Armadillo type fold

Overview
NameArmadillo type fold
Smed IDSMED30020636
Length (bp)1689
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Armadillo type fold (SMED30020636) t-SNE clustered cells

Violin plots show distribution of expression levels for Armadillo type fold (SMED30020636) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Armadillo type fold (SMED30020636) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Armadillo type fold (SMED30020636) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020636

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30020636SMESG000011258.1 SmedASXL_012303SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30020636SMESG000011258.1 dd_Smed_v6_18133_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30020636SMESG000011258.1 dd_Smed_v4_18133_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Armadillo type fold vs. Ensembl Human
Match: ARMH1 (armadillo like helical domain containing 1 [Source:HGNC Symbol;Acc:HGNC:34345])

HSP 1 Score: 367.851 bits (943), Expect = 5.661e-122
Identity = 202/424 (47.64%), Postives = 287/424 (67.69%), Query Frame = 2
Query:   95 MSSAKQDNATYNVISILQEWDKASKERRKQLLQDFIDQHQQITGPELEMELAQMASLFLARISVWLKLTYMTGTCLTEQLKTLHIFLNASSSQNFLSEFFEXXXXXXXXXXXXXXXSKEIDKEWAVKVLTCVANSGTKYKEVICESYGIRAIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPKAQQLAIQTIRTIQPIVKVAHRALIERIICLLESLHLEVQSATIELICDLMNYEIRDDILRGLVMLLKPA-KEI---------NPQVIFIEETGSSKPPLPVFIQQSTAAKCIRILMNRDIDLADKLIQADVVHNLLYAMGNVEYADSQRQASLSLHVFCQSYPIIDENVREAMGNFLYSAFMKDPEALYVQMTPLQADVLISNKVSIKQALSLERLMRKMNELY 1336
            M+S K+  A   ++S LQEWD A K  R  +L  FI+ +Q  T PELE E +Q ASLFL R++  L++TYMT +CL + L+++ IFL+A SS  +L EF E GG+L LLEI  L   KE  K+ +VK+L  +ANSG  YKE+ICESYG+R+IAE +AKSKSEETQ   + LL+ L  GNP+Y NQVYKGLI +LPC SPKAQQL++QT+RT QPI+   H ++++ ++ +L ++HLEVQ   IELI DL+ Y++R  +L+GLV LL P+ KEI         +P V+ +       P LP+F+QQ+ AAK I +L   D+ +A++L+   VV  L+ AMGN ++++SQR ASL+L  F Q +P++ E+VR+ MG  LY  F+ + E LY+++  +QAD+L +N V++ +AL L      MN LY
Sbjct:    1 MTSIKEQAAISRLLSFLQEWDNAGKVARSHILDKFIETNQGKTAPELEQEFSQGASLFLVRLTTSLRITYMTDSCLEKLLRSIGIFLSAVSSNRYLIEFLEVGGVLTLLEILGLEKIKEEAKKESVKLLQVIANSGRTYKELICESYGVRSIAEFLAKSKSEETQEEVQVLLDSLVHGNPKYQNQVYKGLIALLPCESPKAQQLSLQTLRTAQPIIGTTHPSIVDCVLKVLGTMHLEVQYEAIELIKDLVGYDVRQALLKGLVALLIPSVKEISKLQAKILSDPSVLQL------TPSLPMFLQQAAAAKAIGVLARNDMSIAEELLYLRVVRGLMAAMGNTDHSNSQRLASLTLECFVQMFPLVAEHVRKCMGEELYQLFLSNAEDLYMKIDSIQADILAANTVNVTKALCLHGSSYSMNTLY 418          
BLAST of Armadillo type fold vs. Ensembl Human
Match: ARMH1 (armadillo like helical domain containing 1 [Source:HGNC Symbol;Acc:HGNC:34345])

HSP 1 Score: 367.851 bits (943), Expect = 5.661e-122
Identity = 202/424 (47.64%), Postives = 287/424 (67.69%), Query Frame = 2
Query:   95 MSSAKQDNATYNVISILQEWDKASKERRKQLLQDFIDQHQQITGPELEMELAQMASLFLARISVWLKLTYMTGTCLTEQLKTLHIFLNASSSQNFLSEFFEXXXXXXXXXXXXXXXSKEIDKEWAVKVLTCVANSGTKYKEVICESYGIRAIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPKAQQLAIQTIRTIQPIVKVAHRALIERIICLLESLHLEVQSATIELICDLMNYEIRDDILRGLVMLLKPA-KEI---------NPQVIFIEETGSSKPPLPVFIQQSTAAKCIRILMNRDIDLADKLIQADVVHNLLYAMGNVEYADSQRQASLSLHVFCQSYPIIDENVREAMGNFLYSAFMKDPEALYVQMTPLQADVLISNKVSIKQALSLERLMRKMNELY 1336
            M+S K+  A   ++S LQEWD A K  R  +L  FI+ +Q  T PELE E +Q ASLFL R++  L++TYMT +CL + L+++ IFL+A SS  +L EF E GG+L LLEI  L   KE  K+ +VK+L  +ANSG  YKE+ICESYG+R+IAE +AKSKSEETQ   + LL+ L  GNP+Y NQVYKGLI +LPC SPKAQQL++QT+RT QPI+   H ++++ ++ +L ++HLEVQ   IELI DL+ Y++R  +L+GLV LL P+ KEI         +P V+ +       P LP+F+QQ+ AAK I +L   D+ +A++L+   VV  L+ AMGN ++++SQR ASL+L  F Q +P++ E+VR+ MG  LY  F+ + E LY+++  +QAD+L +N V++ +AL L      MN LY
Sbjct:    1 MTSIKEQAAISRLLSFLQEWDNAGKVARSHILDKFIETNQGKTAPELEQEFSQGASLFLVRLTTSLRITYMTDSCLEKLLRSIGIFLSAVSSNRYLIEFLEVGGVLTLLEILGLEKIKEEAKKESVKLLQVIANSGRTYKELICESYGVRSIAEFLAKSKSEETQEEVQVLLDSLVHGNPKYQNQVYKGLIALLPCESPKAQQLSLQTLRTAQPIIGTTHPSIVDCVLKVLGTMHLEVQYEAIELIKDLVGYDVRQALLKGLVALLIPSVKEISKLQAKILSDPSVLQL------TPSLPMFLQQAAAAKAIGVLARNDMSIAEELLYLRVVRGLMAAMGNTDHSNSQRLASLTLECFVQMFPLVAEHVRKCMGEELYQLFLSNAEDLYMKIDSIQADILAANTVNVTKALCLHGSSYSMNTLY 418          
BLAST of Armadillo type fold vs. Ensembl Human
Match: ARMH1 (armadillo like helical domain containing 1 [Source:HGNC Symbol;Acc:HGNC:34345])

HSP 1 Score: 233.802 bits (595), Expect = 2.638e-72
Identity = 127/239 (53.14%), Postives = 172/239 (71.97%), Query Frame = 2
Query:   95 MSSAKQDNATYNVISILQEWDKASKERRKQLLQDFIDQHQQITGPELEMELAQMASLFLARISVWLKLTYMTGTCLTEQLKTLHIFLNASSSQNFLSEFFEXXXXXXXXXXXXXXXSKEIDKEWAVKVLTCVANSGTKYKEVICESYGIRAIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPKAQQLAIQTIRTIQPIVKVAHRALIERIICLLESLHLEVQ 811
            M+S K+  A   ++S LQEWD A K  R  +L  FI+ +Q  T PELE E +Q ASLFL R++  L++TYMT +CL + L+++ IFL+A SS  +L EF E GG+L LLEI  L   KE  K+ +VK+L  +ANSG  YKE+ICESYG+R+IAE +AKSKSEETQ   + LL+ L  GNP+Y NQVYKGLI +LPC SPKAQQL++QT+RT QPI+   H ++++ ++ +L ++HLEVQ
Sbjct:    1 MTSIKEQAAISRLLSFLQEWDNAGKVARSHILDKFIETNQGKTAPELEQEFSQGASLFLVRLTTSLRITYMTDSCLEKLLRSIGIFLSAVSSNRYLIEFLEVGGVLTLLEILGLEKIKEEAKKESVKLLQVIANSGRTYKELICESYGVRSIAEFLAKSKSEETQEEVQVLLDSLVHGNPKYQNQVYKGLIALLPCESPKAQQLSLQTLRTAQPIIGTTHPSIVDCVLKVLGTMHLEVQ 239          
BLAST of Armadillo type fold vs. Ensembl Human
Match: ARMH1 (armadillo like helical domain containing 1 [Source:HGNC Symbol;Acc:HGNC:34345])

HSP 1 Score: 221.476 bits (563), Expect = 2.301e-68
Identity = 121/220 (55.00%), Postives = 157/220 (71.36%), Query Frame = 2
Query:   95 MSSAKQDNATYNVISILQEWDKASKERRKQLLQDFIDQHQQITGPELEMELAQMASLFLARISVWLKLTYMTGTCLTEQLKTLHIFLNASSSQNFLSEFFEXXXXXXXXXXXXXXXSKEIDKEWAVKVLTCVANSGTKYKEVICESYGIRAIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPKAQQLAIQTIRTIQPIVKVAH 754
            M+S K+  A   ++S LQEWD A K  R  +L  FI+ +Q  T PELE E +Q ASLFL R++  L++TYMT +CL + L+++ IFL+A SS  +L EF E GG+L LLEI  L   KE  K+ +VK+L  +ANSG  YKE+ICESYG+R+IAE +AKSKSEETQ   + LL+ L  GNP+Y NQVYKGLI +LPC SPKAQQL++QT+RT QPI+   H
Sbjct:    1 MTSIKEQAAISRLLSFLQEWDNAGKVARSHILDKFIETNQGKTAPELEQEFSQGASLFLVRLTTSLRITYMTDSCLEKLLRSIGIFLSAVSSNRYLIEFLEVGGVLTLLEILGLEKIKEEAKKESVKLLQVIANSGRTYKELICESYGVRSIAEFLAKSKSEETQEEVQVLLDSLVHGNPKYQNQVYKGLIALLPCESPKAQQLSLQTLRTAQPIIGTTH 220          
BLAST of Armadillo type fold vs. Ensembl Human
Match: ARMH1 (armadillo like helical domain containing 1 [Source:HGNC Symbol;Acc:HGNC:34345])

HSP 1 Score: 206.838 bits (525), Expect = 7.051e-63
Identity = 115/209 (55.02%), Postives = 150/209 (71.77%), Query Frame = 2
Query:   95 MSSAKQDNATYNVISILQEWDKASKERRKQLLQDFIDQHQQITGPELEMELAQMASLFLARISVWLKLTYMTGTCLTEQLKTLHIFLNASSSQNFLSEFFEXXXXXXXXXXXXXXXSKEIDKEWAVKVLTCVANSGTKYKEVICESYGIRAIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPKAQQLAIQTI 721
            M+S K+  A   ++S LQEWD A K  R  +L  FI+ +Q  T PELE E +Q ASLFL R++  L++TYMT +CL + L+++ IFL+A SS  +L EF E GG+L LLEI  L   KE  K+ +VK+L  +ANSG  YKE+ICESYG+R+IAE +AKSKSEETQ   + LL+ L  GNP+Y NQVYKGLI +LPC SPKAQQL++QT+
Sbjct:    1 MTSIKEQAAISRLLSFLQEWDNAGKVARSHILDKFIETNQGKTAPELEQEFSQGASLFLVRLTTSLRITYMTDSCLEKLLRSIGIFLSAVSSNRYLIEFLEVGGVLTLLEILGLEKIKEEAKKESVKLLQVIANSGRTYKELICESYGVRSIAEFLAKSKSEETQEEVQVLLDSLVHGNPKYQNQVYKGLIALLPCESPKAQQLSLQTL 209          
BLAST of Armadillo type fold vs. Ensembl Zebrafish
Match: armh1 (armadillo like helical domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-081104-194])

HSP 1 Score: 298.901 bits (764), Expect = 1.922e-97
Identity = 143/274 (52.19%), Postives = 201/274 (73.36%), Query Frame = 2
Query:  470 VKVLTCVANSGTKYKEVICESYGIRAIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPKAQQLAIQTIRTIQPIVKVAHRALIERIICLLESLHLEVQSATIELICDLMNYEIRDDILRGLVMLLKPAKEINPQVIFIE--ETGSSKPPLPVFIQQSTAAKCIRILMNRDIDLADKLIQADVVHNLLYAMGNVEYADSQRQASLSLHVFCQSYPIIDENVREAMGNFLYSAFMKDPEALYVQMTPLQADVLISNKVSI 1285
            +++L  ++N+G KYKE++CESYG++A+AEC+AKS++EETQ T  A LE LA GNP+Y NQVYKGLI +L C SP+AQQL +Q +R +QPIVK AH +++E ++ LL S HLEVQ   IELI +LM+ E+   +LRGLV  LKP KE  P+   +E  E   +   LPV +QQ+ +AK IRIL  R  D++ +L+   V+H+LLYAMGN ++ADSQRQASL+L  F + YP+++E+VR AMG  L+ +FM + + L++ M  +QAD+L SNKV+I
Sbjct:    2 LRLLQIISNTGQKYKELVCESYGVKAVAECLAKSETEETQETAAAFLESLAHGNPKYQNQVYKGLIALLTCTSPRAQQLVLQILRIVQPIVKSAHHSIVEPLLNLLRSPHLEVQHEAIELITELMHSEVGQALLRGLVAFLKPTKERIPKHKILEDQEMAKTTDSLPVLLQQAASAKTIRILAQRSEDVSKELLSLRVIHHLLYAMGNQQHADSQRQASLALEHFVRMYPVVEEHVRRAMGAALFESFMHNVDVLHLSMDDIQADILRSNKVNI 275          
BLAST of Armadillo type fold vs. Ensembl Zebrafish
Match: armh1 (armadillo like helical domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-081104-194])

HSP 1 Score: 283.108 bits (723), Expect = 1.459e-91
Identity = 143/270 (52.96%), Postives = 199/270 (73.70%), Query Frame = 2
Query:   95 MSSAKQDNATYNVISILQEWDKASKERRKQLLQDFIDQHQQITGPELEMELAQMASLFLARISVWLKLTYMTGTCLTEQLKTLHIFLNASSSQNFLSEFFEXXXXXXXXXXXXXXXSKEIDKEWAVKVLTCVANSGTKYKEVICESYGIRAIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPKAQQLAIQTIRTIQPIVKVAHRALIERIICLLESLHLEVQSATIELICDLMNYEIRDDILRGLVMLLKPAK 904
            M S+K+  +   V+  L EWD+A+K  R ++L+DF+D+++  T PELE+E AQ+ASLFL+R++ WL+LTYM GTCL  QL+ + +FL+ SS+  ++ EF E GG+L LLEI      KE DK  A+++L  ++N+G KYKE++CESYG++A+AEC+AKS++EETQ T  A LE LA GNP+Y NQVYKGLI +L C SP+AQQL +Q +R +QPIVK AH +++E ++ LL S HLEVQ   IELI +LM+ E+   +LRGLV  LKP K
Sbjct:    1 MFSSKEQLSISQVMCFLHEWDQANKTVRSRMLRDFLDKNEGKTCPELELEFAQVASLFLSRLTAWLRLTYMFGTCLDLQLRAVGVFLSDSSNHQYMMEFLEVGGVLTLLEILGQDKLKEEDKTEALRLLQIISNTGQKYKELVCESYGVKAVAECLAKSETEETQETAAAFLESLAHGNPKYQNQVYKGLIALLTCTSPRAQQLVLQILRIVQPIVKSAHHSIVEPLLNLLRSPHLEVQHEAIELITELMHSEVGQALLRGLVAFLKPTK 270          
BLAST of Armadillo type fold vs. Ensembl Zebrafish
Match: armh1 (armadillo like helical domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-081104-194])

HSP 1 Score: 272.707 bits (696), Expect = 6.415e-87
Identity = 151/348 (43.39%), Postives = 219/348 (62.93%), Query Frame = 2
Query:   95 MSSAKQDNATYNVISILQEWDKASKERRKQLLQDFIDQHQQITGPELEMELAQMASLFLARISVWLKLTYMTGTCLTEQLKTLHIFLNASSSQNFLSEFFEXXXXXXXXXXXXXXXSKEIDKEWAVKVLTCVANSGTKYKEVICESYGIRAIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPKAQQLAIQTIRTIQPIVKVAHRALIERIICLLESLHLEVQSATIELICDLMNYEIRDDILRGLVMLLKPAKEINPQVIFIEETGSSKPPLPVFIQQSTAAKCIRILMNRDIDLADKLIQADVVHNLLYAMGNVEYADSQRQASLSLHVF 1138
            M S+K+  +   V+  L EWD+A+K  R ++L+DF+D+++  T PELE+E AQ+ASLFL+R++ WL+LTYM GTCL  QL+ + +FL+ SS+  ++ EF E GG+L LLEI      KE DK  A+++L  ++N+G KYKE++CESYG++A+AEC+AKS++EETQ T  A LE LA GNP+Y NQVYKGLI +L C SP+AQQL +Q +R +Q               C +     E+Q +++ ++ D                               +E   +   LPV +QQ+ +AK IRIL  R  D++ +L+   V+H+LLYAMGN ++ADSQRQASL+L V 
Sbjct:    1 MFSSKEQLSISQVMCFLHEWDQANKTVRSRMLRDFLDKNEGKTCPELELEFAQVASLFLSRLTAWLRLTYMFGTCLDLQLRAVGVFLSDSSNHQYMMEFLEVGGVLTLLEILGQDKLKEEDKTEALRLLQIISNTGQKYKELVCESYGVKAVAECLAKSETEETQETAAAFLESLAHGNPKYQNQVYKGLIALLTCTSPRAQQLVLQILRIVQS--------------CAV----FELQLSSLFVLLD-------------------------------QEMAKTTDSLPVLLQQAASAKTIRILAQRSEDVSKELLSLRVIHHLLYAMGNQQHADSQRQASLALEVL 299          
BLAST of Armadillo type fold vs. Ensembl Zebrafish
Match: armh1 (armadillo like helical domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-081104-194])

HSP 1 Score: 255.373 bits (651), Expect = 7.317e-81
Identity = 130/249 (52.21%), Postives = 182/249 (73.09%), Query Frame = 2
Query:   95 MSSAKQDNATYNVISILQEWDKASKERRKQLLQDFIDQHQQITGPELEMELAQMASLFLARISVWLKLTYMTGTCLTEQLKTLHIFLNASSSQNFLSEFFEXXXXXXXXXXXXXXXSKEIDKEWAVKVLTCVANSGTKYKEVICESYGIRAIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPKAQQLAIQTIRTIQPIVKVAHRALIERIICLLESLHLEVQSATIELICDL 841
            M S+K+  +   V+  L EWD+A+K  R ++L+DF+D+++  T PELE+E AQ+ASLFL+R++ WL+LTYM GTCL  QL+ + +FL+ SS+  ++ EF E GG+L LLEI      KE DK  A+++L  ++N+G KYKE++CESYG++A+AEC+AKS++EETQ T  A LE LA GNP+Y NQVYKGLI +L C SP+AQQL +Q +R +QPIVK AH +++E ++ LL S HLEVQ     LI D 
Sbjct:    1 MFSSKEQLSISQVMCFLHEWDQANKTVRSRMLRDFLDKNEGKTCPELELEFAQVASLFLSRLTAWLRLTYMFGTCLDLQLRAVGVFLSDSSNHQYMMEFLEVGGVLTLLEILGQDKLKEEDKTEALRLLQIISNTGQKYKELVCESYGVKAVAECLAKSETEETQETAAAFLESLAHGNPKYQNQVYKGLIALLTCTSPRAQQLVLQILRIVQPIVKSAHHSIVEPLLNLLRSPHLEVQHEGNLLISDF 249          
BLAST of Armadillo type fold vs. Ensembl Zebrafish
Match: armh1 (armadillo like helical domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-081104-194])

HSP 1 Score: 246.899 bits (629), Expect = 3.185e-78
Identity = 123/226 (54.42%), Postives = 172/226 (76.11%), Query Frame = 2
Query:  134 ISILQEWDKASKERRKQLLQDFIDQHQQITGPELEMELAQMASLFLARISVWLKLTYMTGTCLTEQLKTLHIFLNASSSQNFLSEFFEXXXXXXXXXXXXXXXSKEIDKEWAVKVLTCVANSGTKYKEVICESYGIRAIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPKAQQLAIQTIRTIQPIVKVAHRALIERIICLLESLHLEVQ 811
            +  L EWD+A+K  R ++L+DF+D+++  T PELE+E AQ+ASLFL+R++ WL+LTYM GTCL  QL+ + +FL+ SS+  ++ EF E GG+L LLEI      KE DK  A+++L  ++N+G KYKE++CESYG++A+AEC+AKS++EETQ T  A LE LA GNP+Y NQVYKGLI +L C SP+AQQL +Q +R +QPIVK AH +++E ++ LL S HLEVQ
Sbjct:    1 MCFLHEWDQANKTVRSRMLRDFLDKNEGKTCPELELEFAQVASLFLSRLTAWLRLTYMFGTCLDLQLRAVGVFLSDSSNHQYMMEFLEVGGVLTLLEILGQDKLKEEDKTEALRLLQIISNTGQKYKELVCESYGVKAVAECLAKSETEETQETAAAFLESLAHGNPKYQNQVYKGLIALLTCTSPRAQQLVLQILRIVQPIVKSAHHSIVEPLLNLLRSPHLEVQ 226          
BLAST of Armadillo type fold vs. Ensembl Xenopus
Match: rbfox3 (RNA binding fox-1 homolog 3 [Source:Xenbase;Acc:XB-GENE-976381])

HSP 1 Score: 201.06 bits (510), Expect = 4.911e-60
Identity = 111/239 (46.44%), Postives = 161/239 (67.36%), Query Frame = 2
Query:   95 MSSAKQDNATYNVISILQEWDKASKERRKQLLQDFIDQHQQITGPELEMELAQMASLFLARISVWLKLTYMTGTCLTEQLKTLHIFLNASSSQNFLSEFFEXXXXXXXXXXXXXXXSKEIDKEWAVKVLTCVANSGTKYKEVICESYGIRAIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPKAQQLAIQTIRTIQPIVKVAHRALIERIICLLESLHLEVQ 811
            MSS K+  AT  +++ L+EWD  +K  R ++L  FI  +Q  TG +LE E +Q  SLF AR++ W  +TY+    +   + +   F + S+S  +  EF E GGIL LLEI  L++  +  K  A+K+L  +A +G++YKE++CESYG+RA+AEC+AKSK EETQ   + +LEILA GNP+Y  QVYKGLI +LP  SP AQ+LA+QT+R IQ IV   H  +++ ++ +L+S+HLEVQ
Sbjct:    1 MSSFKERKATTMLMAFLKEWDSGTKATRSRMLNKFISLYQGKTGSQLEQEFSQGGSLFFARLTTWFFMTYLDEIFVCNDILS---FPSLSTSNRYNVEFVEDGGILTLLEILGLNNLGDQHKAEALKLLQILAKTGSQYKELVCESYGVRAVAECLAKSKVEETQEQAQVVLEILAHGNPKYQYQVYKGLIALLPSGSPNAQRLALQTLRVIQQIVSTTHPNIVDSLLGVLQSMHLEVQ 236          
BLAST of Armadillo type fold vs. Ensembl Mouse
Match: Armh1 (armadillo-like helical domain containing 1 [Source:MGI Symbol;Acc:MGI:2686507])

HSP 1 Score: 379.793 bits (974), Expect = 1.013e-126
Identity = 196/400 (49.00%), Postives = 279/400 (69.75%), Query Frame = 2
Query:   95 MSSAKQDNATYNVISILQEWDKASKERRKQLLQDFIDQHQQITGPELEMELAQMASLFLARISVWLKLTYMTGTCLTEQLKTLHIFLNASSSQNFLSEFFEXXXXXXXXXXXXXXXSKEIDKEWAVKVLTCVANSGTKYKEVICESYGIRAIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPKAQQLAIQTIRTIQPIVKVAHRALIERIICLLESLHLEVQSATIELICDLMNYEIRDDILRGLVMLLKP----AKEINPQVIFIEETGSSKPPLPVFIQQSTAAKCIRILMNRDIDLADKLIQADVVHNLLYAMGNVEYADSQRQASLSLHVFCQSYPIIDENVREAMGNFLYSAFMKDPEALYVQMTPLQADVLISNKVS 1282
            M+S K+  A   ++S LQEWD A K  R Q+L  FI  ++  TGPELE+E +Q ASLFL R++ WL++ YMTG  L + L+++ IFL+A SS  +L EF E GG+L LLEI  +    E DK+ ++K+L  +AN+G KYKE+ICESYG+RAIAE +AKSKSEETQ   + LLE L  GNP+Y NQVYKGLI +LPC SPKAQ+LA+QT++T Q IV   H ++++R++ +L ++HLEVQ   IELI DL++Y++R  +L+GLV LL P      ++  ++        +   LPVF+QQ+ AAK I IL   D++LA +L+   VVH L+ AMGN ++++SQR ASL+L  F Q +P+++E VR++MG+ LY  F+ D E LY ++  +QAD+L +NKV+
Sbjct:    1 MTSVKEQAAISRLLSFLQEWDNAGKGLRNQILTTFIKTNEGKTGPELELEFSQGASLFLIRVTTWLRIIYMTGLELEKILRSIGIFLSAVSSNRYLLEFLEIGGVLTLLEILGVEKINEEDKKESIKLLQIIANTGRKYKELICESYGVRAIAEFLAKSKSEETQEEVQVLLETLVHGNPKYQNQVYKGLIALLPCESPKAQRLALQTLKTAQSIVGATHPSIVDRVLTVLSTVHLEVQYEAIELIKDLIHYDVRLPLLKGLVALLMPPVKETSKLQAKIFSDSSILQTTTQLPVFLQQAAAAKTIGILARNDLNLAVELLNLRVVHGLMSAMGNTDHSNSQRLASLTLEYFVQMFPLVEEQVRKSMGDELYQLFLNDAEILYTKIDSIQADILAANKVN 400          
BLAST of Armadillo type fold vs. UniProt/SwissProt
Match: sp|A7MBF6|ARMD1_BOVIN (Armadillo-like helical domain containing protein 1 OS=Bos taurus OX=9913 GN=ARMH1 PE=2 SV=1)

HSP 1 Score: 374.015 bits (959), Expect = 1.288e-123
Identity = 195/410 (47.56%), Postives = 286/410 (69.76%), Query Frame = 2
Query:   95 MSSAKQDNATYNVISILQEWDKASKERRKQLLQDFIDQHQQITGPELEMELAQMASLFLARISVWLKLTYMTGTCLTEQLKTLHIFLNASSSQNFLSEFFEXXXXXXXXXXXXXXXSKEIDKEWAVKVLTCVANSGTKYKEVICESYGIRAIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPKAQQLAIQTIRTIQPIVKVAHRALIERIICLLESLHLEVQSATIELICDLMNYEIRDDILRGLVMLLKPA----KEINPQVIFIEETGSSKPPLPVFIQQSTAAKCIRILMNRDIDLADKLIQADVVHNLLYAMGNVEYADSQRQASLSLHVFCQSYPIIDENVREAMGNFLYSAFMKDPEALYVQMTPLQADVLISNKVSIKQALSLERL 1312
            M+S K+  A   ++S LQ+WD A K  R  +L +FI+ +Q  T PELE E +Q ASLFL R++ WL+LTYMTG+ L + L+++ +FL+A SS  +L EF E GG+L LLEI  L+  KE DK+ ++K+L  +ANSG KYKE+ICESYG+R+IAE +AKSKSEETQ   + LL+ L  GNP+Y NQVYKGLI +LPC SPKAQQLA+QT+RT Q I+   H ++++ ++ +L ++HLEVQ   IELI DL+NY++   +L+GLV LL P+     ++  Q++           LP+F+QQ+ AAK I +L   +  LA++++   V+H+L+ AMGN ++++SQRQASL+L  F Q +P+++E+VR+ MG  LY  F+ + E LY+ +  +QAD+L +NKV++ + L L  L
Sbjct:    1 MTSIKEQAAISRLLSFLQDWDNAGKVARSNILNNFIEANQGKTAPELEQEFSQGASLFLVRLTTWLRLTYMTGSPLDKLLRSIGVFLSAVSSNRYLIEFLEVGGVLTLLEILALNKIKEEDKKESIKLLQVIANSGRKYKELICESYGVRSIAEFLAKSKSEETQEEVQVLLDSLIHGNPKYQNQVYKGLIALLPCASPKAQQLALQTLRTAQSIIGTTHPSIVDCVLKVLCTMHLEVQYEAIELIKDLVNYDVCPALLKGLVALLIPSFKETSKLQSQIVSDSSVLELTAHLPLFLQQAAAAKAIGVLARHNTTLAEEMLHLRVIHSLMAAMGNTDHSNSQRQASLTLEYFVQLFPVVEEHVRKTMGEELYKLFLSNAENLYMNIDSIQADILAANKVNVTRVLHLSGL 410          
BLAST of Armadillo type fold vs. UniProt/SwissProt
Match: sp|Q6PIY5|ARMD1_HUMAN (Armadillo-like helical domain containing protein 1 OS=Homo sapiens OX=9606 GN=ARMH1 PE=2 SV=2)

HSP 1 Score: 367.851 bits (943), Expect = 2.718e-121
Identity = 202/424 (47.64%), Postives = 287/424 (67.69%), Query Frame = 2
Query:   95 MSSAKQDNATYNVISILQEWDKASKERRKQLLQDFIDQHQQITGPELEMELAQMASLFLARISVWLKLTYMTGTCLTEQLKTLHIFLNASSSQNFLSEFFEXXXXXXXXXXXXXXXSKEIDKEWAVKVLTCVANSGTKYKEVICESYGIRAIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPKAQQLAIQTIRTIQPIVKVAHRALIERIICLLESLHLEVQSATIELICDLMNYEIRDDILRGLVMLLKPA-KEI---------NPQVIFIEETGSSKPPLPVFIQQSTAAKCIRILMNRDIDLADKLIQADVVHNLLYAMGNVEYADSQRQASLSLHVFCQSYPIIDENVREAMGNFLYSAFMKDPEALYVQMTPLQADVLISNKVSIKQALSLERLMRKMNELY 1336
            M+S K+  A   ++S LQEWD A K  R  +L  FI+ +Q  T PELE E +Q ASLFL R++  L++TYMT +CL + L+++ IFL+A SS  +L EF E GG+L LLEI  L   KE  K+ +VK+L  +ANSG  YKE+ICESYG+R+IAE +AKSKSEETQ   + LL+ L  GNP+Y NQVYKGLI +LPC SPKAQQL++QT+RT QPI+   H ++++ ++ +L ++HLEVQ   IELI DL+ Y++R  +L+GLV LL P+ KEI         +P V+ +       P LP+F+QQ+ AAK I +L   D+ +A++L+   VV  L+ AMGN ++++SQR ASL+L  F Q +P++ E+VR+ MG  LY  F+ + E LY+++  +QAD+L +N V++ +AL L      MN LY
Sbjct:    1 MTSIKEQAAISRLLSFLQEWDNAGKVARSHILDKFIETNQGKTAPELEQEFSQGASLFLVRLTTSLRITYMTDSCLEKLLRSIGIFLSAVSSNRYLIEFLEVGGVLTLLEILGLEKIKEEAKKESVKLLQVIANSGRTYKELICESYGVRSIAEFLAKSKSEETQEEVQVLLDSLVHGNPKYQNQVYKGLIALLPCESPKAQQLSLQTLRTAQPIIGTTHPSIVDCVLKVLGTMHLEVQYEAIELIKDLVGYDVRQALLKGLVALLIPSVKEISKLQAKILSDPSVLQL------TPSLPMFLQQAAAAKAIGVLARNDMSIAEELLYLRVVRGLMAAMGNTDHSNSQRLASLTLECFVQMFPLVAEHVRKCMGEELYQLFLSNAEDLYMKIDSIQADILAANTVNVTKALCLHGSSYSMNTLY 418          
BLAST of Armadillo type fold vs. TrEMBL
Match: A0A267GQR5 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034157g1 PE=4 SV=1)

HSP 1 Score: 476.863 bits (1226), Expect = 8.796e-162
Identity = 233/395 (58.99%), Postives = 314/395 (79.49%), Query Frame = 2
Query:  110 QDNATYNVISILQEWDKASKERRKQLLQDFIDQHQQITGPELEMELAQMASLFLARISVWLKLTYMTGTCLTEQLKTLHIFLNASSSQNFLSEFFEXXXXXXXXXXXXXXXSKEIDKEWAVKVLTCVANSGTKYKEVICESYGIRAIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPKAQQLAIQTIRTIQPIVKVAHRALIERIICLLESLHLEVQSATIELICDLMNYEIRDDILRGLVMLLKPAKEIN---PQVIFIEETGSSKPPLPVFIQQSTAAKCIRILMNRDIDLADKLIQADVVHNLLYAMGNVEYADSQRQASLSLHVFCQSYPIIDENVREAMGNFLYSAFMKDPEALYVQMTPLQADVLISNKVSI 1285
            Q+ AT NV+++L+EWD++SK +R  +L+DFI+QHQ+ +GPELE ELAQMASLFLAR+SVWLKLTYMTGTC+TEQL+T+H+FL+AS+S NF+ EF EHGGI+CLLE+  L  +KE DK+WA+++L C+AN+GTKYKE+ICESYGIRA+AEC+AKSKSE TQ + R LL+ LADGN R++ QVYKGLI VLPC SP AQQ+A+QT+R +QPIVK A+  ++ER+  LL +LHLEVQSATIE I +LM+Y I DD+L+ +V LL+P ++ +         +   +   P+P+++QQ+ AAKCI  L  +   + D+L+    VH+L++AMGN+++ADSQRQAS++L   C+  PI+DE+VREAMG  LY  FM + EALYV MTP+QADVL+SNKV+I
Sbjct:    1 QEVATMNVMNMLREWDQSSKAKRSVILRDFINQHQKKSGPELEFELAQMASLFLARVSVWLKLTYMTGTCVTEQLETIHLFLSASTSHNFMIEFLEHGGIMCLLELLGLKKAKEEDKDWAIRILQCIANAGTKYKEIICESYGIRAVAECLAKSKSERTQDSARYLLQSLADGNARFVEQVYKGLIAVLPCTSPTAQQMAVQTLRFVQPIVKHANPVIVERLTNLLSTLHLEVQSATIEFIKELMHYNIADDLLQAVVTLLRPNRDTSRAEQSGGVGDAGDAGSTPMPIYVQQAAAAKCIGELARQSDRICDRLVYLRAVHHLMFAMGNLDHADSQRQASVALEFLCRKLPIVDEHVREAMGQALYDQFMSNAEALYVDMTPVQADVLVSNKVNI 395          
BLAST of Armadillo type fold vs. TrEMBL
Match: A0A1I8GFC6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 469.929 bits (1208), Expect = 7.224e-159
Identity = 236/400 (59.00%), Postives = 318/400 (79.50%), Query Frame = 2
Query:   95 MSSAKQDNATYNVISILQEWDKASKERRKQLLQDFIDQHQQITGPELEMELAQMASLFLARISVWLKLTYMTGTCLTEQLKTLHIFLNASSSQNFLSEFFEXXXXXXXXXXXXXXXSKEIDKEWAVKVLTCVANSGTKYKEVICESYGIRAIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPKAQQLAIQTIRTIQPIVKVAHRALIERIICLLESLHLEVQSATIELICDLMNYEIRDDILRGLVMLLKPAKEIN---PQVIFIEETGSSKPPLPVFIQQSTAAKCIRILMNRDIDLADKLIQADVVHNLLYAMGNVEYADSQRQASLSLHVFCQSYPIIDENVREAMGNFLYSAFMKDPEALYVQMTPLQADVLISNKVSI 1285
            M S+KQ+ AT NV+++L+EWD++SK +R  +L+DFI+QHQ+ +GPELE ELAQMASLFLAR+SVWLKLTYMTGTC+TEQL+T+H+FL+AS+S NF+ EF EHGGI+CLLE+  L  +KE DK+WA+++L C+AN+GTKYKE+ICESYGIRA+AEC+AKSKSE TQ + R LL+ LADGN R++ QVYKGLI VLPC SP AQQ+A+QT+R +QPIVK A+  ++ER+  LL +LHLEVQSATIE I +LM+Y I DD+L+ +V LL+P ++ +         +   +   P+P+++QQ+ AAKCI  L  +   + D+L+    VH+L++AMGN+++ADSQRQAS++L   C+  PI+DE+VREAMG  LY  FM + EALYV MTP+QADVL+SNKV+I
Sbjct:   10 MGSSKQEVATMNVMNMLREWDQSSKAKRSVILRDFINQHQKKSGPELEFELAQMASLFLARVSVWLKLTYMTGTCVTEQLETIHLFLSASTSHNFMIEFLEHGGIMCLLELLGLKKAKEEDKDWAIRILQCIANAGTKYKEIICESYGIRAVAECLAKSKSERTQDSARYLLQSLADGNARFVEQVYKGLIAVLPCTSPTAQQMAVQTLRFVQPIVKHANPVIVERLTNLLNTLHLEVQSATIEFIKELMHYNIADDLLQAVVTLLRPNRDTSRAEQSGGVGDAGDAGSTPMPIYVQQAAAAKCIGELARQSDRICDRLVYLRAVHHLMFAMGNLDHADSQRQASVALEFLCRKLPIVDEHVREAMGQALYDQFMSNAEALYVDMTPVQADVLVSNKVNI 409          
BLAST of Armadillo type fold vs. TrEMBL
Match: A0A1S3JGS5 (uncharacterized protein C1orf228 homolog OS=Lingula unguis OX=7574 GN=LOC106173143 PE=4 SV=1)

HSP 1 Score: 466.463 bits (1199), Expect = 7.449e-158
Identity = 238/400 (59.50%), Postives = 300/400 (75.00%), Query Frame = 2
Query:   95 MSSAKQDNATYNVISILQEWDKASKERRKQLLQDFIDQHQQITGPELEMELAQMASLFLARISVWLKLTYMTGTCLTEQLKTLHIFLNASSSQNFLSEFFEXXXXXXXXXXXXXXXSKEIDKEWAVKVLTCVANSGTKYKEVICESYGIRAIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPKAQQLAIQTIRTIQPIVKVAHRALIERIICLLESLHLEVQSATIELICDLMNYEIRDDILRGLVMLLKPAKE---INPQVIFIEETGSSKPPLPVFIQQSTAAKCIRILMNRDIDLADKLIQADVVHNLLYAMGNVEYADSQRQASLSLHVFCQSYPIIDENVREAMGNFLYSAFMKDPEALYVQMTPLQADVLISNKVSI 1285
            M SAKQ      V+S+LQEWDK SK  RK++L+DFI Q+Q  TGPELE E AQ ASLFL R++ W++LTYM GTCLTEQL+ L IFL+ASS Q FL+EF E GG+L  LEI  L  +KE DK  A+ +L  VAN+G KYKE+ICESYGIRAIAEC+AKSKSEETQ   R LLE LA GNP++ NQVYKGLI +LPC+SPKAQQ+A QT+R +QPIV  A+  ++E +  LL +LHLEVQ   IELI DLM Y++RDD+L+ LV LL P KE     P+++   E    K PLPVF+QQ+ AAK I IL     +LA+KLIQ  +VHN+++AMGN +YADSQRQAS++L  FC+++PI+D++VR+AMG  LY  FM  P+ LYV MT +QADVL+SNK++I
Sbjct:    1 MGSAKQQTQISKVMSLLQEWDKGSKPVRKKILEDFISQNQNKTGPELEEEFAQAASLFLTRLTAWIRLTYMIGTCLTEQLQALSIFLSASSGQKFLAEFLEVGGVLTTLEIISLKQAKEQDKAQALTLLQHVANAGRKYKELICESYGIRAIAECLAKSKSEETQDCARHLLESLARGNPKFENQVYKGLIALLPCSSPKAQQMAAQTLRIVQPIVGAANPTIVEPLTNLLRTLHLEVQYEAIELIKDLMAYDVRDDLLKVLVQLLHPPKEETIKRPELLDDPEVPQIKAPLPVFVQQAAAAKTIGILARESTELAEKLIQYRMVHNMMFAMGNQDYADSQRQASITLEYFCRTFPIVDDHVRDAMGEALYEQFMAAPDTLYVNMTAIQADVLVSNKINI 400          
BLAST of Armadillo type fold vs. TrEMBL
Match: A0A267FJB0 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034157g2 PE=4 SV=1)

HSP 1 Score: 462.996 bits (1190), Expect = 3.015e-156
Identity = 233/395 (58.99%), Postives = 314/395 (79.49%), Query Frame = 2
Query:  110 QDNATYNVISILQEWDKASKERRKQLLQDFIDQHQQITGPELEMELAQMASLFLARISVWLKLTYMTGTCLTEQLKTLHIFLNASSSQNFLSEFFEXXXXXXXXXXXXXXXSKEIDKEWAVKVLTCVANSGTKYKEVICESYGIRAIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPKAQQLAIQTIRTIQPIVKVAHRALIERIICLLESLHLEVQSATIELICDLMNYEIRDDILRGLVMLLKPAKEIN---PQVIFIEETGSSKPPLPVFIQQSTAAKCIRILMNRDIDLADKLIQADVVHNLLYAMGNVEYADSQRQASLSLHVFCQSYPIIDENVREAMGNFLYSAFMKDPEALYVQMTPLQADVLISNKVSI 1285
            Q+ AT NV+++L+EWD++SK +R  +L+DFI+QHQ+ +GPELE ELAQMASLFLAR+SVWLKLTYMTGTC+TEQL+T+H+FL+AS+S NF+ EF EHGGI+CLLE+  L  +KE DK+WA+++L C+AN+GTKYKE+ICESYGIRA+AEC+AKSKSE TQ + R LL+ LADGN R++ QVYKGLI VLPC SP AQQ+A+QT+R +QPIVK A+  ++ER+  LL +LHLEVQSATIE I +LM+Y I DD+L+ +V LL+P ++ +         +   +   P+P+++QQ+ AAKCI  L  +   + D+L+    VH+L++AMGN+++ADSQRQAS++L   C+  PI+DE+VREAMG  LY  FM + EALYV MTP+QADVL+SNKV+I
Sbjct:    1 QEVATMNVMNMLREWDQSSKAKRSVILRDFINQHQKKSGPELEFELAQMASLFLARVSVWLKLTYMTGTCVTEQLETIHLFLSASTSHNFMIEFLEHGGIMCLLELLGLKKAKEEDKDWAIRILQCIANAGTKYKEIICESYGIRAVAECLAKSKSERTQDSARYLLQSLADGNARFVEQVYKGLIAVLPCTSPTAQQMAVQTLRFVQPIVKHANPVIVERLTNLLNTLHLEVQSATIEFIKELMHYNIADDLLQAVVTLLRPNRDTSRAEQSGGVGDAGDAGSTPMPIYVQQAAAAKCIGELARQSDRICDRLVYLRAVHHLMFAMGNLDHADSQRQASVALEFLCRKLPIVDEHVREAMGQALYDQFMSNAEALYVDMTPVQADVLVSNKVNI 395          
BLAST of Armadillo type fold vs. TrEMBL
Match: A0A1I8IL45 (RING-type domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 480.715 bits (1236), Expect = 1.106e-151
Identity = 236/400 (59.00%), Postives = 318/400 (79.50%), Query Frame = 2
Query:   95 MSSAKQDNATYNVISILQEWDKASKERRKQLLQDFIDQHQQITGPELEMELAQMASLFLARISVWLKLTYMTGTCLTEQLKTLHIFLNASSSQNFLSEFFEXXXXXXXXXXXXXXXSKEIDKEWAVKVLTCVANSGTKYKEVICESYGIRAIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPKAQQLAIQTIRTIQPIVKVAHRALIERIICLLESLHLEVQSATIELICDLMNYEIRDDILRGLVMLLKPAKEIN---PQVIFIEETGSSKPPLPVFIQQSTAAKCIRILMNRDIDLADKLIQADVVHNLLYAMGNVEYADSQRQASLSLHVFCQSYPIIDENVREAMGNFLYSAFMKDPEALYVQMTPLQADVLISNKVSI 1285
            M S+KQ+ AT NV+++L+EWD++SK +R  +L+DFI+QHQ+ +GPELE ELAQMASLFLAR+SVWLKLTYMTGTC+TEQL+T+H+FL+AS+S NF+ EF EHGGI+CLLE+  L  +KE DK+WA+++L C+AN+GTKYKE+ICESYGIRA+AEC+AKSKSE TQ + R LL+ LADGN R++ QVYKGLI VLPC SP AQQ+A+QT+R +QPIVK A+  ++ER+  LL +LHLEVQSATIE I +LM+Y I DD+L+ +V LL+P ++ +         +   +   P+P+++QQ+ AAKCI  L  +   + D+L+    VH+L++AMGN+++ADSQRQAS++L   C+  PI+DE+VREAMG  LY  FM + EALYV MTP+QADVL+SNKV+I
Sbjct: 1005 MGSSKQEVATMNVMNMLREWDQSSKAKRSVILRDFINQHQKKSGPELEFELAQMASLFLARVSVWLKLTYMTGTCVTEQLETIHLFLSASTSHNFMIEFLEHGGIMCLLELLGLKKAKEEDKDWAIRILQCIANAGTKYKEIICESYGIRAVAECLAKSKSERTQDSARYLLQSLADGNARFVEQVYKGLIAVLPCTSPTAQQMAVQTLRFVQPIVKHANPVIVERLTNLLSTLHLEVQSATIEFIKELMHYNIADDLLQAVVTLLRPNRDTSRAEQSGGVGDAGDAGSTPMPIYVQQAAAAKCIGELARQSDRICDRLVYLRAVHHLMFAMGNLDHADSQRQASVALEFLCRKLPIVDEHVREAMGQALYDQFMSNAEALYVDMTPVQADVLVSNKVNI 1404          
BLAST of Armadillo type fold vs. Ensembl Cavefish
Match: armh1 (armadillo like helical domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-081104-194])

HSP 1 Score: 378.252 bits (970), Expect = 1.068e-126
Identity = 194/403 (48.14%), Postives = 283/403 (70.22%), Query Frame = 2
Query:   95 MSSAKQDNATYNVISILQEWDKASKERRKQLLQDFIDQHQQITGPELEMELAQMASLFLARISVWLKLTYMTGTCLTEQLKTLHIFLNASSSQNFLSEFFEXXXXXXXXXXXXXXXSKEIDKEWAVKVLTCVANSGTKYKEVICESYGIRAIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPKAQQLAIQTIRTIQPIVKVAHRALIERIICLLESLHLEVQSATIELICDLMNYEIRDDILRGLVMLLKPAKEINPQVIFIEETGSSKPP--LPVFIQQSTAAKCIRILMNRDIDLADKLIQADVVHNLLYAMGNVEYADSQRQASLSLHVFCQSYPIIDENVREAMGNFLYSAFMKDPEALYVQMTPLQADVLISNKVSIKQAL 1297
            MSS+    A   +++ L+EWD+ S+  R+++LQ F+ Q+   T PELE+E +Q ASLFL RI+VW++LTYM GT L  QLK L +FL+A+  + +L EF E GG+L LLEI     +KE DK  A+++L  ++++G +YKE+ICESYG+RA+A+C+A SKSEETQL+   LLE LA GNP +  QVYKGLI +L C+ PKAQQL +QT+RT+Q +VK A+  ++E ++ LL SLH EVQ   IELI +L   E+R  + R L+ LLKP++E N +   +++    K    LP+F+QQ+ AAK +RIL       +++LI   VVH LLYAMGN E+ D+Q+QASL+L  F +S P+++E+V+ AMG  L+ +FMK+ E LY +M  ++A++L+SNKV+I + +
Sbjct:    1 MSSSVDRAAGRRLLAFLREWDRGSERVRRRMLQTFLSQNTGKTSPELELEFSQAASLFLTRITVWIRLTYMFGTSLDVQLKALGVFLSAAGGRQYLMEFLEVGGVLTLLEILGQKKTKERDKAQALRLLLIISDAGHRYKELICESYGVRAVADCLAWSKSEETQLSAAVLLESLAQGNPSFQQQVYKGLIALLACSCPKAQQLVLQTLRTVQSVVKSAYPGIVEPLLNLLHSLHQEVQHEVIELISELQQTEVRTSLQRSLITLLKPSRERNRKYKNLQDPEMMKMTDLLPLFVQQAAAAKALRILAQSSQRTSEELIHLGVVHQLLYAMGNQEHEDAQKQASLTLEHFVRSDPVVEEHVQRAMGPALFGSFMKNAELLYTRMDDVEAEILLSNKVNISRGI 403          
BLAST of Armadillo type fold vs. Ensembl Nematostella
Match: EDO48169 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJY7])

HSP 1 Score: 396.356 bits (1017), Expect = 2.393e-134
Identity = 203/404 (50.25%), Postives = 282/404 (69.80%), Query Frame = 2
Query:  107 KQDNATYNVISILQEWDKASKERRKQLLQDFIDQHQQITGPELEMELAQMASLFLARISVWLKLTYMTGTCLTEQLKTLHIFLNASSSQNFLSEFFEXXXXXXXXXXXXXXXSKEIDKEWAVKVLTCVANSGTKYKEVICESYGIRAIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPKAQQLAIQTIRTIQPIVKVAHRALIERIICLLESLHLEVQSATIELICDLMNYEIRDDILRGLVMLLKPAK----EINPQVIFIEETGSSKPPLPVFIQQSTAAKCIRILMNRDIDLADKLIQADVVHNLLYAMGNVEYADSQRQASLSLHVFCQSYPIIDENVREAMGNFLYSAFMKDPEALYVQMTPLQADVLISNKVSIKQALSLE 1306
            K D A   V  +LQ WD+ SK  R ++LQ+FI+++Q  TGP LE+E A  ASLFL R++ WL+LTYM G+ +  QL+ + IF+ ASS   FL+EF E GG+L +LEI  L  +KE DK  A+K+L  V NSG +YKE++CES+GIRA+AEC+AKS SEETQ   R LL+ LA+GNP+Y  QVYK LI +L   SPKAQQ+A QT+R +QP+V  A+  +++ ++ LL+SLHLEVQ    ELI DLM+Y++R  +L+GLV LLKP K    E    +I   +    + PLPVF+QQ+ AAK I IL     ++++ L+Q    H LLYAMGN ++ADSQRQA ++L  F +SYP+I+E V+EA+G+  Y  F+  P+ +YV MTP+QADVL+SNK++I   + ++
Sbjct:    2 KNDQAA--VTKLLQTWDRGSKTTRAKILQEFINENQNKTGPALELEFAYSASLFLTRLTAWLRLTYMMGSYVKLQLQAITIFVGASSGHKFLAEFLEVGGVLTVLEILGLKQAKEEDKAQALKLLMHVVNSGRRYKELVCESFGIRAVAECLAKSNSEETQDYARNLLQQLANGNPKYEAQVYKALIALLKSASPKAQQMAAQTLRIVQPVVGTANPTIVDPVLMLLKSLHLEVQYEACELIKDLMSYDVRYSLLQGLVALLKPTKDEIRESADSLIADPDAPQLQAPLPVFVQQAAAAKMIGILAKESPEISEALVQLRATHGLLYAMGNTQHADSQRQAGITLEFFVRSYPLINEKVKEALGDTFYEEFLAHPDTMYVNMTPIQADVLVSNKLNIAGVMEVQ 403          
BLAST of Armadillo type fold vs. Ensembl Medaka
Match: armh1 (armadillo like helical domain containing 1 [Source:NCBI gene;Acc:101165295])

HSP 1 Score: 249.21 bits (635), Expect = 4.697e-76
Identity = 158/400 (39.50%), Postives = 245/400 (61.25%), Query Frame = 2
Query:   95 MSSAKQDNATYNVISILQEWDKASKERRKQLLQDFIDQHQQITGPELEMELAQMASLFLARISVWLKLTYMTGTCLTEQLKTLHIFLNASSSQNFLSEFFEXXXXXXXXXXXXXXXSKEIDKEWAVKVLTCVANSGTKYKEVICESYGIRAIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPKAQQLAIQTIRTIQPIVKVAHRALIERIICLLESLHLEVQSATIELICDLMNYEIRDDILRGLVMLLKPAKE--INPQVIFIEETGSSKPPLPVFIQQSTAAKCIRILMNRDIDLADKLIQADVVHNLLYAMGNVEYADSQRQASLSLHVFCQSYPIIDENVREAMGNFLYSAFMKD-PEALYVQMTPLQADVLISNKVSI 1285
            MSS ++       +  L+ WD+     R +LL+ F++++ + T  ELE++LAQ ASL LARI+VW+++++     L  QLK L IFL+AS+   +L EF + GG++ LL++      +  DK  A+++L  ++++G KYKE ICE  G+  +++CM  S   +      ALLE L+ GNP+Y +Q+Y+ LIG+L    P+AQ L +QT+R++Q  +  AH  ++  ++  L SLHL+VQ     LI DLM   +R  +L GLV LLKP +E    P+V     TGS    L VF+QQ+ AA  IR L   D +++ +L+   VV NLLYA+GN E+ ++Q QASL+L  F +S P +  +VR  MG+ L++AF     + L+++M   QA+VL+SN + I
Sbjct:    1 MSSPEEQANLGRALDFLRRWDRGDGPVRVRLLRSFLNRNARKTFYELEVDLAQTASLLLARITVWMRVSFTAEGFLALQLKALGIFLSASNHDQYLMEFLQGGGVVILLDVLSSSQVQNDDKTEALRLLLNISDAGRKYKEFICEHNGVEILSDCMVGSDGGDA---AGALLESLSHGNPKYQDQIYRSLIGLLTRVRPRAQLLLLQTLRSVQLKLGPAHDGIVAPLLNTLRSLHLDVQDEACNLIRDLMGDGVRVKLLSGLVALLKPVEEETREPEV-----TGS----LAVFVQQAAAATAIRSLAEEDEEISRELLSLGVVPNLLYALGNQEHGEAQIQASLALEHFVRSDPSVGAHVRRVMGSQLFAAFTHSKADTLHMKMDKRQAEVLLSNHLHI 388          
BLAST of Armadillo type fold vs. Planmine SMEST
Match: SMESG000011258.1 (SMESG000011258.1)

HSP 1 Score: 854.744 bits (2207), Expect = 0.000e+0
Identity = 435/435 (100.00%), Postives = 435/435 (100.00%), Query Frame = 2
Query:   95 MSSAKQDNATYNVISILQEWDKASKERRKQLLQDFIDQHQQITGPELEMELAQMASLFLARISVWLKLTYMTGTCLTEQLKTLHIFLNASSSQNFLSEFFEXXXXXXXXXXXXXXXSKEIDKEWAVKVLTCVANSGTKYKEVICESYGIRAIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPKAQQLAIQTIRTIQPIVKVAHRALIERIICLLESLHLEVQSATIELICDLMNYEIRDDILRGLVMLLKPAKEINPQVIFIEETGSSKPPLPVFIQQSTAAKCIRILMNRDIDLADKLIQADVVHNLLYAMGNVEYADSQRQASLSLHVFCQSYPIIDENVREAMGNFLYSAFMKDPEALYVQMTPLQADVLISNKVSIKQALSLERLMRKMNELYPELRPSLSCTAPELLSYRLRG 1399
            MSSAKQDNATYNVISILQEWDKASKERRKQLLQDFIDQHQQITGPELEMELAQMASLFLARISVWLKLTYMTGTCLTEQLKTLHIFLNASSSQNFLSEFFEHGGILCLLEICILHHSKEIDKEWAVKVLTCVANSGTKYKEVICESYGIRAIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPKAQQLAIQTIRTIQPIVKVAHRALIERIICLLESLHLEVQSATIELICDLMNYEIRDDILRGLVMLLKPAKEINPQVIFIEETGSSKPPLPVFIQQSTAAKCIRILMNRDIDLADKLIQADVVHNLLYAMGNVEYADSQRQASLSLHVFCQSYPIIDENVREAMGNFLYSAFMKDPEALYVQMTPLQADVLISNKVSIKQALSLERLMRKMNELYPELRPSLSCTAPELLSYRLRG
Sbjct:    1 MSSAKQDNATYNVISILQEWDKASKERRKQLLQDFIDQHQQITGPELEMELAQMASLFLARISVWLKLTYMTGTCLTEQLKTLHIFLNASSSQNFLSEFFEHGGILCLLEICILHHSKEIDKEWAVKVLTCVANSGTKYKEVICESYGIRAIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPKAQQLAIQTIRTIQPIVKVAHRALIERIICLLESLHLEVQSATIELICDLMNYEIRDDILRGLVMLLKPAKEINPQVIFIEETGSSKPPLPVFIQQSTAAKCIRILMNRDIDLADKLIQADVVHNLLYAMGNVEYADSQRQASLSLHVFCQSYPIIDENVREAMGNFLYSAFMKDPEALYVQMTPLQADVLISNKVSIKQALSLERLMRKMNELYPELRPSLSCTAPELLSYRLRG 435          
BLAST of Armadillo type fold vs. Planmine SMEST
Match: SMESG000011258.1 (SMESG000011258.1)

HSP 1 Score: 784.252 bits (2024), Expect = 0.000e+0
Identity = 400/400 (100.00%), Postives = 400/400 (100.00%), Query Frame = 2
Query:   95 MSSAKQDNATYNVISILQEWDKASKERRKQLLQDFIDQHQQITGPELEMELAQMASLFLARISVWLKLTYMTGTCLTEQLKTLHIFLNASSSQNFLSEFFEXXXXXXXXXXXXXXXSKEIDKEWAVKVLTCVANSGTKYKEVICESYGIRAIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPKAQQLAIQTIRTIQPIVKVAHRALIERIICLLESLHLEVQSATIELICDLMNYEIRDDILRGLVMLLKPAKEINPQVIFIEETGSSKPPLPVFIQQSTAAKCIRILMNRDIDLADKLIQADVVHNLLYAMGNVEYADSQRQASLSLHVFCQSYPIIDENVREAMGNFLYSAFMKDPEALYVQMTPLQADVLISNKVSIKQA 1294
            MSSAKQDNATYNVISILQEWDKASKERRKQLLQDFIDQHQQITGPELEMELAQMASLFLARISVWLKLTYMTGTCLTEQLKTLHIFLNASSSQNFLSEFFEHGGILCLLEICILHHSKEIDKEWAVKVLTCVANSGTKYKEVICESYGIRAIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPKAQQLAIQTIRTIQPIVKVAHRALIERIICLLESLHLEVQSATIELICDLMNYEIRDDILRGLVMLLKPAKEINPQVIFIEETGSSKPPLPVFIQQSTAAKCIRILMNRDIDLADKLIQADVVHNLLYAMGNVEYADSQRQASLSLHVFCQSYPIIDENVREAMGNFLYSAFMKDPEALYVQMTPLQADVLISNKVSIKQA
Sbjct:    1 MSSAKQDNATYNVISILQEWDKASKERRKQLLQDFIDQHQQITGPELEMELAQMASLFLARISVWLKLTYMTGTCLTEQLKTLHIFLNASSSQNFLSEFFEHGGILCLLEICILHHSKEIDKEWAVKVLTCVANSGTKYKEVICESYGIRAIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPKAQQLAIQTIRTIQPIVKVAHRALIERIICLLESLHLEVQSATIELICDLMNYEIRDDILRGLVMLLKPAKEINPQVIFIEETGSSKPPLPVFIQQSTAAKCIRILMNRDIDLADKLIQADVVHNLLYAMGNVEYADSQRQASLSLHVFCQSYPIIDENVREAMGNFLYSAFMKDPEALYVQMTPLQADVLISNKVSIKQA 400          
BLAST of Armadillo type fold vs. Planmine SMEST
Match: SMESG000036629.1 (SMESG000036629.1)

HSP 1 Score: 97.4413 bits (241), Expect = 6.184e-28
Identity = 46/54 (85.19%), Postives = 48/54 (88.89%), Query Frame = 2
Query: 1292 ALSLERLMRKMNELYPELRPSLSCTAPELLSYRLRGRTGIDLFEIVCQHWETPE 1453
            A+SLE  MRKM+ELYPELR  LSCTAPELL YRLRG TGIDLFEIVCQHWETPE
Sbjct:    8 AMSLEIFMRKMDELYPELRLLLSCTAPELLLYRLRGHTGIDLFEIVCQHWETPE 61          

HSP 2 Score: 46.595 bits (109), Expect = 6.184e-28
Identity = 20/27 (74.07%), Postives = 22/27 (81.48%), Query Frame = 1
Query: 1453 SFSIVKKPYQYTYRCEACKDRMRSYNA 1533
             F IV+KPYQ  YRCEAC+DRMRSYN 
Sbjct:   63 DFPIVEKPYQCPYRCEACEDRMRSYNV 89          
BLAST of Armadillo type fold vs. Planmine SMEST
Match: SMESG000000873.1 (SMESG000000873.1)

HSP 1 Score: 47.3654 bits (111), Expect = 7.330e-7
Identity = 22/54 (40.74%), Postives = 35/54 (64.81%), Query Frame = 2
Query: 1286 KQALSLERLMRKMNELYPELRPSLSCTAPELLSYRLRGRTGIDLFEIVCQHWET 1447
            ++A   E ++ KM EL+P ++  LS  APE L+ R+   TGI++ EIV  H+E+
Sbjct:    5 QEAYVFETILMKMEELFPNMKNKLSYCAPEFLATRIYQMTGINIEEIVRMHYES 58          
BLAST of Armadillo type fold vs. Planmine SMEST
Match: SMESG000053908.1 (SMESG000053908.1)

HSP 1 Score: 46.9802 bits (110), Expect = 4.356e-6
Identity = 25/64 (39.06%), Postives = 38/64 (59.38%), Query Frame = 2
Query: 1268 SNKVSIKQALSLER----LMRKMNELYPELRPSLSCTAPELLSYRLRGRTGIDLFEIVCQHWET 1447
            SNK  I    S  +    L+ KM ELYP++   L C AP++L +R++  TG+DL  I+ +H +T
Sbjct:  333 SNKAVISNVFSRRKVNAILIAKMEELYPKICSELICCAPDILPFRIKLDTGLDLEMILEKHLDT 396          

HSP 2 Score: 22.7126 bits (47), Expect = 4.356e-6
Identity = 9/19 (47.37%), Postives = 11/19 (57.89%), Query Frame = 1
Query: 1462 IVKKPYQYTYRCEACKDRM 1518
            IV  P    Y C+AC DR+
Sbjct:  403 IVNHPGVCAYECDACLDRL 421          
The following BLAST results are available for this feature:
BLAST of Armadillo type fold vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARMH15.661e-12247.64armadillo like helical domain containing 1 [Source... [more]
ARMH15.661e-12247.64armadillo like helical domain containing 1 [Source... [more]
ARMH12.638e-7253.14armadillo like helical domain containing 1 [Source... [more]
ARMH12.301e-6855.00armadillo like helical domain containing 1 [Source... [more]
ARMH17.051e-6355.02armadillo like helical domain containing 1 [Source... [more]
back to top
BLAST of Armadillo type fold vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Armadillo type fold vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Armadillo type fold vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
armh11.922e-9752.19armadillo like helical domain containing 1 [Source... [more]
armh11.459e-9152.96armadillo like helical domain containing 1 [Source... [more]
armh16.415e-8743.39armadillo like helical domain containing 1 [Source... [more]
armh17.317e-8152.21armadillo like helical domain containing 1 [Source... [more]
armh13.185e-7854.42armadillo like helical domain containing 1 [Source... [more]
back to top
BLAST of Armadillo type fold vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rbfox34.911e-6046.44RNA binding fox-1 homolog 3 [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of Armadillo type fold vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Armh11.013e-12649.00armadillo-like helical domain containing 1 [Source... [more]
back to top
BLAST of Armadillo type fold vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|A7MBF6|ARMD1_BOVIN1.288e-12347.56Armadillo-like helical domain containing protein 1... [more]
sp|Q6PIY5|ARMD1_HUMAN2.718e-12147.64Armadillo-like helical domain containing protein 1... [more]
back to top
BLAST of Armadillo type fold vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GQR58.796e-16258.99Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8GFC67.224e-15959.00Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1S3JGS57.449e-15859.50uncharacterized protein C1orf228 homolog OS=Lingul... [more]
A0A267FJB03.015e-15658.99Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8IL451.106e-15159.00RING-type domain-containing protein OS=Macrostomum... [more]
back to top
BLAST of Armadillo type fold vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
armh11.068e-12648.14armadillo like helical domain containing 1 [Source... [more]
back to top
BLAST of Armadillo type fold vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Armadillo type fold vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Armadillo type fold vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO481692.393e-13450.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Armadillo type fold vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
armh14.697e-7639.50armadillo like helical domain containing 1 [Source... [more]
back to top
BLAST of Armadillo type fold vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000011258.10.000e+0100.00SMESG000011258.1[more]
SMESG000011258.10.000e+0100.00SMESG000011258.1[more]
SMESG000036629.16.184e-2885.19SMESG000036629.1[more]
SMESG000000873.17.330e-740.74SMESG000000873.1[more]
SMESG000053908.14.356e-639.06SMESG000053908.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020636 ID=SMED30020636|Name=Armadillo type fold|organism=Schmidtea mediterranea sexual|type=transcript|length=1689bp
GTTTCCCCTTGAAATGTCATAGTAATTTGCATTTAATATTTAAAATTAAA
TAGAATTACAACTTGATATTATATTAAATTAACTCAACTAATAAATGAGC
TCAGCTAAGCAAGATAATGCGACTTATAATGTTATAAGCATTCTACAAGA
ATGGGATAAAGCTTCCAAAGAACGACGTAAGCAATTACTACAAGATTTTA
TAGATCAACATCAACAAATAACTGGACCGGAATTGGAAATGGAACTGGCT
CAAATGGCAAGTTTATTCCTGGCTAGAATTTCAGTTTGGCTAAAACTAAC
ATACATGACCGGTACATGCCTCACTGAACAGCTCAAAACTCTTCATATAT
TTCTAAATGCATCAAGCAGTCAGAATTTTCTATCAGAATTTTTTGAACAC
GGAGGTATTCTATGCCTGTTAGAAATTTGTATTTTGCACCATTCTAAGGA
AATCGACAAAGAATGGGCAGTTAAAGTTCTCACTTGTGTAGCAAATTCTG
GAACGAAATACAAAGAAGTCATCTGTGAAAGTTATGGCATTCGTGCTATT
GCCGAATGCATGGCTAAGTCGAAATCAGAAGAAACTCAACTTACCTGTCG
GGCTTTGTTGGAGATTCTAGCTGACGGTAATCCAAGATATTTAAACCAAG
TCTATAAAGGGTTAATTGGAGTTCTTCCATGTAATTCTCCAAAAGCTCAA
CAATTGGCTATTCAAACTATCCGTACTATTCAGCCGATTGTTAAAGTTGC
TCATCGTGCTTTAATAGAGAGAATAATCTGTCTATTAGAGTCGTTGCATT
TGGAAGTTCAGTCTGCAACAATAGAACTTATTTGCGATCTGATGAATTAC
GAAATTCGAGATGACATTCTTCGTGGTCTTGTAATGCTCCTCAAGCCAGC
CAAGGAAATAAATCCCCAAGTAATATTTATTGAAGAAACCGGTTCATCGA
AACCGCCTTTACCGGTATTTATTCAACAATCTACAGCTGCCAAATGCATT
CGAATTCTAATGAACAGGGACATTGATCTGGCAGACAAATTGATACAGGC
AGATGTGGTTCACAATTTACTCTACGCTATGGGAAACGTAGAATACGCTG
ACAGCCAACGTCAAGCCAGTCTCAGTTTACATGTTTTCTGTCAATCATAT
CCGATAATTGATGAAAATGTTCGAGAAGCTATGGGCAACTTTCTCTATTC
TGCGTTTATGAAAGACCCGGAAGCCCTCTATGTTCAAATGACTCCACTTC
AAGCCGATGTTTTAATAAGTAATAAAGTTAGCATAAAACAAGCATTGTCA
CTGGAGAGACTTATGAGAAAAATGAACGAGCTATACCCTGAGCTCCGACC
GTCTTTATCCTGCACGGCTCCAGAATTACTATCATATCGACTCAGAGGTC
GTACGGGAATTGATCTCTTCGAAATCGTTTGTCAACACTGGGAGACACCT
GAAGTTTTTCAATTGTTAAAAAACCATATCAATACACATATCGATGCGAA
GCTTGTAAAGATCGGATGAGATCATACAATGCATGTTACTCCATGATTCA
CAATGCAATACAAGTGCATGTTTAACAAAGACTTGACTAATGAATATATC
AAAGACTATGGTTTTATGATTATTTGTATTTAAAAATATATTTATGAAAA
AATATTTTACAAATTATATTGATTACAAGTATACCAGCG
back to top

protein sequence of SMED30020636-orf-1

>SMED30020636-orf-1 ID=SMED30020636-orf-1|Name=SMED30020636-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=475bp
MSSAKQDNATYNVISILQEWDKASKERRKQLLQDFIDQHQQITGPELEME
LAQMASLFLARISVWLKLTYMTGTCLTEQLKTLHIFLNASSSQNFLSEFF
EHGGILCLLEICILHHSKEIDKEWAVKVLTCVANSGTKYKEVICESYGIR
AIAECMAKSKSEETQLTCRALLEILADGNPRYLNQVYKGLIGVLPCNSPK
AQQLAIQTIRTIQPIVKVAHRALIERIICLLESLHLEVQSATIELICDLM
NYEIRDDILRGLVMLLKPAKEINPQVIFIEETGSSKPPLPVFIQQSTAAK
CIRILMNRDIDLADKLIQADVVHNLLYAMGNVEYADSQRQASLSLHVFCQ
SYPIIDENVREAMGNFLYSAFMKDPEALYVQMTPLQADVLISNKVSIKQA
LSLERLMRKMNELYPELRPSLSCTAPELLSYRLRGRTGIDLFEIVCQHWE
TPEVFQLLKNHINTHIDAKLVKIG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR011989ARM-like
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process