKWDSTTISWIPEKSDFPIYDEPTNWGLLNEKKLRWNNQMK 478
            GW I + Y   VL+ NW EER N+ +     N+T +T++       PDV  RR+  L+ DG+   ++  HHG  Y    I+ YDQE N RE    + LPPLR W+S  ++W PEKSDFP+   PTN+GLL +K+ +W  + +
Sbjct:   16 GWRIEQRYATDVLIGNWNEERRNFERGGSHFNSTQKTDFKNYGKQLPDVKTRRQALLKHDGLAKAYLFSHHGKTYSGHRISWYDQEYNKRE-VTESQLPPLRSWNSQQLAWGPEKSDFPLEGRPTNYGLLEKKQEKWRREAE 156          
BLAST of Chromosome 11 open reading frame 58 vs. Ensembl Nematostella
Match: EDO40672 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6L1])

HSP 1 Score: 77.411 bits (189), Expect = 7.983e-18
Identity = 56/163 (34.36%), Postives = 83/163 (50.92%), Query Frame = 2
Query:   53 GWNITKDYKPGVLVNNWFEERLNYNKENIKHNTTYRTNYSATSLPFPDVILRRKNWLRG-DGIGTHFMLRHHGHVYDDSLITLYDQEINHRERKGRNVLPPLRKWDSTTISWIPEKSDFPIYDEPTNWGLLNEKKLRWNNQMKDMAKPDLLTTYTDS-FHTPS 535
            GW I   Y   VL+ NWFEERL + ++    N+T R ++  T    P+ ILRR+  LR  +G+G   +L HHG+ Y  S ++ +  +  H     R   P  R+WD    SW PEK D  + +   N  LL+    R N+ +  +   D+ +T T S F TP+
Sbjct:   13 GWKIEPKYIDRVLIGNWFEERLQFPRDRSFGNSTQRQDFRNTKGRQPERILRRQLALRNWEGVGQQCLLNHHGNSYMTSGLSTHLTDYQH---PMRVKSPGKRRWDGHQSSWKPEKLDRQVPESEKN-RLLH----RRNSTLPVIPTADMYSTETSSNFRTPT 167          
BLAST of Chromosome 11 open reading frame 58 vs. Planmine SMEST
Match: SMESG000030362.1 (SMESG000030362.1)

HSP 1 Score: 375.17 bits (962), Expect = 1.098e-134
Identity = 182/182 (100.00%), Postives = 182/182 (100.00%), Query Frame = 2
Query:   35 MKKSTHGWNITKDYKPGVLVNNWFEERLNYNKENIKHNTTYRTNYSATSLPFPDVILRRKNWLRGDGIGTHFMLRHHGHVYDDSLITLYDQEINHRERKGRNVLPPLRKWDSTTISWIPEKSDFPIYDEPTNWGLLNEKKLRWNNQMKDMAKPDLLTTYTDSFHTPSIDSYSRLRFSKPLKA 580
            MKKSTHGWNITKDYKPGVLVNNWFEERLNYNKENIKHNTTYRTNYSATSLPFPDVILRRKNWLRGDGIGTHFMLRHHGHVYDDSLITLYDQEINHRERKGRNVLPPLRKWDSTTISWIPEKSDFPIYDEPTNWGLLNEKKLRWNNQMKDMAKPDLLTTYTDSFHTPSIDSYSRLRFSKPLKA
Sbjct:    1 MKKSTHGWNITKDYKPGVLVNNWFEERLNYNKENIKHNTTYRTNYSATSLPFPDVILRRKNWLRGDGIGTHFMLRHHGHVYDDSLITLYDQEINHRERKGRNVLPPLRKWDSTTISWIPEKSDFPIYDEPTNWGLLNEKKLRWNNQMKDMAKPDLLTTYTDSFHTPSIDSYSRLRFSKPLKA 182          
BLAST of Chromosome 11 open reading frame 58 vs. Planmine SMEST
Match: SMESG000027616.1 (SMESG000027616.1)

HSP 1 Score: 50.447 bits (119), Expect = 3.620e-8
Identity = 43/160 (26.88%), Postives = 67/160 (41.88%), Query Frame = 2
Query:   56 WNITKDYKPGVLVNNWFEERLNYNKENIKHNTTYRTNYSATSLPFPDVILRRKNWLRGDGIGTHFMLRHHGHVYDDSLITLYDQEINHRERKGRNVLPPLRKWDSTTISWIPEKSDFPIYDEPTNWGLLNEKKLRWNNQMKDMAKPDLLTTYTDSFHTPS 535
            WN  K Y+P  L++NW+E+RL Y +  ++  +    ++S   L  PD++  +  W  GD            H    + + +  Q I + E  G                        P Y    NWGL+  K+L W+N+ K +  P   TTY DS+ TP 
Sbjct:    5 WNCKKTYEPSTLLHNWYEDRLKYKQHELQPGSRLCYDFSRKDLDVPDIVKHQTYW--GD---------RRKHYLQQNPVKITKQCIANPELFG------------------------PDY----NWGLVYNKRLFWDNE-KLLQTP---TTYVDSYCTPQ 121          
BLAST of Chromosome 11 open reading frame 58 vs. Planmine SMEST
Match: SMESG000027616.1 (SMESG000027616.1)

HSP 1 Score: 50.447 bits (119), Expect = 4.176e-8
Identity = 43/160 (26.88%), Postives = 67/160 (41.88%), Query Frame = 2
Query:   56 WNITKDYKPGVLVNNWFEERLNYNKENIKHNTTYRTNYSATSLPFPDVILRRKNWLRGDGIGTHFMLRHHGHVYDDSLITLYDQEINHRERKGRNVLPPLRKWDSTTISWIPEKSDFPIYDEPTNWGLLNEKKLRWNNQMKDMAKPDLLTTYTDSFHTPS 535
            WN  K Y+P  L++NW+E+RL Y +  ++  +    ++S   L  PD++  +  W  GD            H    + + +  Q I + E  G                        P Y    NWGL+  K+L W+N+ K +  P   TTY DS+ TP 
Sbjct:    4 WNCKKTYEPSTLLHNWYEDRLKYKQHELQPGSRLCYDFSRKDLDVPDIVKHQTYW--GD---------RRKHYLQQNPVKITKQCIANPELFG------------------------PDY----NWGLVYNKRLFWDNE-KLLQTP---TTYVDSYCTPQ 120          
BLAST of Chromosome 11 open reading frame 58 vs. Planmine SMEST
Match: SMESG000026202.1 (SMESG000026202.1)

HSP 1 Score: 47.3654 bits (111), Expect = 1.665e-7
Identity = 22/58 (37.93%), Postives = 31/58 (53.45%), Query Frame = 2
Query:   56 WNITKDYKPGVLVNNWFEERLNYNKENIKHNTTYRTNYSATSLPFPDVILRRKNWLRG 229
            W +T  Y P  L+ NW+E++L Y K    H +TY T+Y+   LP  D   R +  L G
Sbjct:   10 WKVTSQYSPKTLIGNWYEDKLKYKKYVYNHKSTYETDYTPKLLPSVD---RERQMLEG 64          
The following BLAST results are available for this feature:
BLAST of Chromosome 11 open reading frame 58 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
C1orf1581.896e-2032.62chromosome 1 open reading frame 158 [Source:HGNC S... [more]
C1orf1589.618e-1429.51chromosome 1 open reading frame 158 [Source:HGNC S... [more]
back to top
BLAST of Chromosome 11 open reading frame 58 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome 11 open reading frame 58 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome 11 open reading frame 58 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-226m7.42.443e-2533.14si:ch211-226m7.4 [Source:ZFIN;Acc:ZDB-GENE-080919-... [more]
back to top
BLAST of Chromosome 11 open reading frame 58 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
c11orf588.413e-2833.33chromosome 11 open reading frame 58 [Source:Xenbas... [more]
back to top
BLAST of Chromosome 11 open reading frame 58 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
1700012P22Rik9.011e-2132.43RIKEN cDNA 1700012P22 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Chromosome 11 open reading frame 58 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q4KKZ1|CA158_MOUSE6.303e-2032.43Uncharacterized protein C1orf158 homolog OS=Mus mu... [more]
sp|Q8N1D5|CA158_HUMAN9.905e-2032.62Uncharacterized protein C1orf158 OS=Homo sapiens O... [more]
sp|Q2TA11|CA158_BOVIN3.463e-1832.09Uncharacterized protein C1orf158 homolog OS=Bos ta... [more]
back to top
BLAST of Chromosome 11 open reading frame 58 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|234818761.469e-4040.22tr|A0A210PL41|A0A210PL41_MIZYE Uncharacterized pro... [more]
gnl|BL_ORD_ID|205392769.023e-3940.35tr|A0A0B7BTB7|A0A0B7BTB7_9EUPU Uncharacterized pro... [more]
gnl|BL_ORD_ID|157292441.298e-3838.60tr|R7V944|R7V944_CAPTE Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|182657372.075e-3841.42tr|A0A267E257|A0A267E257_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|181978742.287e-3841.42tr|A0A267G3E5|A0A267G3E5_9PLAT Uncharacterized pro... [more]
back to top
BLAST of Chromosome 11 open reading frame 58 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
aadacl49.261e-2538.46chromosome 22 C1orf158 homolog [Source:NCBI gene;A... [more]
aadacl41.657e-1035.37chromosome 22 C1orf158 homolog [Source:NCBI gene;A... [more]
back to top
BLAST of Chromosome 11 open reading frame 58 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome 11 open reading frame 58 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome 11 open reading frame 58 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO310047.696e-3440.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406727.983e-1834.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Chromosome 11 open reading frame 58 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome 11 open reading frame 58 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000030362.11.098e-134100.00SMESG000030362.1[more]
SMESG000027616.13.620e-826.88SMESG000027616.1[more]
SMESG000027616.14.176e-826.88SMESG000027616.1[more]
SMESG000026202.11.665e-737.93SMESG000026202.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020643 ID=SMED30020643|Name=Chromosome 11 open reading frame 58|organism=Schmidtea mediterranea sexual|type=transcript|length=620bp
GTAACACAGAAATATTTTCAAATAATTAATTTTAATGAAGAAATCCACAC
ACGGATGGAACATAACGAAGGATTATAAACCAGGCGTCCTTGTAAACAAT
TGGTTTGAAGAAAGATTAAATTATAACAAAGAGAATATCAAACACAACAC
TACTTACCGAACCAATTATTCAGCCACTTCGCTACCGTTTCCTGATGTAA
TATTGAGAAGGAAAAATTGGTTGCGAGGAGATGGAATTGGAACTCATTTT
ATGTTGCGACATCACGGTCATGTGTATGATGACAGTCTAATAACATTATA
TGATCAAGAAATCAATCATCGCGAGAGAAAAGGCCGAAATGTTTTACCTC
CGCTGAGAAAATGGGACAGTACTACAATTAGTTGGATACCAGAGAAATCC
GATTTCCCTATTTATGACGAGCCGACAAATTGGGGATTGCTCAATGAGAA
AAAACTTCGATGGAATAATCAAATGAAAGATATGGCAAAGCCTGACTTAC
TAACAACTTACACCGATAGTTTCCACACGCCGTCGATTGACTCGTATTCA
CGATTGAGATTTTCCAAACCGTTGAAGGCGTAGAGAATTATTATCGTTTT
GTTTTAATTTCGACATTTTT
back to top

protein sequence of SMED30020643-orf-1

>SMED30020643-orf-1 ID=SMED30020643-orf-1|Name=SMED30020643-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=183bp
MKKSTHGWNITKDYKPGVLVNNWFEERLNYNKENIKHNTTYRTNYSATSL
PFPDVILRRKNWLRGDGIGTHFMLRHHGHVYDDSLITLYDQEINHRERKG
RNVLPPLRKWDSTTISWIPEKSDFPIYDEPTNWGLLNEKKLRWNNQMKDM
AKPDLLTTYTDSFHTPSIDSYSRLRFSKPLKA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR037662C1orf158
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR037662Uncharacterized protein C1orf158PANTHERPTHR31180UNCHARACTERIZEDcoord: 4..179