Short transient receptor potential channel

Overview
NameShort transient receptor potential channel
Smed IDSMED30020631
Length (bp)3179
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Short transient receptor potential channel (SMED30020631) t-SNE clustered cells

Violin plots show distribution of expression levels for Short transient receptor potential channel (SMED30020631) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Short transient receptor potential channel (SMED30020631) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Short transient receptor potential channel (SMED30020631) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020631

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30020631SMESG000051161.1 dd_Smed_v4_7609_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020631SMESG000051161.1 dd_Smed_v4_7609_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30020631SMESG000051161.1 dd_Smed_v4_7609_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30020631SMESG000051161.1 dd_Smed_v4_7609_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30020631SMESG000051161.1 dd_Smed_v4_7609_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30020631SMESG000051161.1 dd_Smed_v4_7609_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Short transient receptor potential channel vs. Ensembl Human
Match: TRPC6 (transient receptor potential cation channel subfamily C member 6 [Source:HGNC Symbol;Acc:HGNC:12338])

HSP 1 Score: 401.364 bits (1030), Expect = 3.259e-123
Identity = 263/759 (34.65%), Postives = 408/759 (53.75%), Query Frame = 3
Query:  210 STHLKDKEYIYLNAVEFGEYEMVQKMVED-PEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEK---SHQRQRLRMQN--AKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTI--VKNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITV-ATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLK---SENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILS 2450
            ST L  +E  +L+A E+G   +V+KM+E+   +NVNCVDYMG++A+ LA+ ++++E+ ELLL K     + DALL AIS   + +V+ I+ H  F + ++   S  +  L+  +  A     ++FS D+TP++LAAH   +EI+  LL +G  ++ PHD  C C  C + +  DS      R++ Y+ L+SPAYL+L++ D V +A  L NEL  LA  EK+FK +Y  L++QC  F    +DLCR ++EV+++L+G +  +++    R  L+ +KLA++   KKFVAH NCQ Q+ + +Y  L  +R   +  K      +   LP L +IY F P +K                    +G  ++ P +KF+    S+ +FL L+ + A  R +   L  + +T T+ A  +    FR  T   S +++ +I W+ G I  EC +++T G K Y    +N++D   L ++ AS+  R +  +  + A ++  A          N+TL             +L K    +N  +    R+ W P DP+ +S+ L+A+A V+SFSR+ Y++PA E  GPLQISL R + DI +FM +F ++ VAF++GM NLY Y+  I    N                 AF +   +F TL+W +FG S   S +I+ N                   I  +G  LYG Y   ++I+LLNMLIAM++ SF EI+ D   EWKFARA LW  Y E    LPVPFNL+ S
Sbjct:   92 STSLSIEEERFLDAAEYGNIPVVRKMLEECHSLNVNCVDYMGQNALQLAVANEHLEITELLLKKENLSRVGDALLLAISKGYVRIVEAILSHPAFAEGKRLATSPSQSELQQDDFYAYDEDGTRFSHDVTPIILAAHCQEYEIVHTLLRKGARIERPHDYFCKCNDCNQKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCRNTEEVEAILNGDVETLQSGDHGRPNLSRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLRQQTMAVKFLVVLAVAIGLPFLALIYWFAPCSK--------------------MGKIMRGPFMKFVAHAASFTIFLGLLVMNAADRFEGTKLLPN-ETSTDNAKQL----FRMKTSCFSWMEMLIISWVIGMIWAECKEIWTQGPKEYLFELWNMLDFGMLAIFAASFIARFMAFWHASKAQSIIDA----------NDTL------------KDLTKVTLGDNVKYYNLARIKWDPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYY--IGAKQN----------------EAFTTVEESFKTLFWAIFGLSEVKSVVINYNHK----------------FIENIGYVLYGVYNVTMVIVLLNMLIAMINSSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLVPS 769          
BLAST of Short transient receptor potential channel vs. Ensembl Human
Match: TRPC7 (transient receptor potential cation channel subfamily C member 7 [Source:HGNC Symbol;Acc:HGNC:20754])

HSP 1 Score: 385.571 bits (989), Expect = 4.457e-118
Identity = 263/760 (34.61%), Postives = 412/760 (54.21%), Query Frame = 3
Query:  210 STHLKDKEYIYLNAVEFGEYEMVQKMVEDPE-INVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEK---SHQRQRLRMQN--AKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVI----RYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPS--LPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITV-ATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILS 2450
             T L  +E  +L++ E+G   +V+KM+E+ + +N NCVDYMG++A+ LA+ ++++E+ ELLL K     + DALL AIS   + +V+ I++H  F + ++   S   Q LR  +  A     ++FS DITP++LAAH   +EI+ +LL +G  ++ PHD  C C  C + + +DS      R++ Y+ L+S AYL+L++ D V +A  L NEL +LA  E +FK +Y  L++QC  F    +DLCR ++EV+++L+G +  N +V     R  L+ +KLA++   KKFVAH NCQ Q+   +Y  L  +R  ++   +KF ++   S  LP L + Y   P +K                    +G  L+ P +KF+    S+ +FL L+ V A+ R +    T   +T+T+    I    FR  T   S  ++ ++ W+ G I  EC +++  G + Y    +N++D   L +++AS+  R +   K   A  LY          + ++TL            N  L  E  Y+      WW P DP+ +S+ L+A+A V+SFSR+ Y++PA E  GPLQISL R + DI +FM +F ++ VAF++GM NLY Y+             A+++       PAF +   +F TL+W++FG S   S +      L Y         D  F I  +G  LYG Y   ++++LLNMLIAM++ S+ EI+ D   EWKFARA LWL Y +    LP PFNL+ S
Sbjct:   37 GTSLTPEEERFLDSAEYGNIPVVRKMLEESKTLNFNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARVGDALLLAISKGYVRIVEAILNHPAFAQGQRLTLSPLEQELRDDDFYAYDEDGTRFSHDITPIILAAHCQEYEIVHILLLKGARIERPHDYFCKCNECTEKQRKDSFSHSRSRMNAYKGLASAAYLSLSSEDPVLTALELSNELARLANIETEFKNDYRKLSMQCKDFVVGVLDLCRDTEEVEAILNGDV--NFQVWSDHHRPSLSRIKLAIKYEVKKFVAHPNCQQQLLTMWYENLSGLRQQSI--AVKFLAVFGVSIGLPFLAIAYWIAPCSK--------------------LGRTLRSPFMKFVAHAVSFTIFLGLLVVNASDRFE-GVKTLPNETFTDYPKQI----FRVKTTQFSWTEMLIMKWVLGMIWSECKEIWEEGPREYVLHLWNLLDFGMLSIFVASFTARFMAFLKATEAQ-LY------VDQHVQDDTL-----------HNVSLPPEVAYFTYARDKWW-PSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYY-----------RGAKYN-------PAFTTVEESFKTLFWSIFGLSEVISVV------LKY---------DHKF-IENIGYVLYGVYNVTMVVVLLNMLIAMINNSYQEIEEDADVEWKFARAKLWLSYFDEGRTLPAPFNLVPS 714          
BLAST of Short transient receptor potential channel vs. Ensembl Human
Match: TRPC3 (transient receptor potential cation channel subfamily C member 3 [Source:HGNC Symbol;Acc:HGNC:12335])

HSP 1 Score: 367.081 bits (941), Expect = 2.866e-111
Identity = 253/761 (33.25%), Postives = 403/761 (52.96%), Query Frame = 3
Query:  210 STHLKDKEYIYLNAVEFGEYEMVQKMVEDPE-INVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEK---SHQRQRLRMQN--AKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTI--VKNNKVIRY--PLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITV-ATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADAL---YSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILS 2450
             T L  +E  +L+A E+G   +V+KM+E+ + +NVNCVDYMG++A+ LA+ ++++E+ ELLL K     I DALL AIS   + +V+ I++H  F  +++   S   Q L+  +  A     ++FS DITP++LAAH   +E++ +LL +G  ++ PHD  C C  C + +  DS      R++ Y+ L+SPAYL+L++ D V +A  L NEL +LA  EK+FK +Y  L++QC  F    +DLCR S+EV+++L+G +   +  +V R+   L+ VKLA++   KKFVAH NCQ Q+   +Y  L  +R+  +  K     ++   LP L + Y   P ++                    +G  L+ P +KF+    S+ +FL L+   A+ R +    T    T T+    I    FR  T   +  ++ ++ W+ G +  EC +++  G + Y    +N++D   L +++A++  R +   +   A      Y  E  +++  +  E        +YF +                R  W P DP+ +S+ L+A+A V+SFSR+ Y++PA E  GPLQISL R + DI +FM LF ++  AF++GM  LY Y+    V A                  AF +   +F TL+W++FG S   S +      L Y         D  F I  +G  LYG Y   ++++LLNMLIAM++ S+ EI+ D   EWKFAR+ LWL Y +    LP PF+L+ S
Sbjct:   33 GTSLTAEEERFLDAAEYGNIPVVRKMLEESKTLNVNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARIGDALLLAISKGYVRIVEAILNHPGFAASKRLTLSPCEQELQDDDFYAYDEDGTRFSPDITPIILAAHCQKYEVVHMLLMKGARIERPHDYFCKCGDCMEKQRHDSFSHSRSRINAYKGLASPAYLSLSSEDPVLTALELSNELAKLANIEKEFKNDYRKLSMQCKDFVVGVLDLCRDSEEVEAILNGDLESAEPLEVHRHKASLSRVKLAIKYEVKKFVAHPNCQQQLLTIWYENLSGLREQTIAIKCLVVLVVALGLPFLAIGYWIAPCSR--------------------LGKILRSPFMKFVAHAASFIIFLGLLVFNASDRFE-GITTLPNITVTDYPKQI----FRVKTTQFTWTEMLIMVWVLGMMWSECKELWLEGPREYILQLWNVLDFGMLSIFIAAFTARFLAFLQATKAQQYVDSYVQESDLSEVTLPPEI-------QYFTY---------------ARDKWLPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVLFIMVFFAFMIGMFILYSYYLGAKVNA------------------AFTTVEESFKTLFWSIFGLSEVTSVV------LKY---------DHKF-IENIGYVLYGIYNVTMVVVLLNMLIAMINSSYQEIEDDSDVEWKFARSKLWLSYFDDGKTLPPPFSLVPS 712          
BLAST of Short transient receptor potential channel vs. Ensembl Human
Match: TRPC3 (transient receptor potential cation channel subfamily C member 3 [Source:HGNC Symbol;Acc:HGNC:12335])

HSP 1 Score: 367.466 bits (942), Expect = 1.033e-110
Identity = 253/761 (33.25%), Postives = 403/761 (52.96%), Query Frame = 3
Query:  210 STHLKDKEYIYLNAVEFGEYEMVQKMVEDPE-INVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEK---SHQRQRLRMQN--AKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTI--VKNNKVIRY--PLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITV-ATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADAL---YSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILS 2450
             T L  +E  +L+A E+G   +V+KM+E+ + +NVNCVDYMG++A+ LA+ ++++E+ ELLL K     I DALL AIS   + +V+ I++H  F  +++   S   Q L+  +  A     ++FS DITP++LAAH   +E++ +LL +G  ++ PHD  C C  C + +  DS      R++ Y+ L+SPAYL+L++ D V +A  L NEL +LA  EK+FK +Y  L++QC  F    +DLCR S+EV+++L+G +   +  +V R+   L+ VKLA++   KKFVAH NCQ Q+   +Y  L  +R+  +  K     ++   LP L + Y   P ++                    +G  L+ P +KF+    S+ +FL L+   A+ R +    T    T T+    I    FR  T   +  ++ ++ W+ G +  EC +++  G + Y    +N++D   L +++A++  R +   +   A      Y  E  +++  +  E        +YF +                R  W P DP+ +S+ L+A+A V+SFSR+ Y++PA E  GPLQISL R + DI +FM LF ++  AF++GM  LY Y+    V A                  AF +   +F TL+W++FG S   S +      L Y         D  F I  +G  LYG Y   ++++LLNMLIAM++ S+ EI+ D   EWKFAR+ LWL Y +    LP PF+L+ S
Sbjct:  106 GTSLTAEEERFLDAAEYGNIPVVRKMLEESKTLNVNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARIGDALLLAISKGYVRIVEAILNHPGFAASKRLTLSPCEQELQDDDFYAYDEDGTRFSPDITPIILAAHCQKYEVVHMLLMKGARIERPHDYFCKCGDCMEKQRHDSFSHSRSRINAYKGLASPAYLSLSSEDPVLTALELSNELAKLANIEKEFKNDYRKLSMQCKDFVVGVLDLCRDSEEVEAILNGDLESAEPLEVHRHKASLSRVKLAIKYEVKKFVAHPNCQQQLLTIWYENLSGLREQTIAIKCLVVLVVALGLPFLAIGYWIAPCSR--------------------LGKILRSPFMKFVAHAASFIIFLGLLVFNASDRFE-GITTLPNITVTDYPKQI----FRVKTTQFTWTEMLIMVWVLGMMWSECKELWLEGPREYILQLWNVLDFGMLSIFIAAFTARFLAFLQATKAQQYVDSYVQESDLSEVTLPPEI-------QYFTY---------------ARDKWLPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVLFIMVFFAFMIGMFILYSYYLGAKVNA------------------AFTTVEESFKTLFWSIFGLSEVTSVV------LKY---------DHKF-IENIGYVLYGIYNVTMVVVLLNMLIAMINSSYQEIEDDSDVEWKFARSKLWLSYFDDGKTLPPPFSLVPS 785          
BLAST of Short transient receptor potential channel vs. Ensembl Human
Match: TRPC5 (transient receptor potential cation channel subfamily C member 5 [Source:HGNC Symbol;Acc:HGNC:12337])

HSP 1 Score: 310.457 bits (794), Expect = 1.385e-89
Identity = 229/760 (30.13%), Postives = 380/760 (50.00%), Query Frame = 3
Query:  213 THLKDKEYIYLNAVEFGEYEMVQKMVEDPEI----NVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEKSHQRQRLRMQNAKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVIR---YPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILII 2471
            T L  +E  +LNAVE G+Y  V++ +++ EI    N+NC+D +GRSA+L+A++++N+E++ELLL+   Y  + DALL AI  E +  V+L++ ++   +     Q   L M     +  S+F+ DITP+MLAAHTNN+EII+LL+ +   +  PH I C C  C      DSL     RL+ Y+AL+SP+ +AL++ D + +AF L  EL +L++ E +FK EY  L+ QC  FAK  +D  R+S E++ +L+     + ++     + LA +K+A++  +K+FVA  NCQ  +   +Y      R  + +  +K  + +         I   FP           +S + +IS +  +GLF++ P IKFI    SY  FLF++ +A+                     I + D        + ++  ++ W+ G I  E  +++  G   Y   ++N+MD     LYLA+ +L+ +   K NG+                                               R  W  + P  +++ LFA++N++S  R+  L  A   LGPLQISL RM+ DI++F+ ++ L+++AF  G+  LY+Y+    +      N+ +  +  +    AF +   T  +L+W++FG  +   T +      +                  VG+ ++GTY  + +++LLNMLIAMM+ S+  I      EWKFAR  LW+ Y +  G LP PFN+I S    L +
Sbjct:   27 TELSAEEKAFLNAVEKGDYATVKQALQEAEIYYNVNINCMDPLGRSALLIAIENENLEIMELLLNHSVY--VGDALLYAIRKEVVGAVELLLSYR---RPSGEKQVPTLMMD----TQFSEFTPDITPIMLAAHTNNYEIIKLLVQKRVTIPRPHQIRCNCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAEYEELSQQCKLFAKDLLDQARSSRELEIILNHRDDHSEELDPQKYHDLAKLKVAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRKHWV--VKLLTCMT--------IGFLFP----------MLSIAYLISPRSNLGLFIKKPFIKFICHTASYLTFLFMLLLAS-------------------QHIVRTDLHVQGPPPTVVEWMILPWVLGFIWGEIKEMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAYVKYNGSRP---------------------------------------------REEWEMWHPTLIAEALFAISNILSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETRAIDE---PNNCK-GIRCEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFT----------------EFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSFLYL 673          
BLAST of Short transient receptor potential channel vs. Ensembl Celegans
Match: trp-2 (TRP (Transient receptor potential) channel family; TRP homlogous cation channel protein [Source:UniProtKB/TrEMBL;Acc:G5EE02])

HSP 1 Score: 341.658 bits (875), Expect = 1.303e-102
Identity = 247/777 (31.79%), Postives = 396/777 (50.97%), Query Frame = 3
Query:  210 STHLKDKEYIYLNAVEFGEYEMVQKM---VEDPEINVNCVDYMGRSAILLAMKSDNMEMIELLLD-KLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEKSHQRQRLRMQNAKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGT------IVKNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDVE---FLTADTDTWTEKANTIFKYDFRTNTRIISP--IQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVT--------ANPLSNSAEFSLTLDSAIPAFQSTGSTFH---TLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQI 2462
            ++ L++K++  L + E G+   V+K+   +     N+NC+D +GR+A+L+A++++N+EMIELLLD  +E     DA+L AI  E +  V++I++H      EK  +    R Q  + +  S F+ DITP++LAAH +N+E I+L LD+   +  PHD+ C CP C   + EDSL L   R++ Y AL+SP+ + L+  D +  AF L  EL +L+  E +F+ +Y  L+ +C +F    +D  R S E++ +L+ T      +   N      LA +KLA+Q S+K+FVAH NCQ  + + +Y  +  +R  N I K+ F+ L + S P+  ++Y+  P++ +                    G F + P IKF+    SY  FL L+ +A+ R++V      T D D              R  TR   P  I+ A+  W+ G I +E  Q++  GL  Y ++ +NI+D  +  LYL + ALR +V Y     +AL +  + IA+ +                                 R  W  +DP  +S+C FA AN+ S  ++ ++      LGPL+ISL RM+ DI++F  +++L++ AF  G+  L WY+A +            N  S S ++    +S    ++S  S +H   TL+W LFG       ++D          +   + +  FL    G  ++G+YC   II+LLNMLIAMMS S+  I      EWKFAR+ L+L Y +    LP PFN++ S   I
Sbjct:   29 NSRLREKQF--LLSCERGDIGSVRKLLAGISTETFNINCLDPLGRNALLIAIENENIEMIELLLDHNIE---TGDAILYAIGEENVEAVEIIVEH-----LEKMDKFDSER-QGVEITEHSAFTPDITPIVLAAHKDNYECIKLFLDKKGTVPHPHDVRCSCPECYVAREEDSLRLSRSRINAYRALTSPSLICLSARDPILYAFELSWELKRLSFIENEFRTDYEELSQKCQKFCVHMLDQVRGSKELEVVLNHTTNAWHDVTSANYGNPEKLARLKLAIQLSQKRFVAHPNCQQLLLDIWYEGVESVRCTNFIYKLIFYILGMLSFPLFSLVYLLAPHSSM--------------------GQFAKKPFIKFLSHSGSYIFFLILLIMASQRMNVIDNILRTDDVD--------------RKETRGPPPTIIECAIFLWVLGLIWVEIKQLWECGLYNYCRNLWNILDFITNSLYLCTTALR-VVAYVQVEQEALRANSVHIARHLP--------------------------------RRDWDAWDPTLLSECFFATANIFSSLKLVHIFTVSPHLGPLKISLGRMVIDIVKFFMVYALVLFAFACGLNQLLWYYASMRQNECNLYEQYKNEKSLSYKYEHLKESCDDKYKSCSSIYHTAETLFWALFG-------LVD---------LTHFRLKEDHFLSEWTGKTIFGSYCCCSIIVLLNMLIAMMSNSYQYISDQADIEWKFARSRLFLEYFDDTATLPPPFNIVPSPKSI 711          
BLAST of Short transient receptor potential channel vs. Ensembl Celegans
Match: trp-2 (TRP (Transient receptor potential) channel family; TRP homlogous cation channel protein [Source:UniProtKB/TrEMBL;Acc:G5EE02])

HSP 1 Score: 342.813 bits (878), Expect = 2.164e-102
Identity = 244/777 (31.40%), Postives = 395/777 (50.84%), Query Frame = 3
Query:  210 STHLKDKEYIYLNAVEFGEYEMVQKM---VEDPEINVNCVDYMGRSAILLAMKSDNMEMIELLLD-KLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEKSHQRQRLRMQNAKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGT------IVKNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDVE---FLTADTDTWTEKANTIFKYDFRTNTRIISP--IQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVT--------ANPLSNSAEFSLTLDSAIPAFQSTGSTFH---TLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQI 2462
            ++ L++K+++   + E G+   V+K+   +     N+NC+D +GR+A+L+A++++N+EMIELLLD  +E     DA+L AI  E +  V++I++H   +    S +      Q  + +  S F+ DITP++LAAH +N+E I+L LD+   +  PHD+ C CP C   + EDSL L   R++ Y AL+SP+ + L+  D +  AF L  EL +L+  E +F+ +Y  L+ +C +F    +D  R S E++ +L+ T      +   N      LA +KLA+Q S+K+FVAH NCQ  + + +Y  +  +R  N I K+ F+ L + S P+  ++Y+  P++ +                    G F + P IKF+    SY  FL L+ +A+ R++V      T D D              R  TR   P  I+ A+  W+ G I +E  Q++  GL  Y ++ +NI+D  +  LYL + ALR +V Y     +AL +  + IA+ +                                 R  W  +DP  +S+C FA AN+ S  ++ ++      LGPL+ISL RM+ DI++F  +++L++ AF  G+  L WY+A +            N  S S ++    +S    ++S  S +H   TL+W LFG       ++D          +   + +  FL    G  ++G+YC   II+LLNMLIAMMS S+  I      EWKFAR+ L+L Y +    LP PFN++ S   I
Sbjct:   29 NSRLREKQFLL--SCERGDIGSVRKLLAGISTETFNINCLDPLGRNALLIAIENENIEMIELLLDHNIE---TGDAILYAIGEENVEAVEIIVEHLEKMDKFDSER------QGVEITEHSAFTPDITPIVLAAHKDNYECIKLFLDKKGTVPHPHDVRCSCPECYVAREEDSLRLSRSRINAYRALTSPSLICLSARDPILYAFELSWELKRLSFIENEFRTDYEELSQKCQKFCVHMLDQVRGSKELEVVLNHTTNAWHDVTSANYGNPEKLARLKLAIQLSQKRFVAHPNCQQLLLDIWYEGVESVRCTNFIYKLIFYILGMLSFPLFSLVYLLAPHSSM--------------------GQFAKKPFIKFLSHSGSYIFFLILLIMASQRMNVIDNILRTDDVD--------------RKETRGPPPTIIECAIFLWVLGLIWVEIKQLWECGLYNYCRNLWNILDFITNSLYLCTTALR-VVAYVQVEQEALRANSVHIARHLP--------------------------------RRDWDAWDPTLLSECFFATANIFSSLKLVHIFTVSPHLGPLKISLGRMVIDIVKFFMVYALVLFAFACGLNQLLWYYASMRQNECNLYEQYKNEKSLSYKYEHLKESCDDKYKSCSSIYHTAETLFWALFG-------LVD---------LTHFRLKEDHFLSEWTGKTIFGSYCCCSIIVLLNMLIAMMSNSYQYISDQADIEWKFARSRLFLEYFDDTATLPPPFNIVPSPKSI 711          
BLAST of Short transient receptor potential channel vs. Ensembl Celegans
Match: trp-1 (Transient-receptor-potential-like protein [Source:UniProtKB/Swiss-Prot;Acc:P34586])

HSP 1 Score: 300.442 bits (768), Expect = 5.064e-86
Identity = 227/775 (29.29%), Postives = 385/775 (49.68%), Query Frame = 3
Query:  219 LKDKEYIYLNAVEFGEYEMVQKMVE---DPEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAE-KSHQRQRLRMQNAKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLS--GTIVKNNKVI---RYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQV-ALIF-WIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILII----FSEVRKLFG 2498
            +  +E  +L A E G    +Q+ ++   D  +NVNC+D MGR+A+ +A+ ++NME++ELLL + +   I +ALL AI      LV+++++H    +        Q L   +  ++  +++SSDI+PV+LAA  N  EI+Q+L+ +  +++ PH   C+C  C++ +  DSL   L+R++T+ AL+SPA+++LT+ D + SAF L  +L +LA +E +FKE Y  L+ QC Q++   +  CR+S+EV ++L+  G +  +N  +   +  L+ +KLA++  +K FV+H +CQ  + + +Y  + + +          ++ L+   PI  ++YI  P ++                    +G  ++ P +KF     S+  FL L+T ATF  D  +   +    T           R + R      V +L+F W+ G +  E  Q++  G KRY + ++N +D   + LYL + ++R    Y                                 F +R +  +          R +W+  +P  V++ LFAV NV SF+R+ YL      LGPLQISL  M+ D+ +F  +F LI+ +F +G+  LYWY+       +P ++      T   +   F S   ++ TL W+LF  +    T +  N  ++                  VG  ++  Y    II+LLNMLIAMMS SF  I      EWKF R  LW+ + +    LP PFN+I++   ++ +    F+ VR L G
Sbjct:   46 ISPEERRFLEAAELGNKPTLQECLDYDGDRRLNVNCLDSMGRTALEIAVDNENMEVVELLLQQPD-IRIGNALLCAIREGVYRLVEVLVNHPNITREMLGDGWSQAL---DPSEAASAEYSSDISPVILAAQLNQFEILQMLIRKDASIEKPHRHSCICETCDRERLNDSLQYSLKRINTFRALASPAWMSLTSPDPILSAFKLSWDLQRLAFEEHEFKETYLQLSEQCKQYSCDLLSQCRSSEEVIAILNKDGNVNDDNIDVWASKLSLSRLKLAIKYEQKAFVSHPHCQQLLTSIWYEGIPYRQRSGTWANFFLYAFLLFLWPIFCLMYILMPKSR--------------------LGRLVRSPFMKFFYYSVSFATFLGLLTWATFE-DYRYEKGERGGMT-----------RASDRGPPATWVESLVFTWVIGMLWSEIKQLWEEGFKRYMRQWWNWLDFLMICLYLCTISIRLSAYY--------------------------------IFTYREDPYRYT-------VRTYWTSEEPMLVAEALFAVGNVFSFARIIYLFQTNPYLGPLQISLGCMLVDVAKFCFIFVLIISSFSIGLAQLYWYY-------DPNTDVCLPGATCKHSSNVFSSIADSYLTLLWSLFSITKPEDTDVVENHKIT----------------QWVGQGMFIMYHCTSIIVLLNMLIAMMSHSFQIINDHADLEWKFHRTKLWMAHFDEGSSLPPPFNIIVTPKSLIYVMNCLFNTVRWLLG 722          
BLAST of Short transient receptor potential channel vs. Ensembl Celegans
Match: trp-1 (Transient-receptor-potential-like protein [Source:UniProtKB/Swiss-Prot;Acc:P34586])

HSP 1 Score: 300.442 bits (768), Expect = 6.331e-86
Identity = 227/775 (29.29%), Postives = 385/775 (49.68%), Query Frame = 3
Query:  219 LKDKEYIYLNAVEFGEYEMVQKMVE---DPEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAE-KSHQRQRLRMQNAKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLS--GTIVKNNKVI---RYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQV-ALIF-WIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILII----FSEVRKLFG 2498
            L +  + +L A E G    +Q+ ++   D  +NVNC+D MGR+A+ +A+ ++NME++ELLL + +   I +ALL AI      LV+++++H    +        Q L   +  ++  +++SSDI+PV+LAA  N  EI+Q+L+ +  +++ PH   C+C  C++ +  DSL   L+R++T+ AL+SPA+++LT+ D + SAF L  +L +LA +E +FKE Y  L+ QC Q++   +  CR+S+EV ++L+  G +  +N  +   +  L+ +KLA++  +K FV+H +CQ  + + +Y  + + +          ++ L+   PI  ++YI  P ++                    +G  ++ P +KF     S+  FL L+T ATF  D  +   +    T           R + R      V +L+F W+ G +  E  Q++  G KRY + ++N +D   + LYL + ++R    Y                                 F +R +  +          R +W+  +P  V++ LFAV NV SF+R+ YL      LGPLQISL  M+ D+ +F  +F LI+ +F +G+  LYWY+       +P ++      T   +   F S   ++ TL W+LF  +    T +  N  ++                  VG  ++  Y    II+LLNMLIAMMS SF  I      EWKF R  LW+ + +    LP PFN+I++   ++ +    F+ VR L G
Sbjct:   66 LSNNLFRFLEAAELGNKPTLQECLDYDGDRRLNVNCLDSMGRTALEIAVDNENMEVVELLLQQPD-IRIGNALLCAIREGVYRLVEVLVNHPNITREMLGDGWSQAL---DPSEAASAEYSSDISPVILAAQLNQFEILQMLIRKDASIEKPHRHSCICETCDRERLNDSLQYSLKRINTFRALASPAWMSLTSPDPILSAFKLSWDLQRLAFEEHEFKETYLQLSEQCKQYSCDLLSQCRSSEEVIAILNKDGNVNDDNIDVWASKLSLSRLKLAIKYEQKAFVSHPHCQQLLTSIWYEGIPYRQRSGTWANFFLYAFLLFLWPIFCLMYILMPKSR--------------------LGRLVRSPFMKFFYYSVSFATFLGLLTWATFE-DYRYEKGERGGMT-----------RASDRGPPATWVESLVFTWVIGMLWSEIKQLWEEGFKRYMRQWWNWLDFLMICLYLCTISIRLSAYY--------------------------------IFTYREDPYRYT-------VRTYWTSEEPMLVAEALFAVGNVFSFARIIYLFQTNPYLGPLQISLGCMLVDVAKFCFIFVLIISSFSIGLAQLYWYY-------DPNTDVCLPGATCKHSSNVFSSIADSYLTLLWSLFSITKPEDTDVVENHKIT----------------QWVGQGMFIMYHCTSIIVLLNMLIAMMSHSFQIINDHADLEWKFHRTKLWMAHFDEGSSLPPPFNIIVTPKSLIYVMNCLFNTVRWLLG 742          
BLAST of Short transient receptor potential channel vs. Ensembl Celegans
Match: spe-41 (TRP homologous cation channel protein; TRP-3 channel protein [Source:UniProtKB/TrEMBL;Acc:G5EF09])

HSP 1 Score: 85.8853 bits (211), Expect = 8.579e-17
Identity = 90/377 (23.87%), Postives = 160/377 (42.44%), Query Frame = 3
Query:  339 AILLAMKSDNMEMIEL---LLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEKSHQRQRLRMQNAKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEK---LKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEK-QFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPS--LPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDVEFLTADTDTW--TEKANTIFKYDF 1436
             ILL    D+  +  L   L+D      +++ALL +I+     LV+ ++    F+ A          ++ +  +    F   +TP+MLA   NN  I+Q L+ RGH + +PH I C C  C++     +  + ++++ R     ALSS AYL L T D  ++   +  +L QLA  ++ ++ E Y  L +   +F     D     DE + +++       ++       +++AM    ++F   +N Q  +++ F        ++ +  K   +  L     +P L M++ F P       KG  M                  P+ +FI  +  Y +FL     A  R  + F  A TD+   T +A  IF Y +
Sbjct:   72 GILLPHGPDDGRLSSLQSLLMDTSSEESLKEALLLSIAVGSRPLVEFVL--VLFVDAP--------YLERSGSANSPHFPPHMTPLMLACILNNFSIVQCLITRGHCIQIPHFITCECKTCKRETVTTHSSTRLVDVMR-----ALSSEAYLWLATDDVFAATCAVARDLQQLASDDQLEYVETYRDLEMNVQRFLCRISDQAWRVDEFNMMVANRNYCPERMTEISSPRLQMAMDSQMRQFTCSTNSQTTIKSVFRSDWY---NYGIKPKRDAWRFLRACILMPFLVMLHAFMPT------KGTTMC----------------VPLARFIAHITMYLVFLI---AAILRPTIGFYFAWTDSIEVTVQALEIFMYAY 405          

HSP 2 Score: 56.225 bits (134), Expect = 1.237e-7
Identity = 59/229 (25.76%), Postives = 113/229 (49.34%), Query Frame = 3
Query: 1788 RLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSA-------EFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNS-TMIDGNMGLSY-PGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLIL 2447
            R+ W  ++   + +   A+A V+S  +  Y     + +G   IS+ + +     ++ +   I+V+F VG+         IIV  +P  N +       +++ T DS    +++ G++   L+W++FG    ++ T + GN G +  P + TL+   S+F I      L   Y  ++II +LN++ +++ K  DE+  +   E+KF RA ++  ++  E   P P NLIL
Sbjct:  465 RMHWPSFEFSLLHEICLAIACVLSILKCFYYAQMMKSIGGSVISVGKCVGKTYTYILIMVAIIVSFSVGL--------NIIV--DPYLNRSTMKIGDQDYTKTTDS----YETIGTSSKNLFWSIFGYLGPSTFTTVVGNTGPNMDPVKHTLN--SSTFEI------LAAVYHGILIITVLNLMTSILVKGADEVLDNEEMEFKFTRAAIYSEFLSWEMAAPPPLNLIL 671          
BLAST of Short transient receptor potential channel vs. Ensembl Fly
Match: Trpgamma (gene:FBgn0032593 transcript:FBtr0080945)

HSP 1 Score: 344.739 bits (883), Expect = 4.458e-101
Identity = 261/834 (31.29%), Postives = 425/834 (50.96%), Query Frame = 3
Query:  228 KEYIYLNAVEFGEY----EMVQKMVEDPEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCL-IEDALLNAISNEKINLVKLIIDHQTFI-KAEKSHQRQRLRMQNAKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLL----SGTIVKNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNL-IEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDV---EFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFA----KIIVTANPLSNSAEFSLTLDS----AIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLF--GFEGLKVQEVNGYEEYI-EANEQKKDLNKMKANMIRRYLFQLQRMKEQENKSGD 2654
            +E  +L AVE G+      M+QK  +   INVNCVD +GR+A+L+A+ ++N+EM+ELL++   Y +  +DALL++IS E +  V++++DH+     +E +H  +      +     S F+ DITP++LAAH +N+EII++LLDRG  L MPHD+ C C  C + + EDSL     R++ Y AL+SP+ +AL++ D + +AF L  EL +L+  E +FK EY  L  QC  FA A +D  RTS E++ LL    +G + ++ +  R  L  +KLA++  +KKFVAHSN Q  + + +Y  L   R  N+ ++ +    + I   PI  + YI  P +                     IG  ++ P IKFI    SYF FLFL+ +A+ R++     +  AD+   +   NT+ +   +   +  + I+  ++ W+ G I  E  Q++  GL+ Y    +N++D  +  LY+A+ ALR +  +++              K MI+                       N++     R  W  +DP  +S+ LF+ AN+ S  ++ Y+      LGPLQ+SL+RM+ DI++F  L+ L++ AF  G+  L WY+A    K     +P+S     + T D         F +   T  TL+W +FG    +S  +DG                        G  ++GTY  + I++LLN+LIAMM+ S+  I      EWKFAR+ LW+ Y E  G  P PFN+I +   I      +R++F  G    + + +        +A+++     ++  N++RRY+   QR  E +  + D
Sbjct:   20 EEKKFLLAVERGDMAGTRRMLQKAQDTEYINVNCVDPLGRTALLMAIDNENLEMVELLIN---YNVDTKDALLHSISEEFVEAVEVLLDHENVTFHSEGNHSWE------SASEDTSTFTPDITPLILAAHRDNYEIIKILLDRGAVLPMPHDVRCGCDECVQSRQEDSLRHSRSRINAYRALASPSLIALSSKDPILTAFELSWELRRLSFLEHEFKNEYQELRKQCQDFATALLDHTRTSHELEILLNHDPTGPVYEHGE--RMHLNRLKLAIKLRQKKFVAHSNVQQLLASIWYEGLPGFRRKNMALQAVDIIRIGI-MFPIFSLAYILAPYSS--------------------IGQTMRKPFIKFICHSASYFTFLFLLMLASQRIETFIGGWFFADS---SGMLNTMEELPTKRGAK-PTFIEWLILAWVSGLIWSEVKQLWDVGLQEYLNDMWNVIDFVTNSLYVATVALRVVSFFQVQ-------------KEMIY-----------------------NSHATDLPRERWDAWDPMLISEGLFSAANIFSSLKLVYIFSVNPHLGPLQVSLSRMVMDIMKFFFLYVLVLFAFGSGLNQLLWYYADLEKKRCPEVSPMSALLNMNGTNDPNACIVWRRFSNLFETTQTLFWAVFGLIDLDSFELDG----------------IKIFTRFWGMLMFGTYSVINIVVLLNLLIAMMNHSYQLISERADVEWKFARSKLWISYFEEGGTCPPPFNIIPTPKSIWYAIKWMRRVFCSGSSAARREHLKTIRRKAQQASDRDFKYQQIMRNLVRRYVTVEQRKAESQGVTED 765          
BLAST of Short transient receptor potential channel vs. Ensembl Fly
Match: Trpgamma (gene:FBgn0032593 transcript:FBtr0080946)

HSP 1 Score: 344.739 bits (883), Expect = 4.458e-101
Identity = 261/834 (31.29%), Postives = 425/834 (50.96%), Query Frame = 3
Query:  228 KEYIYLNAVEFGEY----EMVQKMVEDPEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCL-IEDALLNAISNEKINLVKLIIDHQTFI-KAEKSHQRQRLRMQNAKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLL----SGTIVKNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNL-IEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDV---EFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFA----KIIVTANPLSNSAEFSLTLDS----AIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLF--GFEGLKVQEVNGYEEYI-EANEQKKDLNKMKANMIRRYLFQLQRMKEQENKSGD 2654
            +E  +L AVE G+      M+QK  +   INVNCVD +GR+A+L+A+ ++N+EM+ELL++   Y +  +DALL++IS E +  V++++DH+     +E +H  +      +     S F+ DITP++LAAH +N+EII++LLDRG  L MPHD+ C C  C + + EDSL     R++ Y AL+SP+ +AL++ D + +AF L  EL +L+  E +FK EY  L  QC  FA A +D  RTS E++ LL    +G + ++ +  R  L  +KLA++  +KKFVAHSN Q  + + +Y  L   R  N+ ++ +    + I   PI  + YI  P +                     IG  ++ P IKFI    SYF FLFL+ +A+ R++     +  AD+   +   NT+ +   +   +  + I+  ++ W+ G I  E  Q++  GL+ Y    +N++D  +  LY+A+ ALR +  +++              K MI+                       N++     R  W  +DP  +S+ LF+ AN+ S  ++ Y+      LGPLQ+SL+RM+ DI++F  L+ L++ AF  G+  L WY+A    K     +P+S     + T D         F +   T  TL+W +FG    +S  +DG                        G  ++GTY  + I++LLN+LIAMM+ S+  I      EWKFAR+ LW+ Y E  G  P PFN+I +   I      +R++F  G    + + +        +A+++     ++  N++RRY+   QR  E +  + D
Sbjct:   20 EEKKFLLAVERGDMAGTRRMLQKAQDTEYINVNCVDPLGRTALLMAIDNENLEMVELLIN---YNVDTKDALLHSISEEFVEAVEVLLDHENVTFHSEGNHSWE------SASEDTSTFTPDITPLILAAHRDNYEIIKILLDRGAVLPMPHDVRCGCDECVQSRQEDSLRHSRSRINAYRALASPSLIALSSKDPILTAFELSWELRRLSFLEHEFKNEYQELRKQCQDFATALLDHTRTSHELEILLNHDPTGPVYEHGE--RMHLNRLKLAIKLRQKKFVAHSNVQQLLASIWYEGLPGFRRKNMALQAVDIIRIGI-MFPIFSLAYILAPYSS--------------------IGQTMRKPFIKFICHSASYFTFLFLLMLASQRIETFIGGWFFADS---SGMLNTMEELPTKRGAK-PTFIEWLILAWVSGLIWSEVKQLWDVGLQEYLNDMWNVIDFVTNSLYVATVALRVVSFFQVQ-------------KEMIY-----------------------NSHATDLPRERWDAWDPMLISEGLFSAANIFSSLKLVYIFSVNPHLGPLQVSLSRMVMDIMKFFFLYVLVLFAFGSGLNQLLWYYADLEKKRCPEVSPMSALLNMNGTNDPNACIVWRRFSNLFETTQTLFWAVFGLIDLDSFELDG----------------IKIFTRFWGMLMFGTYSVINIVVLLNLLIAMMNHSYQLISERADVEWKFARSKLWISYFEEGGTCPPPFNIIPTPKSIWYAIKWMRRVFCSGSSAARREHLKTIRRKAQQASDRDFKYQQIMRNLVRRYVTVEQRKAESQGVTED 765          
BLAST of Short transient receptor potential channel vs. Ensembl Fly
Match: Trpgamma (gene:FBgn0032593 transcript:FBtr0335144)

HSP 1 Score: 344.739 bits (883), Expect = 9.923e-101
Identity = 261/834 (31.29%), Postives = 425/834 (50.96%), Query Frame = 3
Query:  228 KEYIYLNAVEFGEY----EMVQKMVEDPEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCL-IEDALLNAISNEKINLVKLIIDHQTFI-KAEKSHQRQRLRMQNAKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLL----SGTIVKNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNL-IEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDV---EFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFA----KIIVTANPLSNSAEFSLTLDSAI----PAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLF--GFEGLKVQEVNGYEEYI-EANEQKKDLNKMKANMIRRYLFQLQRMKEQENKSGD 2654
            +E  +L AVE G+      M+QK  +   INVNCVD +GR+A+L+A+ ++N+EM+ELL++   Y +  +DALL++IS E +  V++++DH+     +E +H  +      +     S F+ DITP++LAAH +N+EII++LLDRG  L MPHD+ C C  C + + EDSL     R++ Y AL+SP+ +AL++ D + +AF L  EL +L+  E +FK EY  L  QC  FA A +D  RTS E++ LL    +G + ++ +  R  L  +KLA++  +KKFVAHSN Q  + + +Y  L   R  N+ ++ +    + I   PI  + YI  P +                     IG  ++ P IKFI    SYF FLFL+ +A+ R++     +  AD+   +   NT+ +   +   +  + I+  ++ W+ G I  E  Q++  GL+ Y    +N++D  +  LY+A+ ALR +  +++              K MI+                       N++     R  W  +DP  +S+ LF+ AN+ S  ++ Y+      LGPLQ+SL+RM+ DI++F  L+ L++ AF  G+  L WY+A    K     +P+S     + T D         F +   T  TL+W +FG    +S  +DG                        G  ++GTY  + I++LLN+LIAMM+ S+  I      EWKFAR+ LW+ Y E  G  P PFN+I +   I      +R++F  G    + + +        +A+++     ++  N++RRY+   QR  E +  + D
Sbjct:   81 EEKKFLLAVERGDMAGTRRMLQKAQDTEYINVNCVDPLGRTALLMAIDNENLEMVELLIN---YNVDTKDALLHSISEEFVEAVEVLLDHENVTFHSEGNHSWE------SASEDTSTFTPDITPLILAAHRDNYEIIKILLDRGAVLPMPHDVRCGCDECVQSRQEDSLRHSRSRINAYRALASPSLIALSSKDPILTAFELSWELRRLSFLEHEFKNEYQELRKQCQDFATALLDHTRTSHELEILLNHDPTGPVYEHGE--RMHLNRLKLAIKLRQKKFVAHSNVQQLLASIWYEGLPGFRRKNMALQAVDIIRIGI-MFPIFSLAYILAPYSS--------------------IGQTMRKPFIKFICHSASYFTFLFLLMLASQRIETFIGGWFFADS---SGMLNTMEELPTKRGAK-PTFIEWLILAWVSGLIWSEVKQLWDVGLQEYLNDMWNVIDFVTNSLYVATVALRVVSFFQVQ-------------KEMIY-----------------------NSHATDLPRERWDAWDPMLISEGLFSAANIFSSLKLVYIFSVNPHLGPLQVSLSRMVMDIMKFFFLYVLVLFAFGSGLNQLLWYYADLEKKRCPEVSPMSALLNMNGTNDPNACIVWRRFSNLFETTQTLFWAVFGLIDLDSFELDG----------------IKIFTRFWGMLMFGTYSVINIVVLLNLLIAMMNHSYQLISERADVEWKFARSKLWISYFEEGGTCPPPFNIIPTPKSIWYAIKWMRRVFCSGSSAARREHLKTIRRKAQQASDRDFKYQQIMRNLVRRYVTVEQRKAESQGVTED 826          
BLAST of Short transient receptor potential channel vs. Ensembl Fly
Match: trpl (gene:FBgn0005614 transcript:FBtr0088471)

HSP 1 Score: 308.916 bits (790), Expect = 2.179e-88
Identity = 239/814 (29.36%), Postives = 402/814 (49.39%), Query Frame = 3
Query:  249 AVEFGEY----EMVQKMVEDPEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFI-KAEKSHQRQRLRMQNAKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLS--GTIVKNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPL--SNSAEFSLTLDSAIPAFQSTGSTF---HTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLFGFEGLKVQEVNGYEEYIEANEQKKDLNKMKANMIRRYLFQLQRMKEQENKSGD 2654
            AVE G+      ++QK +    IN+NC+D +GR A+ LA+ ++N+EM+ELL+  +     +DALL+AI+ E +  V+L+++H+  I K  + +  Q++ +  A       F+ DITP+MLAAH NN EI+++LLDRG A+ +PHDI C C  C +L  EDSL   L R++ Y AL SP+ + LT++D + +AF L  EL  LA  E++ K EY  L  QC +FA   +D  RTS+E+  +L+    +       R  L  +  A+   +KKFVAHSN Q  + + +Y  L   R  ++++K+   + +    P+  +IY+  PN +                     G  ++ P +KF+    SY  FLF++ + + R D +F+     T  +K   + + + R   +  S +++ ++ ++ G +  E  ++F  G+K Y ++ +N +D     LY++   LR                                     Y +    + +     ++   R  W  +DP+ +++ LFA ANV S  ++ +L      LGPLQISL RM+ DI++F  +++L++ AF  G+  L WYFA +  +   +     A++    DS +  ++  G+ F    +L+W  FG       M+         G     +S         G  ++G+Y  + +I+LLN+LIAMMS S+  I      EWKFAR  LW+ Y E    LP PFN++ S   ++ IF +  K    +  K +         +  EQ  + + +  +++ RY+  + R  E    S D
Sbjct:   48 AVERGDMPNVRRILQKALRHQHININCMDPLGRRALTLAIDNENLEMVELLV--VMGVETKDALLHAINAEFVEAVELLLEHEELIYKEGEPYSWQKVDINTA------MFAPDITPLMLAAHKNNFEILRILLDRGAAVPVPHDIRCGCEECVRLTAEDSLRHSLSRVNIYRALCSPSLICLTSNDPIITAFQLSWELRNLALTEQECKSEYMDLRRQCQKFAVDLLDQTRTSNELAIILNYDPQMSSYEPGDRMSLTRLVQAISYKQKKFVAHSNIQQLLSSIWYDGLPGFRRKSIVDKVICIAQVAVLFPLYCLIYMCAPNCR--------------------TGQLMRKPFMKFLIHASSYLFFLFILILVSQRADDDFVRIFGTTRMKK--ELAEQELRQRGQTPSKLELIVVMYVIGFVWEEVQEIFAVGMKSYLRNMWNFIDFLRNSLYVSVMCLRAFA----------------------------------YIQQATEIARDPQMAYIP--REKWHDFDPQLIAEGLFAAANVFSALKLVHLFSINPHLGPLQISLGRMVIDIVKFFFIYTLVLFAFACGLNQLLWYFAALEKSKCYVLPGGEADWGSHGDSCM-KWRRFGNLFESSQSLFWASFG-------MV---------GLDDFELSGIKSYTRFWGLLMFGSYSVINVIVLLNLLIAMMSNSYAMIDEHSDTEWKFARTKLWMSYFEDSATLPPPFNVLPSVKWVIRIFRKSSKTIDRQRSKKR---------KEQEQFSEYDNIMRSLVWRYVAAMHRKFENNPVSED 769          
BLAST of Short transient receptor potential channel vs. Ensembl Fly
Match: trpl (gene:FBgn0005614 transcript:FBtr0301662)

HSP 1 Score: 308.916 bits (790), Expect = 2.179e-88
Identity = 239/814 (29.36%), Postives = 402/814 (49.39%), Query Frame = 3
Query:  249 AVEFGEY----EMVQKMVEDPEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFI-KAEKSHQRQRLRMQNAKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLS--GTIVKNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPL--SNSAEFSLTLDSAIPAFQSTGSTF---HTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLFGFEGLKVQEVNGYEEYIEANEQKKDLNKMKANMIRRYLFQLQRMKEQENKSGD 2654
            AVE G+      ++QK +    IN+NC+D +GR A+ LA+ ++N+EM+ELL+  +     +DALL+AI+ E +  V+L+++H+  I K  + +  Q++ +  A       F+ DITP+MLAAH NN EI+++LLDRG A+ +PHDI C C  C +L  EDSL   L R++ Y AL SP+ + LT++D + +AF L  EL  LA  E++ K EY  L  QC +FA   +D  RTS+E+  +L+    +       R  L  +  A+   +KKFVAHSN Q  + + +Y  L   R  ++++K+   + +    P+  +IY+  PN +                     G  ++ P +KF+    SY  FLF++ + + R D +F+     T  +K   + + + R   +  S +++ ++ ++ G +  E  ++F  G+K Y ++ +N +D     LY++   LR                                     Y +    + +     ++   R  W  +DP+ +++ LFA ANV S  ++ +L      LGPLQISL RM+ DI++F  +++L++ AF  G+  L WYFA +  +   +     A++    DS +  ++  G+ F    +L+W  FG       M+         G     +S         G  ++G+Y  + +I+LLN+LIAMMS S+  I      EWKFAR  LW+ Y E    LP PFN++ S   ++ IF +  K    +  K +         +  EQ  + + +  +++ RY+  + R  E    S D
Sbjct:   48 AVERGDMPNVRRILQKALRHQHININCMDPLGRRALTLAIDNENLEMVELLV--VMGVETKDALLHAINAEFVEAVELLLEHEELIYKEGEPYSWQKVDINTA------MFAPDITPLMLAAHKNNFEILRILLDRGAAVPVPHDIRCGCEECVRLTAEDSLRHSLSRVNIYRALCSPSLICLTSNDPIITAFQLSWELRNLALTEQECKSEYMDLRRQCQKFAVDLLDQTRTSNELAIILNYDPQMSSYEPGDRMSLTRLVQAISYKQKKFVAHSNIQQLLSSIWYDGLPGFRRKSIVDKVICIAQVAVLFPLYCLIYMCAPNCR--------------------TGQLMRKPFMKFLIHASSYLFFLFILILVSQRADDDFVRIFGTTRMKK--ELAEQELRQRGQTPSKLELIVVMYVIGFVWEEVQEIFAVGMKSYLRNMWNFIDFLRNSLYVSVMCLRAFA----------------------------------YIQQATEIARDPQMAYIP--REKWHDFDPQLIAEGLFAAANVFSALKLVHLFSINPHLGPLQISLGRMVIDIVKFFFIYTLVLFAFACGLNQLLWYFAALEKSKCYVLPGGEADWGSHGDSCM-KWRRFGNLFESSQSLFWASFG-------MV---------GLDDFELSGIKSYTRFWGLLMFGSYSVINVIVLLNLLIAMMSNSYAMIDEHSDTEWKFARTKLWMSYFEDSATLPPPFNVLPSVKWVIRIFRKSSKTIDRQRSKKR---------KEQEQFSEYDNIMRSLVWRYVAAMHRKFENNPVSED 769          
BLAST of Short transient receptor potential channel vs. Ensembl Zebrafish
Match: trpc6b (transient receptor potential cation channel, subfamily C, member 6b [Source:ZFIN;Acc:ZDB-GENE-081030-19])

HSP 1 Score: 399.823 bits (1026), Expect = 4.508e-124
Identity = 274/833 (32.89%), Postives = 429/833 (51.50%), Query Frame = 3
Query:  216 HLKDKEYIYLNAVEFGEYEMVQKMVED-PEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEK-SHQRQRLRMQNAKKSYR---SQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKN---NKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFL-FLITVATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLFGF----------EGLKVQEVNGYEEYIEANE-QKKDLNKMKANMIRRYLFQLQRMKEQENKSGD 2654
            +L   E  +L A E+G   ++++M+E+ PE+NVNCVDYMG++A+ LA+ ++++E+ ELLL K     I DALL AIS   I +V+ I+ HQ F    K +    +   Q+   +Y    ++FS DITP++LA+H + +EI+ +LL +G  +  PHD  C C  C   +  DS      R++ Y+ L+SPAYL+L++ D V +A  L NEL  LA  EK+FK +Y TL++QC  F    +DLCR ++EV+++L+G        +K  R  L  +KLA++   KKFVAH NCQ Q+ + +Y  L  +R      K+     ++  LPIL ++Y   P++K                    +G  ++ P +KF+    S+ +FL  LI  A  R +   L  +       +       FR  T   + +++ +I W+ G I  EC ++++ G + Y    +N++D   L +++ S+  R +  Y  N           +A++ +          K Y +  N  L  E  Y+ R  R+ W P DP+ +S+ L+A+A V+SFSR+ Y++PA E  GPLQISL R + DI +FM +F ++ VAF++GM NLY Y+                         AF +   +F TL+W +FG S   S +I+                +    I  +G  LYG Y   ++I+LLNMLIAM++ SF EI+ D   EWKFARA LW  Y E  G LPVPFNLI S   ++ +   +++L             E  ++ E    +E  E N        ++   +I+RY+     +K Q +K GD
Sbjct:   21 NLSPTEERFLEAAEYGNIPVIRRMLEELPELNVNCVDYMGQNALQLAVANEHLEVTELLLKKENLARIGDALLLAISKGYIRIVEAILSHQAFADTTKLTSSPLQAETQDDFFAYDEDGTRFSHDITPIILASHCHEYEIVHILLRKGACIARPHDYFCKCNGCLYHQRHDSFSHSRSRINAYKGLASPAYLSLSSEDPVLTALELSNELAVLANIEKEFKNDYKTLSMQCKDFVVGLLDLCRNTEEVEAILNGDTEAGGHFDKGDRPNLVRLKLAIKYELKKFVAHPNCQQQLLSIWYENLSGLRQQTTAVKLLVVLGVVVGLPILALLYWIAPSSK--------------------LGKIIRGPFLKFVAHAASFTIFLGLLIMNAADRFEGTSLLPNMTIHDHPSQL-----FRMKTTPFTWMEMLIISWVVGMIWAECKEIWSLGPREYLLEPWNLLDFGMLAIFVTSFIARFMAFYHAN-----------VAQNYV---------DKRYTDLSNITLPLEIEYY-RLARVHWVPSDPQLISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYYRGAKQNG------------------AFTTVEESFKTLFWAIFGLSEVKSVVIN----------------NGHKFIENIGYVLYGVYNVTMVIVLLNMLIAMINNSFQEIEDDADVEWKFARAKLWFSYFEEGGTLPVPFNLIPSPKSVISLAMRLKRLLLIPLHRHKEDLKEDTELNESGKQKESSEKNSPHTSRYQRIMKRLIKRYV-----IKAQTDKEGD 768          
BLAST of Short transient receptor potential channel vs. Ensembl Zebrafish
Match: trpc6a (transient receptor potential cation channel, subfamily C, member 6a [Source:ZFIN;Acc:ZDB-GENE-040724-114])

HSP 1 Score: 393.66 bits (1010), Expect = 2.312e-121
Identity = 279/840 (33.21%), Postives = 439/840 (52.26%), Query Frame = 3
Query:  195 SGLVFSTH---LKDKEYIYLNAVEFGEYEMVQKMVED-PEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEK-SHQRQRLRMQNAKKSYR---SQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVIRYP----LATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLL--IPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITV-ATFRLDVEFLTADTDTWTEKANTIFKYD---FRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLFGFEGLKVQEVNGYEEYIEANEQKKDLNKMKANMIRRYLFQLQRMKE-QENKSGDL 2657
            +  +F+ H   L   E  +L+A E+G   +V++M+E+ PE++VNCVDYMG++A+ LA+ ++++E+ ELLL K     I DALL AIS     +V+ I+ H+ F  + + +    +  M +   +Y    ++FS D+TPV+LA+H + +EI+ +LL +G  ++ PHD  C C  C   +  DS      R++ Y  L+SPAYL+L+  D V +A  L NEL  LA  EK+FK EY  L++QC  F    +DLCR+++EV+++L+G   + +  +  P    L  +KLA++   KKFVAH NCQ Q+ + +Y  L  +R       IKF  +L     LP L M+Y   P +K                    +G  ++ P +KF+    S+ +FL L+ + A  R D   L  +         TI  Y    FR  T   + +++ +I W+ G I  EC ++++ G + Y    +N++D   L +++AS+  R +  +  + A                         + Y +  N +L  E  Y+ R  R+ W P DP+ VS+ L+A+A V+SFSR+ Y++PA E  GPLQISL R + DI +FM +F L+ +AF++GM NLY Y+          +   E          AF +   +F TL+W +FG S   S +                V++    I  +G  LYG Y   V+I+LLNMLIAM++ SF EI+ D   EWKFARA LW  Y E    LPVPFNLI S   +L +      + G +GL ++E++  ++ I    +  +  K+   +++RY+ + Q  KE  E   G+L
Sbjct:   67 AAYMFNGHPNSLTPLEERFLDAAEYGNIPVVRRMLEELPELDVNCVDYMGQNALQLAVANEHLEVTELLLKKDNLSRIGDALLLAISKGYTRIVEAILSHKAFADSRRLTASPSQAPMHDDFFAYDEDGTRFSHDVTPVILASHCHEYEIVHILLGKGARIEQPHDYFCTCDTCNYHQKYDSFCHSRSRINAYRGLASPAYLSLSNEDPVLAALELSNELASLANIEKEFKNEYRKLSMQCKDFVVGLLDLCRSTEEVEAILNG---EEDDTLELPGRPSLIRLKLAIKYELKKFVAHPNCQQQLLSIWYEHLPELR--QQTTAIKFLVVLGVAMGLPFLAMVYWVAPCSK--------------------MGKIMRGPFLKFVAHAASFTIFLGLLVMNAADRFDGTKLLPNM--------TIHDYPTQLFRMKTTPFTWMEMLIISWVIGMIWAECKEIWSQGPREYLLEPWNLLDFGMLAIFVASFISRIMAFWHASSAQRYV--------------------DEHYTDLTNVVLPFEVGYFQRA-RIDWLPSDPQLVSEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFILVFLAFMIGMFNLYSYYRG--------AKQNE----------AFTTVEESFKTLFWAIFGLSEVKSVV----------------VNNGHKFIENIGYVLYGVYNVTVVIVLLNMLIAMINNSFQEIEDDADVEWKFARAKLWFTYFEEGRTLPVPFNLIPSPKSVLSL------VMGVKGL-LRELSVRQKAIMKGSELSE--KIMKRLVKRYIIKAQNDKECDEVNEGEL 809          
BLAST of Short transient receptor potential channel vs. Ensembl Zebrafish
Match: trpc6a (transient receptor potential cation channel, subfamily C, member 6a [Source:ZFIN;Acc:ZDB-GENE-040724-114])

HSP 1 Score: 394.045 bits (1011), Expect = 2.945e-121
Identity = 281/850 (33.06%), Postives = 437/850 (51.41%), Query Frame = 3
Query:  195 SGLVFSTH---LKDKEYIYLNAVEFGEYEMVQKMVED-PEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEK-SHQRQRLRMQNAKKSYR---SQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVIRYP----LATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLL--IPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITV-ATFRLDVEFLTADTDTWTEKANTIFKYD---FRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLFGFEGLKVQEVNGYEEYIEANE----QKKDL------NKMKANMIRRYLFQLQRMKE-QENKSGDL 2657
            +  +F+ H   L   E  +L+A E+G   +V++M+E+ PE++VNCVDYMG++A+ LA+ ++++E+ ELLL K     I DALL AIS     +V+ I+ H+ F  + + +    +  M +   +Y    ++FS D+TPV+LA+H + +EI+ +LL +G  ++ PHD  C C  C   +  DS      R++ Y  L+SPAYL+L+  D V +A  L NEL  LA  EK+FK EY  L++QC  F    +DLCR+++EV+++L+G   + +  +  P    L  +KLA++   KKFVAH NCQ Q+ + +Y  L  +R       IKF  +L     LP L M+Y   P +K                    +G  ++ P +KF+    S+ +FL L+ + A  R D   L  +         TI  Y    FR  T   + +++ +I W+ G I  EC ++++ G + Y    +N++D   L +++AS+  R +  +  + A                         + Y +  N +L  E  Y+ R  R+ W P DP+ VS+ L+A+A V+SFSR+ Y++PA E  GPLQISL R + DI +FM +F L+ +AF++GM NLY Y+          +   E          AF +   +F TL+W +FG S   S +                V++    I  +G  LYG Y   V+I+LLNMLIAM++ SF EI+ D   EWKFARA LW  Y E    LPVPFNLI S   +L +   V+ L     ++ + +    E  E  +    Q K L       K+   +++RY+ + Q  KE  E   G+L
Sbjct:   67 AAYMFNAHPNSLTPLEERFLDAAEYGNIPVVRRMLEELPELDVNCVDYMGQNALQLAVANEHLEVTELLLKKDNLSRIGDALLLAISKGYTRIVEAILSHRAFADSRRLTASPSQAPMHDDFFAYDEDGTRFSHDVTPVILASHCHEYEIVHILLGKGARIEQPHDYFCTCDTCNYHQKYDSFCHSRSRINAYRGLASPAYLSLSNEDPVLAALELSNELASLANIEKEFKNEYRKLSMQCKDFVVGLLDLCRSTEEVEAILNG---EEDDTLELPGRPSLIRLKLAIKYELKKFVAHPNCQQQLLSIWYEHLPELR--QQTTAIKFLVVLGVAMGLPFLAMVYWVAPCSK--------------------MGKIMRGPFLKFVAHAASFTIFLGLLVMNAADRFDGTKLLPNM--------TIHDYPTQLFRMKTTPFTWMEMLIISWVIGMIWAECKEIWSQGPREYLLEPWNLLDFGMLAIFVASFISRIMAFWHASSAQRYV--------------------DEHYTDLTNVVLPFEVGYFQRA-RIDWLPSDPQLVSEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFILVFLAFMIGMFNLYSYYRG--------AKQNE----------AFTTVEESFKTLFWAIFGLSEVKSVV----------------VNNGHKFIENIGYVLYGVYNVTVVIVLLNMLIAMINNSFQEIEDDADVEWKFARAKLWFTYFEEGRTLPVPFNLIPSPKSVLSLVMGVKGLLRELSVRQKAIMKGSELSELGQSKTCQAKTLPRSSRYQKIMKRLVKRYIIKAQNDKECDEVNEGEL 828          
BLAST of Short transient receptor potential channel vs. Ensembl Zebrafish
Match: trpc6a (transient receptor potential cation channel, subfamily C, member 6a [Source:ZFIN;Acc:ZDB-GENE-040724-114])

HSP 1 Score: 393.275 bits (1009), Expect = 5.263e-121
Identity = 281/850 (33.06%), Postives = 437/850 (51.41%), Query Frame = 3
Query:  195 SGLVFSTH---LKDKEYIYLNAVEFGEYEMVQKMVED-PEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEK-SHQRQRLRMQNAKKSYR---SQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVIRYP----LATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLL--IPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITV-ATFRLDVEFLTADTDTWTEKANTIFKYD---FRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLFGFEGLKVQEVNGYEEYIEANE----QKKDL------NKMKANMIRRYLFQLQRMKE-QENKSGDL 2657
            +  +F+ H   L   E  +L+A E+G   +V++M+E+ PE++VNCVDYMG++A+ LA+ ++++E+ ELLL K     I DALL AIS     +V+ I+ H+ F  + + +    +  M +   +Y    ++FS D+TPV+LA+H + +EI+ +LL +G  ++ PHD  C C  C   +  DS      R++ Y  L+SPAYL+L+  D V +A  L NEL  LA  EK+FK EY  L++QC  F    +DLCR+++EV+++L+G   + +  +  P    L  +KLA++   KKFVAH NCQ Q+ + +Y  L  +R       IKF  +L     LP L M+Y   P +K                    +G  ++ P +KF+    S+ +FL L+ + A  R D   L  +         TI  Y    FR  T   + +++ +I W+ G I  EC ++++ G + Y    +N++D   L +++AS+  R +  +  + A                         + Y +  N +L  E  Y+ R  R+ W P DP+ VS+ L+A+A V+SFSR+ Y++PA E  GPLQISL R + DI +FM +F L+ +AF++GM NLY Y+          +   E          AF +   +F TL+W +FG S   S +                V++    I  +G  LYG Y   V+I+LLNMLIAM++ SF EI+ D   EWKFARA LW  Y E    LPVPFNLI S   +L +   V+ L     ++ + +    E  E  +    Q K L       K+   +++RY+ + Q  KE  E   G+L
Sbjct:   67 AAYMFNGHPNSLTPLEERFLDAAEYGNIPVVRRMLEELPELDVNCVDYMGQNALQLAVANEHLEVTELLLKKDNLSRIGDALLLAISKGYTRIVEAILSHKAFADSRRLTASPSQAPMHDDFFAYDEDGTRFSHDVTPVILASHCHEYEIVHILLGKGARIEQPHDYFCTCDTCNYHQKYDSFCHSRSRINAYRGLASPAYLSLSNEDPVLAALELSNELASLANIEKEFKNEYRKLSMQCKDFVVGLLDLCRSTEEVEAILNG---EEDDTLELPGRPSLIRLKLAIKYELKKFVAHPNCQQQLLSIWYEHLPELR--QQTTAIKFLVVLGVAMGLPFLAMVYWVAPCSK--------------------MGKIMRGPFLKFVAHAASFTIFLGLLVMNAADRFDGTKLLPNM--------TIHDYPTQLFRMKTTPFTWMEMLIISWVIGMIWAECKEIWSQGPREYLLEPWNLLDFGMLAIFVASFISRIMAFWHASSAQRYV--------------------DEHYTDLTNVVLPFEVGYFQRA-RIDWLPSDPQLVSEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFILVFLAFMIGMFNLYSYYRG--------AKQNE----------AFTTVEESFKTLFWAIFGLSEVKSVV----------------VNNGHKFIENIGYVLYGVYNVTVVIVLLNMLIAMINNSFQEIEDDADVEWKFARAKLWFTYFEEGRTLPVPFNLIPSPKSVLSLVMGVKGLLRELSVRQKAIMKGSELSELGQSKTCQAKTLPRSSRYQKIMKRLVKRYIIKAQNDKECDEVNEGEL 828          
BLAST of Short transient receptor potential channel vs. Ensembl Zebrafish
Match: trpc7a (transient receptor potential cation channel, subfamily C, member 7a [Source:ZFIN;Acc:ZDB-GENE-091113-40])

HSP 1 Score: 387.882 bits (995), Expect = 2.948e-119
Identity = 259/762 (33.99%), Postives = 407/762 (53.41%), Query Frame = 3
Query:  189 SESGLVFSTHLKDKEYIYLNAVEFGEYEMVQKMVEDPE-INVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTF---IKAEKSHQRQRLRMQN--AKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNN--KVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILS 2450
            SE G    T L ++E  +L+A E+G    V+KM+E+ + +NVNCVDYMG++A+ LA+ ++++E+ ELLL K     + DALL AIS   + +V+ I+ H  F   ++   S   Q LR  +  A     ++FS DITP++LAAH   +EI+ +LL +G  ++ PHD  C C  C + + +DS      R++ Y+ L+S AYL+L++ D V +A  L NEL QLA  E +FK +Y  L++QC  F    +DLCR ++EV+++L+G + +N+  +  R  L+ VKLA++   KKFVAH NCQ ++   +Y  L  +R  ++  K      ++  LP L + Y   P +K                    +G  L+ P +KF+    S+ +FL L+ +          T   +T T+    I    FR  T   S  ++ ++ W+ G I  EC +V+  G + Y    +N++D   L +++AS+  R +    +  + A    +L +  + + N +L       YF +  N                W P DP+ +S+ L+++A V+SFSR+ Y++PA E  GPLQISL R + DI +FM +F ++ +AF++GM NLY Y+             A+++       PAF +   +F TL+W++FG S   S +      L Y         D  F I  +G  LYG Y   ++++LLNMLIAM++ S+ EI+ D   EWKFARA LWL Y +    LP PFNLI S
Sbjct:   25 SERG----TSLTEEEERFLDAAEYGNIPSVRKMLEESKTLNVNCVDYMGQNALQLAVGNEHLEVTELLLKKEGLARVGDALLLAISKGYVRIVEAILAHPAFEGGLRLTLSPLEQELRDDDFYAYDEDGTRFSQDITPMILAAHCKEYEIVHILLLKGARIEKPHDYFCKCGECAEKQKQDSFSHSRSRMNAYKGLASAAYLSLSSEDPVLTALELSNELAQLANIETEFKNDYRKLSMQCKDFVVGVLDLCRNTEEVEAILNGDVDQNHPSEHHRPCLSRVKLAIKYEVKKFVAHPNCQQRLLTLWYENLSGLRQQSIGVKCWTVLGVMVGLPFLAIAYWIMPFSK--------------------VGQVLRSPFMKFVAHAVSFTLFLCLLVLNASDRFAGVKTLPNETITDHPRQI----FRIKTTQFSWTEMLIMKWVLGMIWTECKEVWADGPREYIMHLWNVLDFGMLSVFVASFTARLMA--FLQASQAQLYVDLYVTNANLINASL--PADVAYFTYARNR---------------WLPSDPQLISEGLYSIAVVLSFSRIAYVLPANESFGPLQISLGRTVKDIFKFMVIFIMVFLAFMIGMFNLYSYYL-----------GAKYN-------PAFTTVEESFKTLFWSIFGLSEVISVV------LKY---------DHKF-IENIGYILYGVYNVTMVVVLLNMLIAMINHSYQEIEEDADVEWKFARAKLWLSYFDEGSTLPAPFNLIPS 705          
BLAST of Short transient receptor potential channel vs. Ensembl Xenopus
Match: nup188 (nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-5933085])

HSP 1 Score: 394.045 bits (1011), Expect = 7.438e-122
Identity = 276/831 (33.21%), Postives = 433/831 (52.11%), Query Frame = 3
Query:  210 STHLKDKEYIYLNAVEFGEYEMVQKMVED-PEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEK---SHQRQRLRMQN--AKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVI----RYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPS--LPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITV-ATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLFGFEGLKVQ-EVNGYEEYIEANEQKKDLNKMKANMIRRYLFQLQRMKE-QENKSGDL 2657
            ST L   E  +L+A E+G   +V++M+E+   +NVNCVDYMG++A+ LA+ ++++E+ ELLL K     + DALL AIS   + +V+ I+ H +F + ++   S  +   +  +  A     ++FS DITP++LAAH   +EI+  LL +G  ++ PHD  C C  C + +  DS      R++ Y+ L+SPAYL+L++ D V +A  L NEL  LA  EK+FK +Y  L++QC  F    +DLCR ++EV+++L+G +  N   +    R  L  +KLA++   KKFVAH NCQ Q+ + +Y  L  +R       +KF  +L  +  LP L M+Y   P +K                    +G  ++ P +KF+    S+ +FL L+ + A  R +   +  + ++ T+ A  +    FR  T   S +++ +I W+ G I  EC ++++ G + Y    +NI+D   L ++ AS+  R +  +  + A      +  I                   +  +  L  E  Y+    R+ W P DP+ +S+ L+A+A V+SFSR+ Y++PA E  GPLQISL R + DI +FM +F ++ VAF++GM NLY Y+  +    N                 AF +   +F TL+W +FG S   S +I  N G  +              I  +G  LYG Y   ++I+LLNMLIAM++ SF EI+ D   EWKFARA LW  Y E    LPVPFNL+ S    + I  +V+   GF   +      G +E  E N+      K+   +I+RY+ + Q  KE  E   G+L
Sbjct:   21 STSLSADEERFLDAAEYGNIPVVRRMMEECRSLNVNCVDYMGQNALQLAVANEHLEITELLLKKENLARVGDALLLAISKGYVRIVEAILSHPSFSEGKRLTTSPSQSEFQHDDFYAYDEDGTRFSQDITPIILAAHCQEYEIVHTLLRKGARIERPHDYFCKCTECSEKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCRNTEEVEAILNGDVDTNGGNVELDGRPSLCRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLR--QQTTAVKFLVVLAVAMGLPFLAMVYWIAPCSK--------------------LGKIMRGPFMKFVAHAASFTIFLGLLVMNAADRFEGTKILPN-ESLTDNAKQL----FRMKTSCFSWMELLIISWVIGMIWSECKEIWSQGPREYMFELWNILDFGMLAIFAASFIARFMAFWHASRAQNYVDDDESIK------------------DLSSATLPPEIKYYTLA-RIKWLPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYY--LGAKQN----------------DAFTTVEESFKTLFWAIFGLSEVKSVVI--NYGHKF--------------IENIGYVLYGVYNVTMVIVLLNMLIAMINNSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLVPSPKSFVYIALKVK---GFLNKRFPCNSKGLQEDSEMNK------KIMKRLIKRYVLKAQIDKESDEVNEGEL 762          
BLAST of Short transient receptor potential channel vs. Ensembl Xenopus
Match: nup188 (nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-5933085])

HSP 1 Score: 394.43 bits (1012), Expect = 1.207e-121
Identity = 278/841 (33.06%), Postives = 436/841 (51.84%), Query Frame = 3
Query:  210 STHLKDKEYIYLNAVEFGEYEMVQKMVED-PEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEK---SHQRQRLRMQN--AKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVI----RYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPS--LPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITV-ATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLFGFEGLKVQ-EVNGYEEYIEANEQKKDLN----------KMKANMIRRYLFQLQRMKEQ-ENKSGDL 2657
            ST L   E  +L+A E+G   +V++M+E+   +NVNCVDYMG++A+ LA+ ++++E+ ELLL K     + DALL AIS   + +V+ I+ H +F + ++   S  +   +  +  A     ++FS DITP++LAAH   +EI+  LL +G  ++ PHD  C C  C + +  DS      R++ Y+ L+SPAYL+L++ D V +A  L NEL  LA  EK+FK +Y  L++QC  F    +DLCR ++EV+++L+G +  N   +    R  L  +KLA++   KKFVAH NCQ Q+ + +Y  L  +R       +KF  +L  +  LP L M+Y   P +K                    +G  ++ P +KF+    S+ +FL L+ + A  R +   +  + ++ T+ A  +    FR  T   S +++ +I W+ G I  EC ++++ G + Y    +NI+D   L ++ AS+  R +  +  + A      +  I                   +  +  L  E  Y+    R+ W P DP+ +S+ L+A+A V+SFSR+ Y++PA E  GPLQISL R + DI +FM +F ++ VAF++GM NLY Y+  +    N                 AF +   +F TL+W +FG S   S +I  N G  +              I  +G  LYG Y   ++I+LLNMLIAM++ SF EI+ D   EWKFARA LW  Y E    LPVPFNL+ S    + I  +V+   GF   +      G +E  E N+   +LN          K+   +I+RY+ + Q  KE  E   G+L
Sbjct:   38 STSLSADEERFLDAAEYGNIPVVRRMMEECRSLNVNCVDYMGQNALQLAVANEHLEITELLLKKENLARVGDALLLAISKGYVRIVEAILSHPSFSEGKRLTTSPSQSEFQHDDFYAYDEDGTRFSQDITPIILAAHCQEYEIVHTLLRKGARIERPHDYFCKCTECSEKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCRNTEEVEAILNGDVDTNGGNVELDGRPSLCRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLR--QQTTAVKFLVVLAVAMGLPFLAMVYWIAPCSK--------------------LGKIMRGPFMKFVAHAASFTIFLGLLVMNAADRFEGTKILPN-ESLTDNAKQL----FRMKTSCFSWMELLIISWVIGMIWSECKEIWSQGPREYMFELWNILDFGMLAIFAASFIARFMAFWHASRAQNYVDDDESIK------------------DLSSATLPPEIKYYTLA-RIKWLPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYY--LGAKQN----------------DAFTTVEESFKTLFWAIFGLSEVKSVVI--NYGHKF--------------IENIGYVLYGVYNVTMVIVLLNMLIAMINNSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLVPSPKSFVYIALKVK---GFLNKRFPCNSKGLQEDSEMNKVDGNLNHISHPPTRYQKIMKRLIKRYVLKAQIDKESDEVNEGEL 795          
BLAST of Short transient receptor potential channel vs. Ensembl Xenopus
Match: nup188 (nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-5933085])

HSP 1 Score: 389.808 bits (1000), Expect = 8.205e-120
Identity = 271/829 (32.69%), Postives = 432/829 (52.11%), Query Frame = 3
Query:  210 STHLKDKEYIYLNAVEFGEYEMVQKMVED-PEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEK---SHQRQRLRMQN--AKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVI----RYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPS--LPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITV-ATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLFGFEGLKVQ-EVNGYEEYIEANEQKKDLNKMKANMIRRYLFQLQRMKEQENKSGD 2654
            ST L   E  +L+A E+G   +V++M+E+   +NVNCVDYMG++A+ LA+ ++++E+ ELLL K     + DALL AIS   + +V+ I+ H +F + ++   S  +   +  +  A     ++FS DITP++LAAH   +EI+  LL +G  ++ PHD  C C  C + +  DS      R++ Y+ L+SPAYL+L++ D V +A  L NEL  LA  EK+FK +Y  L++QC  F    +DLCR ++EV+++L+G +  N   +    R  L  +KLA++   KKFVAH NCQ Q+ + +Y  L  +R       +KF  +L  +  LP L M+Y   P +K                    +G  ++ P +KF+    S+ +FL L+ + A  R +   +  + ++ T+ A  +    FR  T   S +++ +I W+ G I  EC ++++ G + Y    +NI+D   L ++ AS+  R +  +  + A      +  I                   +  +  L  E  Y+    R+ W P DP+ +S+ L+A+A V+SFSR+ Y++PA E  GPLQISL R + DI +FM +F ++ VAF++GM NLY Y+  +    N                 AF +   +F TL+W +FG S   S +I  N G  +              I  +G  LYG Y   ++I+LLNMLIAM++ SF EI+ D   EWKFARA LW  Y E    LPVPFNL+ S    + I  +V+   GF   +      G +E  E N+++  ++  + + +  + FQL   K    +S +
Sbjct:   18 STSLSADEERFLDAAEYGNIPVVRRMMEECRSLNVNCVDYMGQNALQLAVANEHLEITELLLKKENLARVGDALLLAISKGYVRIVEAILSHPSFSEGKRLTTSPSQSEFQHDDFYAYDEDGTRFSQDITPIILAAHCQEYEIVHTLLRKGARIERPHDYFCKCTECSEKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCRNTEEVEAILNGDVDTNGGNVELDGRPSLCRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLR--QQTTAVKFLVVLAVAMGLPFLAMVYWIAPCSK--------------------LGKIMRGPFMKFVAHAASFTIFLGLLVMNAADRFEGTKILPN-ESLTDNAKQL----FRMKTSCFSWMELLIISWVIGMIWSECKEIWSQGPREYMFELWNILDFGMLAIFAASFIARFMAFWHASRAQNYVDDDESIK------------------DLSSATLPPEIKYYTLA-RIKWLPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYY--LGAKQN----------------DAFTTVEESFKTLFWAIFGLSEVKSVVI--NYGHKF--------------IENIGYVLYGVYNVTMVIVLLNMLIAMINNSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLVPSPKSFVYIALKVK---GFLNKRFPCNSKGLQEDSEMNKRRGVISPTECHSV-LFPFQLGHSKHSSIRSSE 762          
BLAST of Short transient receptor potential channel vs. Ensembl Xenopus
Match: nup188 (nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-5933085])

HSP 1 Score: 388.267 bits (996), Expect = 9.593e-120
Identity = 260/772 (33.68%), Postives = 408/772 (52.85%), Query Frame = 3
Query:  210 STHLKDKEYIYLNAVEFGEYEMVQKMVED-PEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEK---SHQRQRLRMQN--AKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVI----RYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPS--LPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITV-ATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVR 2486
            ST L   E  +L+A E+G   +V++M+E+   +NVNCVDYMG++A+ LA+ ++++E+ ELLL K     + DALL AIS   + +V+ I+ H +F + ++   S  +   +  +  A     ++FS DITP++LAAH   +EI+  LL +G  ++ PHD  C C  C + +  DS      R++ Y+ L+SPAYL+L++ D V +A  L NEL  LA  EK+FK +Y  L++QC  F    +DLCR ++EV+++L+G +  N   +    R  L  +KLA++   KKFVAH NCQ Q+ + +Y  L  +R       +KF  +L  +  LP L M+Y   P +K                    +G  ++ P +KF+    S+ +FL L+ + A  R +   +  + ++ T+ A  +    FR  T   S +++ +I W+ G I  EC ++++ G + Y    +NI+D   L ++ AS+  R +  +  + A      +  I                   +  +  L  E  Y+    R+ W P DP+ +S+ L+A+A V+SFSR+ Y++PA E  GPLQISL R + DI +FM +F ++ VAF++GM NLY Y+  +    N                 AF +   +F TL+W +FG S   S +I  N G  +              I  +G  LYG Y   ++I+LLNMLIAM++ SF EI+ D   EWKFARA LW  Y E    LPVPFNL+ S    + I  +V+
Sbjct:   17 STSLSADEERFLDAAEYGNIPVVRRMMEECRSLNVNCVDYMGQNALQLAVANEHLEITELLLKKENLARVGDALLLAISKGYVRIVEAILSHPSFSEGKRLTTSPSQSEFQHDDFYAYDEDGTRFSQDITPIILAAHCQEYEIVHTLLRKGARIERPHDYFCKCTECSEKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCRNTEEVEAILNGDVDTNGGNVELDGRPSLCRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLR--QQTTAVKFLVVLAVAMGLPFLAMVYWIAPCSK--------------------LGKIMRGPFMKFVAHAASFTIFLGLLVMNAADRFEGTKILPN-ESLTDNAKQL----FRMKTSCFSWMELLIISWVIGMIWSECKEIWSQGPREYMFELWNILDFGMLAIFAASFIARFMAFWHASRAQNYVDDDESIK------------------DLSSATLPPEIKYYTLA-RIKWLPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYY--LGAKQN----------------DAFTTVEESFKTLFWAIFGLSEVKSVVI--NYGHKF--------------IENIGYVLYGVYNVTMVIVLLNMLIAMINNSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLVPSPKSFVYIALKVK 708          
BLAST of Short transient receptor potential channel vs. Ensembl Xenopus
Match: nup188 (nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-5933085])

HSP 1 Score: 390.193 bits (1001), Expect = 1.309e-119
Identity = 271/829 (32.69%), Postives = 432/829 (52.11%), Query Frame = 3
Query:  210 STHLKDKEYIYLNAVEFGEYEMVQKMVED-PEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEK---SHQRQRLRMQN--AKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVI----RYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPS--LPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITV-ATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLFGFEGLKVQ-EVNGYEEYIEANEQKKDLNKMKANMIRRYLFQLQRMKEQENKSGD 2654
            ST L   E  +L+A E+G   +V++M+E+   +NVNCVDYMG++A+ LA+ ++++E+ ELLL K     + DALL AIS   + +V+ I+ H +F + ++   S  +   +  +  A     ++FS DITP++LAAH   +EI+  LL +G  ++ PHD  C C  C + +  DS      R++ Y+ L+SPAYL+L++ D V +A  L NEL  LA  EK+FK +Y  L++QC  F    +DLCR ++EV+++L+G +  N   +    R  L  +KLA++   KKFVAH NCQ Q+ + +Y  L  +R       +KF  +L  +  LP L M+Y   P +K                    +G  ++ P +KF+    S+ +FL L+ + A  R +   +  + ++ T+ A  +    FR  T   S +++ +I W+ G I  EC ++++ G + Y    +NI+D   L ++ AS+  R +  +  + A      +  I                   +  +  L  E  Y+    R+ W P DP+ +S+ L+A+A V+SFSR+ Y++PA E  GPLQISL R + DI +FM +F ++ VAF++GM NLY Y+  +    N                 AF +   +F TL+W +FG S   S +I  N G  +              I  +G  LYG Y   ++I+LLNMLIAM++ SF EI+ D   EWKFARA LW  Y E    LPVPFNL+ S    + I  +V+   GF   +      G +E  E N+++  ++  + + +  + FQL   K    +S +
Sbjct:   47 STSLSADEERFLDAAEYGNIPVVRRMMEECRSLNVNCVDYMGQNALQLAVANEHLEITELLLKKENLARVGDALLLAISKGYVRIVEAILSHPSFSEGKRLTTSPSQSEFQHDDFYAYDEDGTRFSQDITPIILAAHCQEYEIVHTLLRKGARIERPHDYFCKCTECSEKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCRNTEEVEAILNGDVDTNGGNVELDGRPSLCRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLR--QQTTAVKFLVVLAVAMGLPFLAMVYWIAPCSK--------------------LGKIMRGPFMKFVAHAASFTIFLGLLVMNAADRFEGTKILPN-ESLTDNAKQL----FRMKTSCFSWMELLIISWVIGMIWSECKEIWSQGPREYMFELWNILDFGMLAIFAASFIARFMAFWHASRAQNYVDDDESIK------------------DLSSATLPPEIKYYTLA-RIKWLPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYY--LGAKQN----------------DAFTTVEESFKTLFWAIFGLSEVKSVVI--NYGHKF--------------IENIGYVLYGVYNVTMVIVLLNMLIAMINNSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLVPSPKSFVYIALKVK---GFLNKRFPCNSKGLQEDSEMNKRRGVISPTECHSV-LFPFQLGHSKHSSIRSSE 791          
BLAST of Short transient receptor potential channel vs. Ensembl Mouse
Match: Trpc6 (transient receptor potential cation channel, subfamily C, member 6 [Source:MGI Symbol;Acc:MGI:109523])

HSP 1 Score: 397.512 bits (1020), Expect = 5.999e-122
Identity = 263/759 (34.65%), Postives = 405/759 (53.36%), Query Frame = 3
Query:  210 STHLKDKEYIYLNAVEFGEYEMVQKMVED-PEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEK---SHQRQRLRMQN--AKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSG--TIVKNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITV-ATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLK---SENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILS 2450
            ST L  +E  +L+A E+G   +V+KM+E+   +NVNCVDYMG++A+ LA+ ++++E+ ELLL K     + DALL AIS   + +V+ I++H  F + ++   S  +  L+  +  A     ++FS D+TP++LAAH   +EI+  LL +G  ++ PHD  C C  C + +  DS      R++ Y+ L+SPAYL+L++ D V +A  L NEL  LA  EK+FK +Y  L++QC  F    +DLCR ++EV+++L+G     +     R  L+ +KLA++   KKFVAH NCQ Q+ + +Y  L  +R   +  K      +   LP L +IY   P +K                    +G  L+ P +KF+    S+ +FL L+ + A  R +   L  + +T T+ A  +    FR  T   S +++ +I W+ G I  EC +++T G K Y    +N++D   L ++ AS+  R +  +  + A ++  A          N+TL             +L K    +N  +    R+ W P DP+ +S+ L+A+A V+SFSR+ Y++PA E  GPLQISL R + DI +FM +F ++ VAF++GM NLY Y+  I    N                 AF +   +F TL+W +FG S   S +I+ N                   I  +G  LYG Y   ++I+LLNMLIAM++ SF EI+ D   EWKFARA LW  Y E    LPVPFNL+ S
Sbjct:   91 STSLSIEEERFLDAAEYGNIPVVRKMLEECHSLNVNCVDYMGQNALQLAVANEHLEITELLLKKENLSRVGDALLLAISKGYVRIVEAILNHPAFAEGKRLATSPSQSELQQDDFYAYDEDGTRFSHDVTPIILAAHCQEYEIVHTLLRKGARIERPHDYFCKCTECSQKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYRKLSMQCKDFVVGLLDLCRNTEEVEAILNGDAETRQPGDFGRPNLSRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLRQQTMAVKFLVVLAVAIGLPFLALIYWCAPCSK--------------------MGKILRGPFMKFVAHAASFTIFLGLLVMNAADRFEGTKLLPN-ETSTDNARQL----FRMKTSCFSWMEMLIISWVIGMIWAECKEIWTQGPKEYLFELWNMLDFGMLAIFAASFIARFMAFWHASKAQSIIDA----------NDTL------------KDLTKVTLGDNVKYYNLARIKWDPTDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYY--IGAKQN----------------EAFTTVEESFKTLFWAIFGLSEVKSVVINYNHK----------------FIENIGYVLYGVYNVTMVIVLLNMLIAMINSSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLVPS 768          
BLAST of Short transient receptor potential channel vs. Ensembl Mouse
Match: Trpc7 (transient receptor potential cation channel, subfamily C, member 7 [Source:MGI Symbol;Acc:MGI:1349470])

HSP 1 Score: 385.185 bits (988), Expect = 4.774e-118
Identity = 260/760 (34.21%), Postives = 412/760 (54.21%), Query Frame = 3
Query:  210 STHLKDKEYIYLNAVEFGEYEMVQKMVEDPE-INVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEK---SHQRQRLRMQN--AKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVI----RYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPS--LPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITV-ATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILS 2450
             T L  +E  +L++ E+G   +V+KM+E+ + +N NCVDYMG++A+ LA+ ++++E+ ELLL K     + DALL AIS   + +V+ I+ H  F + ++   S   Q LR  +  A     ++FS DITP++LAAH   +EI+ +LL +G  ++ PHD  C C  C + + +DS      R++ Y+ L+S AYL+L++ D V +A  L NEL +LA  E +FK +Y  L++QC  F    +DLCR ++EV+++L+G +  N +V     R  L+ +KLA++   KKFVAH NCQ Q+   +Y  L  +R  ++   +KF ++   S  LP L + Y   P +K                    +G  L+ P +KF+    S+ +FL L+ V A+ R +    T   +T+T+    I    FR  T   S  ++ ++ W+ G I  EC +++  G + Y    +N++D   L +++AS+  R             + A LK +++ ++ +      +       N  L  E  Y+      WW P DP+ +S+ L+A+A V+SFSR+ Y++PA E  GPLQISL R + DI +FM +F ++ VAF++GM NLY Y+             A+++       PAF +   +F TL+W++FG S   S +      L Y         D  F I  +G  LYG Y   ++++LLNMLIAM++ S+ EI+ D   EWKFARA LWL Y +    LP PFNL+ S
Sbjct:   37 GTSLTPEEERFLDSAEYGNIPVVRKMLEESKTLNFNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARVGDALLLAISKGYVRIVEAILSHPAFAQGQRLTLSPLEQELRDDDFYAYDEDGTRFSHDITPIILAAHCQEYEIVHILLLKGARIERPHDYFCKCNECTEKQRKDSFSHSRSRMNAYKGLASAAYLSLSSEDPVLTALELSNELARLANIETEFKNDYRKLSMQCKDFVVGVLDLCRDTEEVEAILNGDV--NLQVWSDHHRPSLSRIKLAIKYEVKKFVAHPNCQQQLLTMWYENLSGLRQQSI--AVKFLAVFGVSIGLPFLAIAYWIAPCSK--------------------LGQTLRSPFMKFVAHAVSFTIFLGLLVVNASDRFE-GVKTLPNETFTDYPKQI----FRVKTTQFSWTEMLIMKWVLGMIWSECKEIWEEGPREYVLHLWNLLDFGMLSIFVASFTAR-------------FMAFLKASEAQLYVDQYVQDVT-----LHNVSLPPEVAYFTYARDKWW-PSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYY-----------RGAKYN-------PAFTTVEESFKTLFWSIFGLSEVISVV------LKY---------DHKF-IENIGYVLYGVYNVTMVVVLLNMLIAMINNSYQEIEEDADVEWKFARAKLWLSYFDEGRTLPAPFNLVPS 714          
BLAST of Short transient receptor potential channel vs. Ensembl Mouse
Match: Trpc7 (transient receptor potential cation channel, subfamily C, member 7 [Source:MGI Symbol;Acc:MGI:1349470])

HSP 1 Score: 384.8 bits (987), Expect = 6.293e-118
Identity = 260/760 (34.21%), Postives = 412/760 (54.21%), Query Frame = 3
Query:  210 STHLKDKEYIYLNAVEFGEYEMVQKMVEDPE-INVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEK---SHQRQRLRMQN--AKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVI----RYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPS--LPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITV-ATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILS 2450
             T L  +E  +L++ E+G   +V+KM+E+ + +N NCVDYMG++A+ LA+ ++++E+ ELLL K     + DALL AIS   + +V+ I+ H  F + ++   S   Q LR  +  A     ++FS DITP++LAAH   +EI+ +LL +G  ++ PHD  C C  C + + +DS      R++ Y+ L+S AYL+L++ D V +A  L NEL +LA  E +FK +Y  L++QC  F    +DLCR ++EV+++L+G +  N +V     R  L+ +KLA++   KKFVAH NCQ Q+   +Y  L  +R  ++   +KF ++   S  LP L + Y   P +K                    +G  L+ P +KF+    S+ +FL L+ V A+ R +    T   +T+T+    I    FR  T   S  ++ ++ W+ G I  EC +++  G + Y    +N++D   L +++AS+  R             + A LK +++ ++ +      +       N  L  E  Y+      WW P DP+ +S+ L+A+A V+SFSR+ Y++PA E  GPLQISL R + DI +FM +F ++ VAF++GM NLY Y+             A+++       PAF +   +F TL+W++FG S   S +      L Y         D  F I  +G  LYG Y   ++++LLNMLIAM++ S+ EI+ D   EWKFARA LWL Y +    LP PFNL+ S
Sbjct:   37 GTSLTPEEERFLDSAEYGNIPVVRKMLEESKTLNFNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARVGDALLLAISKGYVRIVEAILSHPAFAQGQRLTLSPLEQELRDDDFYAYDEDGTRFSHDITPIILAAHCQEYEIVHILLLKGARIERPHDYFCKCNECTEKQRKDSFSHSRSRMNAYKGLASAAYLSLSSEDPVLTALELSNELARLANIETEFKNDYRKLSMQCKDFVVGVLDLCRDTEEVEAILNGDV--NLQVWSDHHRPSLSRIKLAIKYEVKKFVAHPNCQQQLLTMWYENLSGLRQQSI--AVKFLAVFGVSIGLPFLAIAYWIAPCSK--------------------LGQTLRSPFMKFVAHAVSFTIFLGLLVVNASDRFE-GVKTLPNETFTDYPKQI----FRVKTTQFSWTEMLIMKWVLGMIWSECKEIWEEGPREYVLHLWNLLDFGMLSIFVASFTAR-------------FMAFLKASEAQLYVDQYVQDVT-----LHNVSLPPEVAYFTYARDKWW-PSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYY-----------RGAKYN-------PAFTTVEESFKTLFWSIFGLSEVISVV------LKY---------DHKF-IENIGYVLYGVYNVTMVVVLLNMLIAMINNSYQEIEEDADVEWKFARAKLWLSYFDEGRTLPAPFNLVPS 714          
BLAST of Short transient receptor potential channel vs. Ensembl Mouse
Match: Trpc3 (transient receptor potential cation channel, subfamily C, member 3 [Source:MGI Symbol;Acc:MGI:109526])

HSP 1 Score: 369.392 bits (947), Expect = 9.983e-112
Identity = 252/758 (33.25%), Postives = 401/758 (52.90%), Query Frame = 3
Query:  219 LKDKEYIYLNAVEFGEYEMVQKMVEDPE-INVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEK---SHQRQRLRMQN--AKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVIRY----PLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITV-ATFRLDVEFLTADTDTWTEKANTIFKYD---FRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILS 2450
            L  +E  +L+A E+G   +V+KM+E+   +NVNCVDYMG++A+ LA+ ++++E+ ELLL K     I DALL AIS   + +V+ I+ H  F  + +   S   Q LR  +  A     ++FS DITP++LAAH + +E++ LLL +G  ++ PHD  C C  C + +  D+      R++ Y+ L+SPAYL+L++ D V +A  L NEL +LA  EK+FK +Y  L++QC  F    +DLCR S+EV+++L+G +     + R+     L+ VKLA++   KKFVAH NCQ Q+   +Y  L  +R+  +  K     ++   LP L + Y   P ++                    +G  L+ P +KF+    S+ +FL L+   A+ R   E +T   +       T+  Y    FR  T   +  ++ ++ W+ G +  EC +++  G + Y    +N++D   L +++A++  R +   +   A     + ++  +S +   TL      +YF +                R  W P DP+ +S+ L+A+A V+SFSR+ Y++PA E  GPLQISL R + DI +FM LF ++ +AF++GM  LY Y+    V                   PAF +   +F TL+W++FG S   S +      L Y         D  F I  +G  LYG Y   ++++LLNMLIAM++ S+ EI+ D   EWKFAR+ LWL Y +    LP PF+L+ S
Sbjct:   98 LTAEEERFLDAAEYGNIPVVRKMLEESRTLNVNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARIGDALLLAISKGYVRIVEAILGHPGFAASRRLTLSPCEQELRDDDFYAYDEDGTRFSPDITPIILAAHCHKYEVVHLLLLKGARIERPHDYFCRCSDCAEKQRLDAFSHSRSRINAYKGLASPAYLSLSSEDPVLTALELSNELAKLANIEKEFKNDYRKLSMQCKDFVVGVLDLCRDSEEVEAILNGDLESAEPLERHGHKASLSRVKLAIKYEVKKFVAHPNCQQQLLTIWYENLSGLREQTIAIKCLVVLVVALGLPFLAIGYWIAPCSR--------------------LGKILRSPFMKFVAHAASFIIFLGLLVFNASDRF--EGITTLPNI------TVIDYPKQIFRVKTTQFTWTEMLIMVWVLGMMWSECKELWLEGPREYIVQLWNVLDFGMLSIFIAAFTARFLAFLQATKAQQYVDSHVQ--ESDLSEVTL--PPEVQYFTY---------------ARDKWLPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVLFIMVFLAFMIGMFILYSYYLGAKVN------------------PAFTTVEESFKTLFWSIFGLSEVTSVV------LKY---------DHKF-IENIGYVLYGIYNVTMVVVLLNMLIAMINSSYQEIEDDSDVEWKFARSKLWLSYFDDGKTLPPPFSLVPS 774          
BLAST of Short transient receptor potential channel vs. Ensembl Mouse
Match: Trpc5 (transient receptor potential cation channel, subfamily C, member 5 [Source:MGI Symbol;Acc:MGI:109524])

HSP 1 Score: 309.686 bits (792), Expect = 2.084e-89
Identity = 229/760 (30.13%), Postives = 380/760 (50.00%), Query Frame = 3
Query:  213 THLKDKEYIYLNAVEFGEYEMVQKMVEDPEI----NVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEKSHQRQRLRMQNAKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVIR---YPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILII 2471
            T L  +E  +L+AVE G+Y  V++ +++ EI    N+NC+D +GRSA+L+A++++N+E++ELLL+   Y  + DALL AI  E +  V+L++ ++   K     Q   L M     +  S+F+ DITP+MLAAHTNN+EII+LL+ +   +  PH I C C  C      DSL     RL+ Y+AL+SP+ +AL++ D + +AF L  EL +L++ E +FK EY  L+ QC  FAK  +D  R+S E++ +L+     + ++     + LA +K+A++  +K+FVA  NCQ  +   +Y      R  + +  +K  + +         I   FP           +S + +IS +  +GLF++ P IKFI    SY  FLF++ +A+                     I + D        + ++  ++ W+ G I  E  +++  G   Y   ++N+MD     LYLA+ +L+ +   K NG+                                               R  W  + P  +++ LFA++N++S  R+  L  A   LGPLQISL RM+ DI++F+ ++ L+++AF  G+  LY+Y+    +      N+ +  +  +    AF +   T  +L+W++FG  +   T +      +                  VG+ ++GTY  + +++LLNMLIAMM+ S+  I      EWKFAR  LW+ Y +  G LP PFN+I S    L +
Sbjct:   27 TELSAEEKAFLSAVEKGDYATVKQALQEAEIYYNVNINCMDPLGRSALLIAIENENLEIMELLLNHSVY--VGDALLYAIRKEVVGAVELLLSYR---KPSGEKQVPTLMMD----TQFSEFTPDITPIMLAAHTNNYEIIKLLVQKRVTIPRPHQIRCNCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAEYEELSQQCKLFAKDLLDQARSSRELEIILNHRDDHSEELDPQKYHDLAKLKVAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRKHWV--VKLLTCMT--------IGFLFP----------MLSIAYLISPRSNLGLFIKKPFIKFICHTASYLTFLFMLLLAS-------------------QHIVRTDLHVQGPPPTVVEWMILPWVLGFIWGEIKEMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAYVKYNGSRP---------------------------------------------REEWEMWHPTLIAEALFAISNILSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETRAIDE---PNNCK-GIRCEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFT----------------EFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSFLYL 673          
BLAST of Short transient receptor potential channel vs. UniProt/SwissProt
Match: sp|Q9MYW0|TRPC6_BOVIN (Short transient receptor potential channel 6 OS=Bos taurus OX=9913 GN=TRPC6 PE=2 SV=2)

HSP 1 Score: 404.06 bits (1037), Expect = 1.400e-123
Identity = 269/801 (33.58%), Postives = 423/801 (52.81%), Query Frame = 3
Query:  210 STHLKDKEYIYLNAVEFGEYEMVQKMVEDP-EINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEK---SHQRQRLRMQN--AKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIV---KNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITV-ATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLK---SENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLFG--FEGLKVQEVNGYEEYIEANEQKK 2567
            ST L  +E  +L+A E+G   +V+KM+E+   +NVNCVDYMG++A+ LA+ ++++E+ ELLL K     + DALL AIS   + +V+ I+ H  F + ++   S  +  L+  +  A     ++FS D+TP++LAAH   +EI+  LL +G  ++ PHD  C C  C + +  DS      R++ Y+ L+SPAYL+L++ D V +A  L NEL  LA  EK+FK +Y  L++QC  F    +DLCR ++EV+++L+G +          R  L+ +KLA++   KKFVAH NCQ Q+ + +Y  L  +R   +  K      +   LP L ++Y F P +K                    +G  ++ P +KF+    S+ +FL L+ + A  R +   +  + +T T+ A  +    FR  T   S +++ +I W+ G I  EC +++T G K Y    +N++D   L ++ AS+  R +  +  + A ++  A          N+TL             +L K    +N  +    R+ W P DP+ +S+ L+A+A V+SFSR+ Y++PA E  GPLQISL R + DI +FM +F ++ VAF++GM NLY Y+  I    N                 AF +   +F TL+W +FG S   S +I+ N                   I  +G  LYG Y   ++I+LLNMLIAM++ SF EI+ D   EWKFARA LW  Y E    LPVPFNL+ S   +  +   ++K     F+G K     G++E  E N++ +
Sbjct:   91 STSLSIEEERFLDAAEYGNIPVVRKMLEECLSLNVNCVDYMGQNALQLAVANEHLEITELLLKKENLSRVGDALLLAISKGYVRIVEAILSHPAFAEGKRLATSPSQSELQQDDFYAYDEDGTRFSHDVTPIILAAHCQEYEIVHTLLRKGARIERPHDYFCKCSECNQKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCRNTEEVEAILNGDVEIHHSGGDHYRPNLSRLKLAIKYDVKKFVAHPNCQQQLLSIWYENLSGLRQQTMAVKFLVVLAVAVGLPFLALVYWFAPCSK--------------------MGKIMRGPFMKFVAHAASFTIFLGLLVMNAADRFEGTKILPN-ETSTDHAKQL----FRMKTSCFSWMEMLIISWVIGMIWAECKEIWTQGPKEYLFELWNMLDFGMLAIFAASFIARFMAFWHASKAQSIIDA----------NDTL------------KDLTKVTLGDNVKYYNLARIKWDPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYY--IGAKQN----------------EAFTTVEESFKTLFWAIFGLSEVKSVVINYNHK----------------FIENIGYVLYGVYNVTMVIVLLNMLIAMINSSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLVPSPKSLFYLLLRLKKWISELFQGHK----KGFQEDAEMNKRNE 806          
BLAST of Short transient receptor potential channel vs. UniProt/SwissProt
Match: sp|Q9Y210|TRPC6_HUMAN (Short transient receptor potential channel 6 OS=Homo sapiens OX=9606 GN=TRPC6 PE=1 SV=1)

HSP 1 Score: 401.364 bits (1030), Expect = 1.565e-122
Identity = 263/759 (34.65%), Postives = 408/759 (53.75%), Query Frame = 3
Query:  210 STHLKDKEYIYLNAVEFGEYEMVQKMVED-PEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEK---SHQRQRLRMQN--AKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTI--VKNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITV-ATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLK---SENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILS 2450
            ST L  +E  +L+A E+G   +V+KM+E+   +NVNCVDYMG++A+ LA+ ++++E+ ELLL K     + DALL AIS   + +V+ I+ H  F + ++   S  +  L+  +  A     ++FS D+TP++LAAH   +EI+  LL +G  ++ PHD  C C  C + +  DS      R++ Y+ L+SPAYL+L++ D V +A  L NEL  LA  EK+FK +Y  L++QC  F    +DLCR ++EV+++L+G +  +++    R  L+ +KLA++   KKFVAH NCQ Q+ + +Y  L  +R   +  K      +   LP L +IY F P +K                    +G  ++ P +KF+    S+ +FL L+ + A  R +   L  + +T T+ A  +    FR  T   S +++ +I W+ G I  EC +++T G K Y    +N++D   L ++ AS+  R +  +  + A ++  A          N+TL             +L K    +N  +    R+ W P DP+ +S+ L+A+A V+SFSR+ Y++PA E  GPLQISL R + DI +FM +F ++ VAF++GM NLY Y+  I    N                 AF +   +F TL+W +FG S   S +I+ N                   I  +G  LYG Y   ++I+LLNMLIAM++ SF EI+ D   EWKFARA LW  Y E    LPVPFNL+ S
Sbjct:   92 STSLSIEEERFLDAAEYGNIPVVRKMLEECHSLNVNCVDYMGQNALQLAVANEHLEITELLLKKENLSRVGDALLLAISKGYVRIVEAILSHPAFAEGKRLATSPSQSELQQDDFYAYDEDGTRFSHDVTPIILAAHCQEYEIVHTLLRKGARIERPHDYFCKCNDCNQKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCRNTEEVEAILNGDVETLQSGDHGRPNLSRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLRQQTMAVKFLVVLAVAIGLPFLALIYWFAPCSK--------------------MGKIMRGPFMKFVAHAASFTIFLGLLVMNAADRFEGTKLLPN-ETSTDNAKQL----FRMKTSCFSWMEMLIISWVIGMIWAECKEIWTQGPKEYLFELWNMLDFGMLAIFAASFIARFMAFWHASKAQSIIDA----------NDTL------------KDLTKVTLGDNVKYYNLARIKWDPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYY--IGAKQN----------------EAFTTVEESFKTLFWAIFGLSEVKSVVINYNHK----------------FIENIGYVLYGVYNVTMVIVLLNMLIAMINSSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLVPS 769          
BLAST of Short transient receptor potential channel vs. UniProt/SwissProt
Match: sp|Q61143|TRPC6_MOUSE (Short transient receptor potential channel 6 OS=Mus musculus OX=10090 GN=Trpc6 PE=1 SV=3)

HSP 1 Score: 397.512 bits (1020), Expect = 4.196e-121
Identity = 263/759 (34.65%), Postives = 405/759 (53.36%), Query Frame = 3
Query:  210 STHLKDKEYIYLNAVEFGEYEMVQKMVED-PEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEK---SHQRQRLRMQN--AKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSG--TIVKNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITV-ATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLK---SENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILS 2450
            ST L  +E  +L+A E+G   +V+KM+E+   +NVNCVDYMG++A+ LA+ ++++E+ ELLL K     + DALL AIS   + +V+ I++H  F + ++   S  +  L+  +  A     ++FS D+TP++LAAH   +EI+  LL +G  ++ PHD  C C  C + +  DS      R++ Y+ L+SPAYL+L++ D V +A  L NEL  LA  EK+FK +Y  L++QC  F    +DLCR ++EV+++L+G     +     R  L+ +KLA++   KKFVAH NCQ Q+ + +Y  L  +R   +  K      +   LP L +IY   P +K                    +G  L+ P +KF+    S+ +FL L+ + A  R +   L  + +T T+ A  +    FR  T   S +++ +I W+ G I  EC +++T G K Y    +N++D   L ++ AS+  R +  +  + A ++  A          N+TL             +L K    +N  +    R+ W P DP+ +S+ L+A+A V+SFSR+ Y++PA E  GPLQISL R + DI +FM +F ++ VAF++GM NLY Y+  I    N                 AF +   +F TL+W +FG S   S +I+ N                   I  +G  LYG Y   ++I+LLNMLIAM++ SF EI+ D   EWKFARA LW  Y E    LPVPFNL+ S
Sbjct:   91 STSLSIEEERFLDAAEYGNIPVVRKMLEECHSLNVNCVDYMGQNALQLAVANEHLEITELLLKKENLSRVGDALLLAISKGYVRIVEAILNHPAFAEGKRLATSPSQSELQQDDFYAYDEDGTRFSHDVTPIILAAHCQEYEIVHTLLRKGARIERPHDYFCKCTECSQKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYRKLSMQCKDFVVGLLDLCRNTEEVEAILNGDAETRQPGDFGRPNLSRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLRQQTMAVKFLVVLAVAIGLPFLALIYWCAPCSK--------------------MGKILRGPFMKFVAHAASFTIFLGLLVMNAADRFEGTKLLPN-ETSTDNARQL----FRMKTSCFSWMEMLIISWVIGMIWAECKEIWTQGPKEYLFELWNMLDFGMLAIFAASFIARFMAFWHASKAQSIIDA----------NDTL------------KDLTKVTLGDNVKYYNLARIKWDPTDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYY--IGAKQN----------------EAFTTVEESFKTLFWAIFGLSEVKSVVINYNHK----------------FIENIGYVLYGVYNVTMVIVLLNMLIAMINSSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLVPS 768          
BLAST of Short transient receptor potential channel vs. UniProt/SwissProt
Match: sp|Q9HCX4|TRPC7_HUMAN (Short transient receptor potential channel 7 OS=Homo sapiens OX=9606 GN=TRPC7 PE=1 SV=1)

HSP 1 Score: 385.571 bits (989), Expect = 2.140e-117
Identity = 263/760 (34.61%), Postives = 412/760 (54.21%), Query Frame = 3
Query:  210 STHLKDKEYIYLNAVEFGEYEMVQKMVEDPE-INVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEK---SHQRQRLRMQN--AKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVI----RYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPS--LPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITV-ATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILS 2450
             T L  +E  +L++ E+G   +V+KM+E+ + +N NCVDYMG++A+ LA+ ++++E+ ELLL K     + DALL AIS   + +V+ I++H  F + ++   S   Q LR  +  A     ++FS DITP++LAAH   +EI+ +LL +G  ++ PHD  C C  C + + +DS      R++ Y+ L+S AYL+L++ D V +A  L NEL +LA  E +FK +Y  L++QC  F    +DLCR ++EV+++L+G +  N +V     R  L+ +KLA++   KKFVAH NCQ Q+   +Y  L  +R  ++   +KF ++   S  LP L + Y   P +K                    +G  L+ P +KF+    S+ +FL L+ V A+ R +    T   +T+T+    I    FR  T   S  ++ ++ W+ G I  EC +++  G + Y    +N++D   L +++AS+  R +   K   A  LY          + ++TL            N  L  E  Y+      WW P DP+ +S+ L+A+A V+SFSR+ Y++PA E  GPLQISL R + DI +FM +F ++ VAF++GM NLY Y+             A+++       PAF +   +F TL+W++FG S   S +      L Y         D  F I  +G  LYG Y   ++++LLNMLIAM++ S+ EI+ D   EWKFARA LWL Y +    LP PFNL+ S
Sbjct:   37 GTSLTPEEERFLDSAEYGNIPVVRKMLEESKTLNFNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARVGDALLLAISKGYVRIVEAILNHPAFAQGQRLTLSPLEQELRDDDFYAYDEDGTRFSHDITPIILAAHCQEYEIVHILLLKGARIERPHDYFCKCNECTEKQRKDSFSHSRSRMNAYKGLASAAYLSLSSEDPVLTALELSNELARLANIETEFKNDYRKLSMQCKDFVVGVLDLCRDTEEVEAILNGDV--NFQVWSDHHRPSLSRIKLAIKYEVKKFVAHPNCQQQLLTMWYENLSGLRQQSI--AVKFLAVFGVSIGLPFLAIAYWIAPCSK--------------------LGRTLRSPFMKFVAHAVSFTIFLGLLVVNASDRFE-GVKTLPNETFTDYPKQI----FRVKTTQFSWTEMLIMKWVLGMIWSECKEIWEEGPREYVLHLWNLLDFGMLSIFVASFTARFMAFLKATEAQ-LY------VDQHVQDDTL-----------HNVSLPPEVAYFTYARDKWW-PSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYY-----------RGAKYN-------PAFTTVEESFKTLFWSIFGLSEVISVV------LKY---------DHKF-IENIGYVLYGVYNVTMVVVLLNMLIAMINNSYQEIEEDADVEWKFARAKLWLSYFDEGRTLPAPFNLVPS 714          
BLAST of Short transient receptor potential channel vs. UniProt/SwissProt
Match: sp|Q9WVC5|TRPC7_MOUSE (Short transient receptor potential channel 7 OS=Mus musculus OX=10090 GN=Trpc7 PE=2 SV=1)

HSP 1 Score: 385.185 bits (988), Expect = 3.340e-117
Identity = 260/760 (34.21%), Postives = 412/760 (54.21%), Query Frame = 3
Query:  210 STHLKDKEYIYLNAVEFGEYEMVQKMVEDPE-INVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEK---SHQRQRLRMQN--AKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVI----RYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPS--LPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITV-ATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILS 2450
             T L  +E  +L++ E+G   +V+KM+E+ + +N NCVDYMG++A+ LA+ ++++E+ ELLL K     + DALL AIS   + +V+ I+ H  F + ++   S   Q LR  +  A     ++FS DITP++LAAH   +EI+ +LL +G  ++ PHD  C C  C + + +DS      R++ Y+ L+S AYL+L++ D V +A  L NEL +LA  E +FK +Y  L++QC  F    +DLCR ++EV+++L+G +  N +V     R  L+ +KLA++   KKFVAH NCQ Q+   +Y  L  +R  ++   +KF ++   S  LP L + Y   P +K                    +G  L+ P +KF+    S+ +FL L+ V A+ R +    T   +T+T+    I    FR  T   S  ++ ++ W+ G I  EC +++  G + Y    +N++D   L +++AS+  R             + A LK +++ ++ +      +       N  L  E  Y+      WW P DP+ +S+ L+A+A V+SFSR+ Y++PA E  GPLQISL R + DI +FM +F ++ VAF++GM NLY Y+             A+++       PAF +   +F TL+W++FG S   S +      L Y         D  F I  +G  LYG Y   ++++LLNMLIAM++ S+ EI+ D   EWKFARA LWL Y +    LP PFNL+ S
Sbjct:   37 GTSLTPEEERFLDSAEYGNIPVVRKMLEESKTLNFNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARVGDALLLAISKGYVRIVEAILSHPAFAQGQRLTLSPLEQELRDDDFYAYDEDGTRFSHDITPIILAAHCQEYEIVHILLLKGARIERPHDYFCKCNECTEKQRKDSFSHSRSRMNAYKGLASAAYLSLSSEDPVLTALELSNELARLANIETEFKNDYRKLSMQCKDFVVGVLDLCRDTEEVEAILNGDV--NLQVWSDHHRPSLSRIKLAIKYEVKKFVAHPNCQQQLLTMWYENLSGLRQQSI--AVKFLAVFGVSIGLPFLAIAYWIAPCSK--------------------LGQTLRSPFMKFVAHAVSFTIFLGLLVVNASDRFE-GVKTLPNETFTDYPKQI----FRVKTTQFSWTEMLIMKWVLGMIWSECKEIWEEGPREYVLHLWNLLDFGMLSIFVASFTAR-------------FMAFLKASEAQLYVDQYVQDVT-----LHNVSLPPEVAYFTYARDKWW-PSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYY-----------RGAKYN-------PAFTTVEESFKTLFWSIFGLSEVISVV------LKY---------DHKF-IENIGYVLYGVYNVTMVVVLLNMLIAMINNSYQEIEEDADVEWKFARAKLWLSYFDEGRTLPAPFNLVPS 714          
BLAST of Short transient receptor potential channel vs. TrEMBL
Match: A0A158QUN6 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS6521 PE=3 SV=1)

HSP 1 Score: 961.444 bits (2484), Expect = 0.000e+0
Identity = 491/890 (55.17%), Postives = 643/890 (72.25%), Query Frame = 3
Query:  147 GKNKKCTIVGQKLQSESGLVFSTHLKDKEYIYLNAVEFGEYEMVQKMVEDPEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEK--SHQRQRLRMQNAKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDVEFLTAD-TDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNET----------LFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIV---TANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQIL-IIFSEVRKL----------------FGFEGLKVQEVNGY-----------EEYIEAN--EQKK------DLNKMKANMIRRYLFQLQRMKEQENKSGDLA 2660
            GK KK T+ G KL SE+GLVF + L+DKEY++LNA EFGE E+V++++ DP +NV+CVDYMGR+A+LLAMK++N+E+I+ L+ KL +  +EDALLNAIS EKI++VKLIIDH  +I+ EK  + +RQR  + N K   RSQFSSDITP+MLAAHTNNHEIIQLLLDRG  ++MPHD  C C  CE ++ +DSLILE+QRLHTY+AL+S AYLALTTSD VSSAF LR ELYQLA QEKQFKEEY+ LA+Q M FA +C+DLCRTSDEV SLL+   +  N   +Y LAT+K A+QC EKKFVAHSNCQHQ+EN FYG +  IRDF   ++++FF +  P LP+LY+ Y+FFPN K+P+P+G  + F +  + ++ +   L+CP+IKFIG M SYF FL LITVATFRLD +   A+  D W  +A  I+ YDFR++ ++++ IQ+ L+FWI GQ+  EC QV+ +GL+ Y +S+YNIMD  S+ LYL ++ALR  V+ ++     ++  +L  A+S++ N +          LF+     Y  +RN LL     YWLRGCRLWW+P DPE+VSDCLFA+ANV+SF+RV+YLMPAWE+LGPLQISLARM+SDIIRFMALFS+++++FVVG+TNLYWYFAK+IV   T    +++A  ++   S +PAFQS+ +TF+TL+W+LFG SSNN T+++  +   YPG   L V++++F+IS++GSFLY  Y A +IIILLNMLIAMMSKSFDEIQGDRLEEWKFARA LWLVYIEHEGVLP P NL+ SR  I  +I    + L                FG +       N +           E + E+   E KK       L ++K N++RRYLFQLQ+ KE ENKSGDLA
Sbjct:  215 GKAKKETVAGMKLASENGLVFKSQLQDKEYVFLNAAEFGEVEIVRELLNDPTLNVDCVDYMGRNAVLLAMKTENIELIDALVGKLNFYAVEDALLNAISQEKIHIVKLIIDHPQYIRMEKIMAPRRQRAGIIN-KSIERSQFSSDITPLMLAAHTNNHEIIQLLLDRGLKVEMPHDRSCPCWDCESIRAKDSLILEMQRLHTYQALTSSAYLALTTSDPVSSAFTLRGELYQLASQEKQFKEEYSRLAVQSMDFAVSCLDLCRTSDEVLSLLTANDIIPNGDAQYHLATIKHAVQCREKKFVAHSNCQHQLENTFYGNMFCIRDFEGWQRLQFFIIFTPLLPVLYLTYLFFPNLKVPLPQG--LMFRQTSTGRLQVAQLLRCPIIKFIGHMLSYFTFLLLITVATFRLDKDDDEAEHPDLWKVRAFQIWSYDFRSSQQVMTKIQIILLFWILGQLFGECKQVYHYGLQDYFRSYYNIMDWASVSLYLGAFALRIFVELRVQATQGIFQHQLTFAQSLLQNASNTIAESGASVLFTDQQSNYVAYRNRLLSEAEAYWLRGCRLWWAPDDPEYVSDCLFALANVLSFARVSYLMPAWELLGPLQISLARMVSDIIRFMALFSVMLISFVVGLTNLYWYFAKMIVSIDTKRGTTSAAPATVRYASVVPAFQSSTATFYTLFWSLFGMSSNNVTIVEEELASVYPGHEFLRVNNAAFMISSLGSFLYAIYNACMIIILLNMLIAMMSKSFDEIQGDRLEEWKFARANLWLVYIEHEGVLPAPLNLLPSRVAITKLILRTYKALLTCIAKMSGRQRLHDYFGKDDQTFSFANSFPVEMSTLQSTKETFYESQPPETKKLECLETHLTRVKCNIMRRYLFQLQKHKEAENKSGDLA 1101          
BLAST of Short transient receptor potential channel vs. TrEMBL
Match: A0A0X3PKC2 (Short transient receptor potential channel 7 OS=Schistocephalus solidus OX=70667 GN=TRPC7 PE=3 SV=1)

HSP 1 Score: 947.192 bits (2447), Expect = 0.000e+0
Identity = 489/895 (54.64%), Postives = 633/895 (70.73%), Query Frame = 3
Query:  147 GKNKKCTIVGQKLQSESGLVFSTHLKDKEYIYLNAVEFGEYEMVQKMVEDPEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEKSHQRQRLRMQNAKKSY-RSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNE----TLFSAGSKE----------YFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIV---TANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLFGFEGLKV------------------QEVNGYEEYIEANEQKK---------------------DLNKMKANMIRRYLFQLQRMKEQENKSGDLA 2660
            GK +K T+ G KL SE+GLVF + LKDKEY++LNA EFGE E+V++++ D  +NV+CVDYMGR+A+LLAMK++N+E+I+ L+ +L +  +EDALLNAIS EKI++VKLIIDH  +I+ EK    +  R     KS  RSQFSSDITP+MLAAHTNNHEIIQLLLDRG  ++MPHD  C+C  CE ++ +DSLILE+QRLHTY+AL+S AYLALTTSD VSSAF+LR ELYQLA QEKQFKEEY+ LA+Q M FA +C+DLCRTSDEV  LL+G+    N   +  LAT+K A+QC EKKFVAHSNCQHQ+EN FY  +  IRDF  I++++FF + IP LPILY+IY+FFPN KIP+P+   + F   +S K+ +   L+CP++KFIG M SYF FL LITVATFRLD +  + + D W  ++  ++ YDFRT+ R+++ IQ+ L+FWI GQ+  EC QV+ +GL+ Y +S+YNIMD  S+ LYL +YALR +VD K+   + ++   L  A+S++ N     T   A S E          Y  +RN +L+ ++ YWLRGCRLWWSP DPE+VSDCLFA+ANV+SF+R++YLMPAWE+LGPLQISLARM++DIIRFMALFS+++ AFVVG+TNLYWYFAK+IV   T      +   ++   S IPAFQS+ +TF+TL+W LFGQSSNN T I+ N+   YPG   L V +SSF+I+++GS LY  Y A +IIILLNMLIAMMSKSFDEIQGDRLEEWKFARA LW+VYIE EGVLP P NL+ SR  +  I     K       K                     V+     I+ +E+++                      L ++K N++RRYLFQLQ+ KE ENKSGDLA
Sbjct:  347 GKTRKETVAGMKLASENGLVFKSQLKDKEYVFLNASEFGEVEIVRELLTDRTLNVDCVDYMGRNAVLLAMKTENIELIDCLVGRLNFYAVEDALLNAISQEKIHIVKLIIDHPQYIRMEKIMTPRGQRAGIITKSIERSQFSSDITPLMLAAHTNNHEIIQLLLDRGLKVEMPHDRSCLCLDCESIRAQDSLILEMQRLHTYQALTSSAYLALTTSDPVSSAFVLRGELYQLASQEKQFKEEYSRLAVQSMNFAVSCLDLCRTSDEVHCLLTGSDASTNGDAQCHLATIKQAVQCREKKFVAHSNCQHQLENLFYDCMFCIRDFEGIQRLQFFLIFIPLLPILYIIYLFFPNLKIPLPQN--LMFRHTMSGKLQVSRLLRCPIVKFIGHMLSYFTFLLLITVATFRLDKDDESEEEDLWKIRSYQVWSYDFRTSQRVMTKIQILLLFWILGQLFGECKQVYHYGLQHYFRSYYNIMDWASVSLYLGAYALRILVDIKVCATETVFHQRLLYAQSLLQNASDILTNIDASSFELTQGTHQQINYVGYRNAMLREDSAYWLRGCRLWWSPDDPEYVSDCLFALANVLSFARISYLMPAWELLGPLQISLARMVNDIIRFMALFSVMLTAFVVGLTNLYWYFAKMIVSIDTGRGTRVTGAATVHYASGIPAFQSSTATFYTLFWALFGQSSNNVTTIEENLASVYPGHVDLRVDNSSFMITSLGSILYAIYNACMIIILLNMLIAMMSKSFDEIQGDRLEEWKFARANLWIVYIEQEGVLPAPLNLLPSRVALTKITQRTCKALRHCKCKFLRRGNRRPKDDQLYLNQSNSVDSSGPMIQLDEKQQWTAKEDNRFPSRKNLTPKDEDHLTRVKCNIMRRYLFQLQKQKEAENKSGDLA 1239          
BLAST of Short transient receptor potential channel vs. TrEMBL
Match: G4VSU8 (Putative transient receptor potential channel OS=Schistosoma mansoni OX=6183 GN=Smp_163160 PE=3 SV=1)

HSP 1 Score: 932.169 bits (2408), Expect = 0.000e+0
Identity = 473/879 (53.81%), Postives = 629/879 (71.56%), Query Frame = 3
Query:  141 IAGKNKKCTIVGQKLQSESGLVFSTHLKDKEYIYLNAVEFGEYEMVQKMVEDPEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEKSHQRQRLRMQNA--KKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETL----FSAGSKE-----YFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLFGFEGLKVQEVNGYE----------------EYIEANEQ-KKDLNK-----------MKANMIRRYLFQLQRMKEQENKSGDLA 2660
            + GKNKK T  G KL  ESGLVF THL+DKEY+YLNA EFGE E+V+ +++D +++VNCVDYMGR+A+LLAMK++N++++ELL+++L++  +EDALLNAIS +K +LVKLI+DH  +I+ EK  + +     +    +S RSQFSSDI+P+MLAAH NNHEIIQLLLDRG  L+MPHD  C C  CE ++ EDSLILE QRLHTY+ALSS AYLALTTSD VS+AF+LRNELYQLA QEKQFKEEY+ LA++CM FA +CVDLCRTSDE+  LL GTI         PL T+K A+Q  EKKFVAH NCQHQ+EN FY  +  IRDF  +++++F  + +  LP LY+IY+FFP+ K+P+P+  ++ + +    K  +   L+CPV KF+G M SY  FL LITVATFRLD   ++   D W  +   I  YDFRT+  +++ IQ+ L+FWI GQ+ MEC QV+ +GL+ + +S+YN MD  S+ LYLASY+LR IVD+K+  +   Y   LK+A+S++ N T     F +G++E     Y  +RN +L  E+ YWLRGCRLWW+P DPE++SDCLFA+ NV+SFSR++YLMPAWE+LGPLQISLARM+SDIIRFMALF+++V+AFVVG+TNLYWYFA IIV+ +       ++    S IP+F+STG+TFHTLYW LFGQSS N T ID N+   YPG   L V  S ++++++GS LY  Y A +IIILLNMLIAMMSKSFDEIQGDRLEEWKFARA LWLVYI+ EGVLPVP NL+ SR+ I  + S    +  ++  ++   +  +                +Y   N Q  +++ K           ++A+++RRYLF+LQ+ KE+E KS + +
Sbjct:   55 LIGKNKKWTTAGWKLSCESGLVFRTHLQDKEYVYLNAAEFGELEVVRDLLDDIKLDVNCVDYMGRNALLLAMKNENLDLVELLVNRLDFYAVEDALLNAISQQKNHLVKLIVDHPQYIRMEKQCKSKVSGPSSGTNNRSKRSQFSSDISPLMLAAHINNHEIIQLLLDRGLKLEMPHDRACSCLECETIRAEDSLILEQQRLHTYQALSSSAYLALTTSDPVSTAFILRNELYQLASQEKQFKEEYSELAVKCMDFAISCVDLCRTSDELHCLLGGTINSKPHDRGNPLNTIKNAIQSHEKKFVAHPNCQHQMENLFYSLMFCIRDFEGLQRLQFVIIFLSLLPFLYIIYLFFPHFKMPLPQ--SLIYRDRSVTKYEVTEILRCPVTKFLGHMVSYITFLILITVATFRLDRTAVSDGEDNWEVRYTEILSYDFRTSHVVMTKIQIILLFWILGQLCMECKQVYHYGLRYFFRSYYNFMDWVSIALYLASYSLRIIVDFKVQASMRQYQDVLKVAQSILLNTTCSTSKFCSGTEETTHQNYVNYRNKILIPESAYWLRGCRLWWAPDDPEYISDCLFALGNVLSFSRISYLMPAWELLGPLQISLARMVSDIIRFMALFTVMVIAFVVGLTNLYWYFANIIVSVDAQGQLIRYA----SGIPSFKSTGATFHTLYWALFGQSSTNVTTIDENLASMYPGHEYLAVDSSPYIVNSLGSILYAIYNACMIIILLNMLIAMMSKSFDEIQGDRLEEWKFARASLWLVYIDQEGVLPVPLNLLPSREAISSLLSRFYNIIQWKKPQIYTKHHCDLQKNDNALIFSQTTPTKYHTVNSQLNQNIRKTHTTTTLHTDTIRADVMRRYLFKLQKQKEEELKSAEFS 927          
BLAST of Short transient receptor potential channel vs. TrEMBL
Match: A0A3Q0KRX8 (Putative transient receptor potential channel OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 920.228 bits (2377), Expect = 0.000e+0
Identity = 456/790 (57.72%), Postives = 591/790 (74.81%), Query Frame = 3
Query:  141 IAGKNKKCTIVGQKLQSESGLVFSTHLKDKEYIYLNAVEFGEYEMVQKMVEDPEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEKSHQRQRLRMQNA--KKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETL----FSAGSKE-----YFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFS 2477
            + GKNKK T  G KL  ESGLVF THL+DKEY+YLNA EFGE E+V+ +++D +++VNCVDYMGR+A+LLAMK++N++++ELL+++L++  +EDALLNAIS +K +LVKLI+DH  +I+ EK  + +     +    +S RSQFSSDI+P+MLAAH NNHEIIQLLLDRG  L+MPHD  C C  CE ++ EDSLILE QRLHTY+ALSS AYLALTTSD VS+AF+LRNELYQLA QEKQFKEEY+ LA++CM FA +CVDLCRTSDE+  LL GTI         PL T+K A+Q  EKKFVAH NCQHQ+EN FY  +  IRDF  +++++F  + +  LP LY+IY+FFP+ K+P+P+  ++ + +    K  +   L+CPV KF+G M SY  FL LITVATFRLD   ++   D W  +   I  YDFRT+  +++ IQ+ L+FWI GQ+ MEC QV+ +GL+ + +S+YN MD  S+ LYLASY+LR IVD+K+  +   Y   LK+A+S++ N T     F +G++E     Y  +RN +L  E+ YWLRGCRLWW+P DPE++SDCLFA+ NV+SFSR++YLMPAWE+LGPLQISLARM+SDIIRFMALF+++V+AFVVG+TNLYWYFA IIV+ +       ++    S IP+F+STG+TFHTLYW LFGQSS N T ID N+   YPG   L V  S ++++++GS LY  Y A +IIILLNMLIAMMSKSFDEIQGDRLEEWKFARA LWLVYI+ EGVLPVP NL+ SR+ I  + S
Sbjct:   55 LIGKNKKWTTAGWKLSCESGLVFRTHLQDKEYVYLNAAEFGELEVVRDLLDDIKLDVNCVDYMGRNALLLAMKNENLDLVELLVNRLDFYAVEDALLNAISQQKNHLVKLIVDHPQYIRMEKQCKSKVSGPSSGTNNRSKRSQFSSDISPLMLAAHINNHEIIQLLLDRGLKLEMPHDRACSCLECETIRAEDSLILEQQRLHTYQALSSSAYLALTTSDPVSTAFILRNELYQLASQEKQFKEEYSELAVKCMDFAISCVDLCRTSDELHCLLGGTINSKPHDRGNPLNTIKNAIQSHEKKFVAHPNCQHQMENLFYSLMFCIRDFEGLQRLQFVIIFLSLLPFLYIIYLFFPHFKMPLPQ--SLIYRDRSVTKYEVTEILRCPVTKFLGHMVSYITFLILITVATFRLDRTAVSDGEDNWEVRYTEILSYDFRTSHVVMTKIQIILLFWILGQLCMECKQVYHYGLRYFFRSYYNFMDWVSIALYLASYSLRIIVDFKVQASMRQYQDVLKVAQSILLNTTCSTSKFCSGTEETTHQNYVNYRNKILIPESAYWLRGCRLWWAPDDPEYISDCLFALGNVLSFSRISYLMPAWELLGPLQISLARMVSDIIRFMALFTVMVIAFVVGLTNLYWYFANIIVSVDAQGQLIRYA----SGIPSFKSTGATFHTLYWALFGQSSTNVTTIDENLASMYPGHEYLAVDSSPYIVNSLGSILYAIYNACMIIILLNMLIAMMSKSFDEIQGDRLEEWKFARASLWLVYIDQEGVLPVPLNLLPSREAISSLLS 838          
BLAST of Short transient receptor potential channel vs. TrEMBL
Match: A0A068XXQ6 (Short transient receptor potential channel 6 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000444600 PE=3 SV=1)

HSP 1 Score: 916.761 bits (2368), Expect = 0.000e+0
Identity = 475/918 (51.74%), Postives = 632/918 (68.85%), Query Frame = 3
Query:  105 LVSKQLDSLRSLIAGKNKKCTIVGQKLQSESGLVFSTHLKDKEYIYLNAVEFGEYEMVQKMVEDPEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEKSHQRQRLRMQNA----KKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDVEF-LTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNET--LFSAGSK------------EYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIV---TANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLFGFEGLKVQEVNGY-------EEYIEANEQ-------------------------------------KKDLNKMKANMIRRYLFQLQRMKEQENKSGDLA 2660
            ++++Q+ S   +  GK KK T+ G KL S +GLVF +HL+DKEY++LNA EFGE E+V++++ DP +NVNCVDYMGR+A+LLAMK++N+E+I  L+ KL +  +EDALLNAIS EKI++VKLIIDH  +I+ EK       R Q+A    +   RSQFS+DITP+MLAAHTNNHEIIQLLLDRG  L+MPHD  C+C  CE ++ +DSLILE+QRLHTY+AL+S AYLALTT D VSSAF LR ELYQLA QEKQFKEEY+ LA+Q M FA +C+DLCRTSDEV SLL+   +  +   +Y LAT+K A       FVAHSNCQHQ+EN FYG +  IRDF   ++++FF +  P LPILY+ Y+F PN K+P P+  ++   + I+ K+ +   L+CP++KFIG M SYF+FL LITVATFRLD +     + D W  +A  I+ YDFR++ ++++ I + L+FWI GQ+  E  QV+ +GL+ Y +S+YNIMD  S+ LYL ++ALR  VD ++     ++  +L  A+S++ N +  +   G+              Y  +RN LL  +  YWLRGCRLWW+P DPE+VSDCLFA+ANV+SF+RV+YLMPAWE+LGPLQISLA+M+SDIIRFMALFS++++AFVVG+TNLYWYFAK+I+   +    S +   ++   S +PAFQS+ +TFHTL+W LFG SSNN TM++  +   YPG   L V++++F+IS++GS LY  Y A +IIILLNMLIAMMSKSFDEIQGDRLEEWKFARA LWLVYIEHEGVLP P N + SR  + I     R      G +V+   G+       E+Y++  E                                      +  L ++K N++RRYLFQLQ+ KE ENK+GDLA
Sbjct:  292 MLTEQMGSAAQM--GKAKKDTVAGLKLASGNGLVFKSHLQDKEYVFLNAAEFGEVEIVRELLNDPTLNVNCVDYMGRNAVLLAMKTENIELIGALVGKLNFYAVEDALLNAISQEKIHIVKLIIDHPQYIRMEKIMAP---RGQHAGLIGRCIERSQFSADITPLMLAAHTNNHEIIQLLLDRGFKLEMPHDRSCLCLDCESIRAKDSLILEMQRLHTYQALTSSAYLALTTCDPVSSAFTLRGELYQLASQEKQFKEEYSRLAVQSMDFAVSCLDLCRTSDEVHSLLTANDITPDGDTQYHLATIKHA-------FVAHSNCQHQLENTFYGNMFCIRDFEGWQRLQFFLIFTPLLPILYITYLFLPNLKVPTPQ--SLMSRQTITRKLKVCQLLRCPIVKFIGHMLSYFIFLLLITVATFRLDKDNDEVENPDLWKVRAFQIWSYDFRSSQQVMTKIHILLLFWILGQLFGESKQVYHYGLQDYFRSYYNIMDWVSVSLYLGAFALRIFVDLRVQATQKIFLHQLAYAQSLLLNASTVIVDNGASVFEIKMETNPKTNYVAYRNYLLSEDTAYWLRGCRLWWAPDDPEYVSDCLFALANVLSFARVSYLMPAWELLGPLQISLAQMVSDIIRFMALFSVMLIAFVVGLTNLYWYFAKMIIAIDSKGGASAATPATVRYASGVPAFQSSTATFHTLFWALFGMSSNNVTMVEEELASVYPGHEHLRVNNAAFMISSLGSVLYAVYNACMIIILLNMLIAMMSKSFDEIQGDRLEEWKFARANLWLVYIEHEGVLPAPLNFLPSR--VAITKIIRRIRRTLLGCRVERSGGHKLRNYETEKYLDEGEDLDLKMDDSNMVRISNSKSNEGSVLAARSSLLEKSGDLESHLTRVKCNIMRRYLFQLQKQKEAENKTGDLA 1193          
BLAST of Short transient receptor potential channel vs. Ensembl Cavefish
Match: trpc6b (transient receptor potential cation channel, subfamily C, member 6b [Source:ZFIN;Acc:ZDB-GENE-081030-19])

HSP 1 Score: 397.512 bits (1020), Expect = 4.002e-123
Identity = 274/830 (33.01%), Postives = 429/830 (51.69%), Query Frame = 3
Query:  240 YLNAVEFGEYEMVQKMVED-PEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEKSHQRQRLRMQNAKKSYR-----SQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVI---RYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITV-ATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLFGFEGLKVQEVNGYEEYIEANEQKKD-------------LNKMKANMIRRYLFQLQRMKEQ-ENKSGDL 2657
            +L A E+G   +V++M+E+ PE+NVNCVDYMG++A+ LA+ ++++E+ ELLL K     I DALL AIS   I +V+ I+ HQ F    +      L+ + +   +      ++FS DITP++LA+H + +EI+ +LL RG  ++ PHD  C C  C   +  DS      R++ Y+ L+SPAYL+L++ D V +A  L NEL  LA  EK+FK +Y  L++QC  F    +DLCR ++EV+S+L+G    N+      R  L  +KLA++   KKFVAH NCQ Q+ + +Y  L  +R      K+     +   LPIL ++Y   P++K                     G  ++ P +KF+    S+ +FL L+ + A  R +   L  +       A       FR  T   + +++ +I W+ G I  EC ++++ G + Y    +N++D   L +++ S+  R +  +        Y+A+              S   + Y +  N  L  E  Y+ R  R++W P DP+ +S+ L+A+A V+SFSR+ Y++PA E  GPLQISL R + DI +FM +F ++ VAF++GM NLY Y+           N+            AF +   +F TL+W +FG S   S +I+                +    I  +G  LYG Y   ++I+LLNMLIAM++ SF EI+ D   EWKFARA LW  Y E  G LPVPFNL+ S   ++ +   +++L     L   + +G +E  E NE  K                ++   +I+RY+ + Q  KE  E   G+L
Sbjct:   35 FLEAAEYGNIPVVRRMLEELPELNVNCVDYMGQNALQLAVANEHLEVTELLLKKENLARIGDALLLAISKGYIRIVEAILAHQAFADTSRL-TNSPLQTETSDDFFAYDEDGTRFSHDITPIILASHCHEYEIVHILLRRGARIERPHDYFCKCNTCIYHQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVLTALELSNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCRNTEEVESILNGDAELNDNFASTGRPSLIRLKLAIKYELKKFVAHPNCQQQLLSIWYENLSGLRQQTTAVKLLVVLGVAVGLPILALLYWIAPSSK--------------------FGKIIRGPFLKFVAHAASFTIFLGLLVMNAADRFEGTTLLPNMTIHDHPAQL-----FRMKTTPFTWMEMLIISWVIGMIWAECKEIWSQGPREYLLEPWNLLDFGMLAIFVTSFIARFMAFWHA------YTAQ--------------SYVDERYTDLSNITLPFEIEYY-RLARVYWVPSDPQLISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYY------LGAKQNN------------AFTTVEESFKTLFWAIFGLSEVKSVVIN----------------NGHKFIENIGYVLYGVYNVTMVIVLLNMLIAMINSSFQEIEDDADVEWKFARAKLWFSYFEEGGTLPVPFNLVPSPKSVVSLAYRIKQLL-LTPLHRHK-DGEKEDTELNELGKQKSSDYRGSPRSSRYRRIMKRLIKRYIIKAQMDKESDEVNEGEL 781          
BLAST of Short transient receptor potential channel vs. Ensembl Cavefish
Match: trpc6a (short transient receptor potential channel 6-like [Source:NCBI gene;Acc:103025180])

HSP 1 Score: 383.645 bits (984), Expect = 1.437e-117
Identity = 278/856 (32.48%), Postives = 438/856 (51.17%), Query Frame = 3
Query:  150 KNKKCTIVGQKLQSESGLVFSTH---LKDKEYIYLNAVEFGEYEMVQKMVED-PEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEK--SHQRQRLRMQN--AKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVIRYP-LATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFL-FLITVATFRLDVEFLTADTDTWTEKANTIFKYD---FRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLFGFEGLKVQEVNGYE----EYIE--ANEQKKDLNKMKANMIRRYLFQLQRMKE-QENKSGDL 2657
            KN++  + G      +  +F+ H   L   E  +L+A E+G   +V++M+E+ P ++VNCVDYMG++A+ LA+ ++++E+ ELLL +     I DALL AIS   I +V+ I+ H+ F  +++  +  RQ     +  A     ++FS DITP++LA+H + +EI+ +LL RG  ++ PHD  C C  C   +  DS      R++ Y  L+SPAYL+L+  D V +A  L NEL  LA  EK+FK +Y  L+IQC  F    +DLCR ++EV+++L+G    +  +   P L  + LA++   KKFVAH NCQ Q+ + +Y  L  +R      K+     +   LP L M+Y   P +K                    +G  ++ P +KF+    S+ +FL  L+  A  R D   L  +         TI  Y    FR  T  ++ +++ ++FW+ G I  EC ++++ G + Y    +N++D   L +++AS+  R +  +        Y+A+  +                 Y +  N  L  E  Y+ R  R+ W P DP+ VS+ L+++A V+SFSR+ Y++PA E  GPLQISL R + DI +FM +F L+ +AF++GM NLY Y+  +    N                 AF +   +F TL+W +FG S   S +                V++    I   G  LYG Y   ++I+LLNMLIAM++ SF EI+ D   EWKFARA LW  Y E    LPVPFNL+ S    L +   ++ L      K + +   E    E+ E  + E  +   K+   +I+RY+ + +  KE  E   G+L
Sbjct:   60 KNRRQAVRG------AAYMFNAHPNSLTPVEERFLDAAEYGNIPVVRRMLEEIPGLDVNCVDYMGQNALQLAVANEHLEVTELLLKRDNLSRIGDALLLAISKGYIRIVEAILSHKAFADSKRLTASPRQAAMHDDFFAYDEDGTRFSHDITPIILASHCHEYEIVHILLGRGARIEQPHDYFCTCDTCNYHQKYDSFSHSRSRINAYRGLASPAYLSLSNEDPVLAALELSNELACLANIEKEFKNDYRKLSIQCKDFVVGLLDLCRNTEEVEAILNGEEDDSCDLPGRPSLTRLNLAIKYELKKFVAHPNCQQQLLSIWYENLPGLRQQTTAVKLLVVLGVAIGLPFLSMVYWVAPCSK--------------------LGKIMRGPFLKFVAHAASFTIFLGMLVLNAADRFDGTKLLPNM--------TIHDYPTQLFRMKTTPLTWMEMLIVFWVIGMIWAECKEIWSQGPREYLLEPWNMLDFGMLAIFVASFVTRLMAFWHT------YAAQCYV--------------DVHYTDITNITLPLEVEYF-RLARIDWLPSDPQLVSEGLYSIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFILVFLAFMIGMFNLYSYY--LGAKQN----------------DAFTTIEESFKTLFWAIFGLSEVKSVV----------------VNNGHKFIENTGYVLYGVYNVTMVIVLLNMLIAMINSSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLMPSPKSFLGLGLGLKALMQKIIQKHKAMTKGEAELSEFGEKASGEASRRYKKIMKRLIKRYIIKARMDKESDEVNEGEL 826          
BLAST of Short transient receptor potential channel vs. Ensembl Cavefish
Match: trpc6a (short transient receptor potential channel 6-like [Source:NCBI gene;Acc:103025180])

HSP 1 Score: 382.489 bits (981), Expect = 8.323e-117
Identity = 262/780 (33.59%), Postives = 407/780 (52.18%), Query Frame = 3
Query:  150 KNKKCTIVGQKLQSESGLVFSTH---LKDKEYIYLNAVEFGEYEMVQKMVED-PEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEK--SHQRQRLRMQN--AKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVIRYP-LATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFL-FLITVATFRLDVEFLTADTDTWTEKANTIFKYD---FRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILS 2450
            KN++  + G      +  +F+ H   L   E  +L+A E+G   +V++M+E+ P ++VNCVDYMG++A+ LA+ ++++E+ ELLL +     I DALL AIS   I +V+ I+ H+ F  +++  +  RQ     +  A     ++FS DITP++LA+H + +EI+ +LL RG  ++ PHD  C C  C   +  DS      R++ Y  L+SPAYL+L+  D V +A  L NEL  LA  EK+FK +Y  L+IQC  F    +DLCR ++EV+++L+G    +  +   P L  + LA++   KKFVAH NCQ Q+ + +Y  L  +R      K+     +   LP L M+Y   P +K                    +G  ++ P +KF+    S+ +FL  L+  A  R D   L  +         TI  Y    FR  T  ++ +++ ++FW+ G I  EC ++++ G + Y    +N++D   L +++AS+  R +  +        Y+A+  +                 Y +  N  L  E  Y+ R  R+ W P DP+ VS+ L+++A V+SFSR+ Y++PA E  GPLQISL R + DI +FM +F L+ +AF++GM NLY Y+  +    N                 AF +   +F TL+W +FG S   S +                V++    I   G  LYG Y   ++I+LLNMLIAM++ SF EI+ D   EWKFARA LW  Y E    LPVPFNL+ S
Sbjct:   60 KNRRQAVRG------AAYMFNAHPNSLTPVEERFLDAAEYGNIPVVRRMLEEIPGLDVNCVDYMGQNALQLAVANEHLEVTELLLKRDNLSRIGDALLLAISKGYIRIVEAILSHKAFADSKRLTASPRQAAMHDDFFAYDEDGTRFSHDITPIILASHCHEYEIVHILLGRGARIEQPHDYFCTCDTCNYHQKYDSFSHSRSRINAYRGLASPAYLSLSNEDPVLAALELSNELACLANIEKEFKNDYRKLSIQCKDFVVGLLDLCRNTEEVEAILNGEEDDSCDLPGRPSLTRLNLAIKYELKKFVAHPNCQQQLLSIWYENLPGLRQQTTAVKLLVVLGVAIGLPFLSMVYWVAPCSK--------------------LGKIMRGPFLKFVAHAASFTIFLGMLVLNAADRFDGTKLLPNM--------TIHDYPTQLFRMKTTPLTWMEMLIVFWVIGMIWAECKEIWSQGPREYLLEPWNMLDFGMLAIFVASFVTRLMAFWHT------YAAQCYV--------------DVHYTDITNITLPLEVEYF-RLARIDWLPSDPQLVSEGLYSIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFILVFLAFMIGMFNLYSYY--LGAKQN----------------DAFTTIEESFKTLFWAIFGLSEVKSVV----------------VNNGHKFIENTGYVLYGVYNVTMVIVLLNMLIAMINSSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLMPS 750          
BLAST of Short transient receptor potential channel vs. Ensembl Cavefish
Match: trpc7a (short transient receptor potential channel 7-like [Source:NCBI gene;Acc:103035292])

HSP 1 Score: 379.793 bits (974), Expect = 1.206e-116
Identity = 258/755 (34.17%), Postives = 400/755 (52.98%), Query Frame = 3
Query:  210 STHLKDKEYIYLNAVEFGEYEMVQKMVEDPE-INVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTF---IKAEKSHQRQRLRMQN--AKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNN--KVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILS 2450
             T L  +E  +L+A E+G   +V+KM+E+ + +NVNC+DYMG++A+ LA+ ++++E+ ELLL       I DALL AIS   + +V+ I+ H  F   ++   S   Q  R  +  A     ++FS D+TPV+LAAH   +EI+ +LL +G  ++ PHD  C C  C + + +DS      R++ Y+ L+S AYL+L++ D V +A  L NEL QLA  E +FK +Y  L++QC  F    +DLCR ++EV+++L+G +  N   +  R  L+ VKLA++   KKFVAH NCQ Q+   +Y  L  +R   +  K      ++  LP L + Y   P +K                    +G  L+ P +KF+    S+  FL L+ +      +       +T T+    +    FR  T   S  ++ ++ W+ G I  EC +++  G + Y    +NI+D   L +++ASY  R +   + + A  LY  +L +  S + N TL       YF +  N                W P DP+ +S+ L+++A V+SFSR+ Y++PA E  GPLQISL R + DI +FM +F ++ +AF++GM NLY Y+             A+++       PAF +   +F TL+W++FG S   S +      L Y         D  F I  +G  LYG Y   ++I+LLNMLIAM++ S+ EI+ D   EWKFARA LWL Y +    LP PFNL+ S
Sbjct:    6 GTSLTAEEERFLDAAEYGNIPVVRKMLEESKTLNVNCMDYMGQNALQLAVGNEHLEVTELLLKTEGLARIGDALLLAISKGYVRIVEAILAHPAFEGGLRFAHSPLEQEPREDDFYAYDEDGTRFSQDVTPVILAAHCQEYEIVHILLLKGARIEKPHDHFCKCSECMESQKQDSFSHSRSRMNAYKGLASAAYLSLSSEDPVLTALELSNELSQLANIETEFKNDYRKLSMQCKDFVVGVLDLCRNTEEVEAILNGDVDHNTPREHNRPCLSRVKLAIKYEVKKFVAHPNCQQQLLTLWYENLSGLRQQPIGVKCLTVLGVMVGLPFLAIAYWIMPYSK--------------------VGQVLRSPFMKFVAHAVSFTTFLGLLVLNASDRFLGVKNLPNETITDHPRQV----FRVKTTQFSWTEMLIMKWVLGMIWSECKEIWEDGPREYIMHLWNILDFGMLSIFIASYTARLMAFLRASNAQ-LY-VDLYVTTSDLSNATL--PEEVAYFTYARNR---------------WLPSDPQLISEGLYSIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFLAFMIGMFNLYSYYL-----------GAKYN-------PAFTTVEESFKTLFWSIFGLSEVISVV------LKY---------DHKF-IENIGYVLYGVYNVTMVIVLLNMLIAMINHSYQEIEEDADVEWKFARAKLWLSYFDEGRTLPPPFNLVPS 683          
BLAST of Short transient receptor potential channel vs. Ensembl Cavefish
Match: trpc7a (short transient receptor potential channel 7-like [Source:NCBI gene;Acc:103035292])

HSP 1 Score: 381.719 bits (979), Expect = 2.211e-116
Identity = 261/777 (33.59%), Postives = 409/777 (52.64%), Query Frame = 3
Query:  153 NKKCTIVGQKLQSESGLVFS---THLKDKEYIYLNAVEFGEYEMVQKMVEDPE-INVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTF---IKAEKSHQRQRLRMQN--AKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNN--KVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILS 2450
             ++ T + +K +     +FS   T L  +E  +L+A E+G   +V+KM+E+ + +NVNC+DYMG++A+ LA+ ++++E+ ELLL       I DALL AIS   + +V+ I+ H  F   ++   S   Q  R  +  A     ++FS D+TPV+LAAH   +EI+ +LL +G  ++ PHD  C C  C + + +DS      R++ Y+ L+S AYL+L++ D V +A  L NEL QLA  E +FK +Y  L++QC  F    +DLCR ++EV+++L+G +  N   +  R  L+ VKLA++   KKFVAH NCQ Q+   +Y  L  +R   +  K      ++  LP L + Y   P +K                    +G  L+ P +KF+    S+  FL L+ +      +       +T T+    +    FR  T   S  ++ ++ W+ G I  EC +++  G + Y    +NI+D   L +++ASY  R +   + + A  LY  +L +  S + N TL                  E   +    R  W P DP+ +S+ L+++A V+SFSR+ Y++PA E  GPLQISL R + DI +FM +F ++ +AF++GM NLY Y+             A+++       PAF +   +F TL+W++FG S   S +      L Y         D  F I  +G  LYG Y   ++I+LLNMLIAM++ S+ EI+ D   EWKFARA LWL Y +    LP PFNL+ S
Sbjct:   69 QRRHTTLREKGRRGPAYMFSERGTSLTAEEERFLDAAEYGNIPVVRKMLEESKTLNVNCMDYMGQNALQLAVGNEHLEVTELLLKTEGLARIGDALLLAISKGYVRIVEAILAHPAFEGGLRFAHSPLEQEPREDDFYAYDEDGTRFSQDVTPVILAAHCQEYEIVHILLLKGARIEKPHDHFCKCSECMESQKQDSFSHSRSRMNAYKGLASAAYLSLSSEDPVLTALELSNELSQLANIETEFKNDYRKLSMQCKDFVVGVLDLCRNTEEVEAILNGDVDHNTPREHNRPCLSRVKLAIKYEVKKFVAHPNCQQQLLTLWYENLSGLRQQPIGVKCLTVLGVMVGLPFLAIAYWIMPYSK--------------------VGQVLRSPFMKFVAHAVSFTTFLGLLVLNASDRFLGVKNLPNETITDHPRQV----FRVKTTQFSWTEMLIMKWVLGMIWSECKEIWEDGPREYIMHLWNILDFGMLSIFIASYTARLMAFLRASNAQ-LY-VDLYVTTSDLSNATL-----------------PEEVAYFTYARNRWLPSDPQLISEGLYSIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFLAFMIGMFNLYSYYL-----------GAKYN-------PAFTTVEESFKTLFWSIFGLSEVISVV------LKY---------DHKF-IENIGYVLYGVYNVTMVIVLLNMLIAMINHSYQEIEEDADVEWKFARAKLWLSYFDEGRTLPPPFNLVPS 768          
BLAST of Short transient receptor potential channel vs. Ensembl Sea Lamprey
Match: trpc4b (transient receptor potential cation channel, subfamily C, member 4b [Source:ZFIN;Acc:ZDB-GENE-120329-1])

HSP 1 Score: 211.846 bits (538), Expect = 4.203e-59
Identity = 179/653 (27.41%), Postives = 287/653 (43.95%), Query Frame = 3
Query:  546 KSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVIRYP----LATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISP--IQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVR 2486
            + + S+F+ D+TP++LAAHTNN+E+I+LLL RG ++  PH + C C  C      D L     RL  Y AL+SP  +AL + D   +AF L  EL +L++ E +FK EY  L+ QC QFAK  +D  R++ E++ +L+    +++     P    L  +KLA++  +K+FVA  NCQ  + + +Y      R  +   K+   + L    P+  + Y+  P ++                    +  FL+ P IKFI    SY  FLFL+ +A+ ++      A TD                N +  SP  ++  ++ WI   I  E  Q++  G   Y   ++N+MD     LYLA+ +L+ +   K +G+ A                                             R  W  + P  V++ LFA+AN+ S  R+  L  A   LGPLQISL RM+ DI++F+ ++ L+++AF  G+  LY+Y+     T+    N     +  +    AF +  +    L+             +   + L   G    H+  S  +   +  F Y + C  +   +          + D        EWKFAR  LW+ Y E    LP PFN++ S      +   VR
Sbjct:    8 EGHSSEFTPDMTPIILAAHTNNYELIKLLLTRGVSVPRPHAVRCACLQCAAGSEADGLRHSRSRLAVYRALASPCLVALASEDPFLTAFTLSCELCELSRVENEFKAEYEELSQQCKQFAKELLDQTRSTRELEIVLNYK-EESDGAPEAPDAFNLERLKLAIKYHQKEFVAQPNCQQLLASLWYDGFPGWRRRHWAVKLVTCATLGLLFPLFSVCYLLAPRSR--------------------MAFFLRKPFIKFICHTASYLTFLFLLLLASQQI------ARTD---------------PNMQGPSPTLVEWMILPWICRLIWAEIKQMWDGGFSEYVHDWWNLMDFVMNSLYLATISLKLVAYLKYSGSKA---------------------------------------------REQWEMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYE----TSAGQGNDTCKGIRCEKQNNAFSTLCNCLKHLF-----------PSVSICVHLCPSGSICFHLFTSVSICFHL--FPYVSICVHLFPSVSITSCNAFKNTVDHAD----IEWKFARTKLWMSYFEEGATLPPPFNIVPSPKSAWYLCRYVR 552          
BLAST of Short transient receptor potential channel vs. Ensembl Sea Lamprey
Match: trpc4b (transient receptor potential cation channel, subfamily C, member 4b [Source:ZFIN;Acc:ZDB-GENE-120329-1])

HSP 1 Score: 206.068 bits (523), Expect = 3.822e-57
Identity = 177/646 (27.40%), Postives = 280/646 (43.34%), Query Frame = 3
Query:  567 SSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVIRYP----LATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISP--IQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVR 2486
            + D+TP++LAAHTNN+E+I+LLL RG ++  PH + C C  C      D L     RL  Y AL+SP  +AL + D   +AF L  EL +L++ E +FK EY  L+ QC QFAK  +D  R++ E++ +L+    +++     P    L  +KLA++  +K+FVA  NCQ  + + +Y      R  +   K+   + L    P+  + Y+  P ++                    +  FL+ P IKFI    SY  FLFL+ +A+ ++      A TD                N +  SP  ++  ++ WI   I  E  Q++  G   Y   ++N+MD     LYLA+ +L+ +   K +G+ A                                             R  W  + P  V++ LFA+AN+ S  R+  L  A   LGPLQISL RM+ DI++F+ ++ L+++AF  G+  LY+Y+       N            ++    F S    FH     LF   S    +        +P  S    +D    +          + + ++     +  +    +  E   D   EWKFAR  LW+ Y E    LP PFN++ S      +   VR
Sbjct:    1 TPDMTPIILAAHTNNYELIKLLLTRGVSVPRPHAVRCACLQCAAGSEADGLRHSRSRLAVYRALASPCLVALASEDPFLTAFTLSCELCELSRVENEFKAEYEELSQQCKQFAKELLDQTRSTRELEIVLNYK-EESDGAPEAPDAFNLERLKLAIKYHQKEFVAQPNCQQLLASLWYDGFPGWRRRHWAVKLVTCATLGLLFPLFSVCYLLAPRSR--------------------MAFFLRKPFIKFICHTASYLTFLFLLLLASQQI------ARTD---------------PNMQGPSPTLVEWMILPWICRLIWAEIKQMWDGGFSEYVHDWWNLMDFVMNSLYLATISLKLVAYLKYSGSKA---------------------------------------------REQWEMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETSAGQGNDTCKGIRCEKQNNAFSTWFTSVSICFH-----LFPYVSICVHL--------FPSVSIFFYTDKRKNMLNAAYLREMHFSSAIVACQTIIRASASDPNHVEDHADI--EWKFARTKLWMSYFEEGATLPPPFNIVPSPKSAWYLCRYVR 544          
BLAST of Short transient receptor potential channel vs. Ensembl Sea Lamprey
Match: trpc3 (transient receptor potential cation channel, subfamily C, member 3 [Source:ZFIN;Acc:ZDB-GENE-140129-1])

HSP 1 Score: 194.126 bits (492), Expect = 1.405e-51
Identity = 106/305 (34.75%), Postives = 177/305 (58.03%), Query Frame = 3
Query:  210 STHLKDKEYIYLNAVEFGEYEMVQKMVEDP----EINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEK---SHQRQRLRMQN--AKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSG--------------TIVKNNKVIRYPLATVKLAMQCSEKKFVAHS 1055
            +T L  +E  +L+A E+G   +V++M+ED      +NVNCVDYMG++A+ LA+ ++++E+ ELLL + +   + DAL+ AIS   + +V+ I+ H  F   ++   S + Q  +  +  A     ++FS DITP++LAAH   +EI+ +LL RG  ++ PHD  C C  C + +  D+      R++ Y  L+SPAYL+L++ D V +A  L NEL  LA  EK+FK +Y  L++QC  F    +DLCR ++EV+++L+G               +++    I+Y +  +   ++    KFVAH+
Sbjct:   34 ATSLTAEEERFLDAAEYGNIPVVRRMLEDGGAGRSLNVNCVDYMGQNAMQLAVGNEHLEVAELLLKRDKLSRVGDALMLAISKGYVRIVEAILAHPAFAGEKRLILSPREQETQDDDFYAYDEDGTRFSPDITPIILAAHCQEYEIVHILLRRGARIERPHDYFCKCGECTEKQRHDAFSHSRSRINAYRGLASPAYLSLSSEDPVLTALELSNELAMLANIEKEFKNDYKKLSVQCKDFVVGLLDLCRDTEEVEAILNGDAELNPPACDRQRAALIRLKLAIKYEVKKIGKVLRSPFMKFVAHA 338          

HSP 2 Score: 185.267 bits (469), Expect = 1.214e-48
Identity = 130/397 (32.75%), Postives = 205/397 (51.64%), Query Frame = 3
Query: 1266 IGLFLQCPVIKFIGQMYSYFMFLFLITV-ATFRLD-VEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILS 2450
            IG  L+ P +KF+    S+ +FL L+ + A+ R + V+ L  +T+T  +    +F    R  T   +  ++ ++ WI G I  EC +++  GLK Y    +N++D   L +++AS+  R               A LK +++  F ++       E F   +N    E+  +    R  W P DP+ +S+ L+++A V+SFSR+ Y++PA E  GPLQISL + + DI +FM +F ++ +AF++GM NLY Y+    V                    AF +   +F TL+W++FG S   S +I+ N                   I  +G  LYG Y   ++++LLNMLIAM++ S+ EI+ D   EWKFARA LW+ Y E    LPVPFNL+ S
Sbjct:  323 IGKVLRSPFMKFVAHAASFTIFLALLVLNASDRFEGVKLLPNETET--DHPQQLF----RIKTTSFTWTELLIVAWIIGMIWAECKELWAEGLKEYLFQLWNVLDFGMLSIFVASFTARLF-------------AFLKASEAQRFVDS-------EGFPNVSNATLPEHIRYFNLARSHWLPSDPQIISEGLYSIAIVLSFSRIAYILPANESFGPLQISLGQTVKDIFKFMVIFIMVFLAFMIGMFNLYSYYRGAKVNR------------------AFVTVEESFKTLFWSIFGLSEVASVVINYNHK----------------FIENIGYILYGVYNVTMVVVLLNMLIAMINSSYQEIEDDSDVEWKFARAKLWISYFEQGRTLPVPFNLVPS 659          
BLAST of Short transient receptor potential channel vs. Ensembl Nematostella
Match: EDO48346 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJX1])

HSP 1 Score: 188.348 bits (477), Expect = 1.568e-50
Identity = 191/712 (26.83%), Postives = 325/712 (45.65%), Query Frame = 3
Query:  369 MEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEKSHQRQRLRMQNAKKSYRSQFSSD--ITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALT---TSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLS-----GTIVKNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIF 2474
            +EMI LLL       +  ALL A+S + +  VK ++ +      E ++ R   R  +     ++   S+  +TP++LA+H N+++I++LLL +GH +D  HD GC+CP C+ L    +    L RL+TY AL+SP Y++LT     D V  AF L  EL +LA  E +F+ +Y  L+ QC +FA A +D CR   E++ ++S     G + KN       L  +  A+     +FVAH  CQ  + +  YG         +  KI F  L    +P+  ++Y F P              +  +S K      L  P++KFI    ++ +FL L+ +++ +    F++++T         + K+ F  +  +I+        WIFG IV E   ++  G +RY   ++N++    LGL++ S  L       + G+    S E  +A+S                                        Y    +++  F +  +++F   +  +     LGPLQ+SL +M+ DI++F+ LF LI +AFVV +  +Y  +     T + +           S    F S   +   ++W +F    + + + + N   S+P + T           + G  L+  +    I++ +NMLIAMMS SF ++       WKF+R  +W+ YI    VLP PF+++ S   I+  F
Sbjct:    1 IEMIRLLLK--NGADVGAALLQAVSKDNVLYVKALLAY------ENNNDRFSRRSSSCVNLSKNTNDSNRYMTPLILASHNNSYDIVKLLLSKGHTIDRVHDRGCLCPWCQSLGRIGT---SLHRLYTYRALASPVYMSLTFLSCKDPVRQAFELNKELVELADIEYEFRSDYLQLSQQCEEFAVALLDQCRDMSEIEQMMSVPDMDGALTKNGS---KSLGVLDYAINNKNGRFVAHPYCQMMLNSVIYGDFHTWEKMGVTLKILFALLFTIFIPVWAIVYFFTP--------------TSCLSQK------LATPILKFIMHTGAFGLFLLLLILSSIQ---RFISSNT--------FLLKFLFNFSDILIT-------IWIFGLIVQELKDMWRQGKERYLSQWWNLVTLAMLGLFIISGILW------VAGSALSVSKEGSLAES----------------------------------------YRFILLANAFFTIGVLLAFLHFSNAVQVNSTLGPLQLSLVKMVKDILKFLLLFFLIYLAFVVALRRVYSQYVWAGKTPHTI-----------SLYSVFCSVQGSMRLVFWAIF----DKTELEEFNTDPSFPTKIT----------QSTGEVLFALFNIASILVAINMLIAMMSNSFQKVADSEDFLWKFSRTRMWMEYIIKGSVLPAPFSVLPSIASIINFF 589          
BLAST of Short transient receptor potential channel vs. Ensembl Nematostella
Match: EDO45311 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSZ7])

HSP 1 Score: 174.481 bits (441), Expect = 2.231e-46
Identity = 165/615 (26.83%), Postives = 275/615 (44.72%), Query Frame = 3
Query:  582 PVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVIRYP---LATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRC---IVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSN-SAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYI 2405
            P+++AA   N+E++ +L+ +G  L  PH++ C C  C+     D+     +RL  Y  L++P ++++T++D   +AF L +EL  +A++E +++++Y  L+ QC QF    +D CRTS E   +L+    +N  V  Y    L  V  A+  ++K+FVAH  CQH V    +G +   R  + + +I +    +   P+L +IY F P                     + +G  ++ P +KFI    S+ +FL L+ V++                   +  F+  FR   ++ S ++  +  WI G    EC QV+  G +RY  S +N MD   + L L ++ L     IVD+  N          K+A  ++ +                                          +D ++A   V SF R+ YL      LG LQ+SL+RM+  I +F  +  +++ +F V MT LY    +      P+ N +++    LD     + +  ST  TL W                  L   G  TL+V     LI    + L+  Y A  +++LLNMLIAMMS S+ +++ +   E+KFAR  LW  YI
Sbjct:    1 PLVVAAQLGNYEVLNMLVSKGFQLVKPHNVLCRCEECQA----DNFRESQRRLDIYRGLANPVFISMTSNDPFLTAFELSSELEVIARREDEYEKDYLQLSQQCSQFTIGLLDECRTSREQRCILNYP-GENGSVEDYAENSLGLVNSAISYNQKEFVAHPFCQHLVMQHIFGDITGWRTNHFLYRIAYVLTQVIIFPVLAVIYFFMP--------------------FLEVGRKIKRPFVKFINHTSSFVVFLILLAVSS-------------------HHQFEIRFR---KMPSGLEWLIFSWILGVAWSECKQVWHEGARRYFSSGWNWMDIGMVFLLLGAFVLWTIIFIVDFDSNA---------KLAHDVLLS-----------------------------------------TADGMYAFGVVASFFRLIYLCQISRYLGLLQLSLSRMVRVIFQFAFISCVVLWSFSVAMTMLYMSSFEAYQLPRPVKNVTSDIDAILDK---GYDNLLSTMVTLMWA----------------SLDMVGLDTLNVFKKQSLIQFWTAALFTLYHAASMVVLLNMLIAMMSNSYQQVEDNIETEYKFARTQLWTDYI 499          
BLAST of Short transient receptor potential channel vs. Ensembl Nematostella
Match: EDO49302 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH68])

HSP 1 Score: 91.6633 bits (226), Expect = 5.673e-19
Identity = 127/590 (21.53%), Postives = 241/590 (40.85%), Query Frame = 3
Query:  297 PEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEKSHQRQRLRMQNAKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQ-------RLHTYEALSSPAYLA---LTTSDSVSSAF-------LLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLS------GTIVKNNKVIR------YPLATVKLAMQCSEKKFVAHSNCQHQVENKFY-GKLLFIRDFNLIEKIKFF---------SLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIR 1949
            P+      D++ R+ +   +  +  +++++ LD  E   I  AL NA+     + V+ ++ +        S +R  +  ++ K        + ++P+MLA H    +II+L L +G+ +  PHD        E+L N  ++ LEL        R++ Y AL+SP Y++   +   D++   F        L+N++Y    ++ +F  +Y  ++  C +FA   ++ CRT+DE + LL           K+ K I         L+ + LA++    + VAH   Q +++   Y G  +F R+  +     ++         +LL   LP L + YI  P+ +              ISN       L+ P++KF     ++ +F   + V++F           D +T+             T I   I    + ++ G  + E   ++  G  RY + ++NI+    + L+L SY+LR                            T + +        +N  ++S                    +++  FA A V SF  +T  +   +V GPLQ+SL  + +D+I+
Sbjct:   44 PDFLFRTRDFVTRALLSDTIDLNRGDILKIFLD--EQARIGGALFNAVRKGSKDCVQTMLPY-------ISSKRGDIGPEDVKPG------AFVSPLMLAVHLEKFDIIELFLSKGYRVLEPHDDDDEDDDDEQL-NRTNVGLELSSELSFNLRVNAYRALASPLYISYFFIMNPDALHPIFHVLELNKKLKNQMY----RDFEFNNDYKQISKDCQRFAVDLLEQCRTTDETNVLLDVYPEIQRVYEKDKKHIEGSHTAFKELSMLNLAIRNDMNELVAHPQSQLRLDKILYHGLYMFKREPRVWRYRSWYTGKLFWLRHTLL---LPFLALFYIIAPDCR--------------ISN------VLKTPMVKFYSHTGAFVLFAIALAVSSFE----------DHFTDY------------TLIPVLIDWGTLLFVLGLFLQEVKDLYFQGAFRYIRQWWNIISLLMVVLFLISYSLRL---------------------------TAYLSPQTSPPHLKNLAVRSSQL---------------SLLANSFFAFAMVFSFIHLTNFLQVSDVFGPLQLSLYMLFADLIK 526          
BLAST of Short transient receptor potential channel vs. Ensembl Medaka
Match: TRPC6 (short transient receptor potential channel 6 [Source:NCBI gene;Acc:101169223])

HSP 1 Score: 389.423 bits (999), Expect = 2.711e-120
Identity = 274/826 (33.17%), Postives = 420/826 (50.85%), Query Frame = 3
Query:  231 EYIYLNAVEFGEYEMVQKMVED-PEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEKSHQRQRLRMQNAKK-----SYR---SQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLS-GTIVKNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITV-ATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLFGFEGLKVQEVNGYEEYIEANEQKKDL-----NKMKANMIRRYLFQLQRMKEQENKSGDLA 2660
            E I+L A E+G    V++M+E+ P IN  CVDY G++A+ LA+ ++++E+ +LLL + E   I DALL AIS   + +V+ ++ H++F          RL    A+      SY    ++FS+DITP++LA+H   +EI+ +L  RG  +  PHD  C C  C + +  DS      R+H Y+ L+SPAYL L++ D V  A  L NEL  LA  EK+FK +Y  L++QC  F    +DLCR+++EV+++L+ G+   +    R  L  +KLA++   KKFVAH NCQ Q+ + +Y  L  IR  ++  K+         LP+L  I+   P +K                    +G  +  P +KF+    S++MFL L+ + A  R     L  +  T    +       FR  T   S +++ +I WI G+I  EC  ++   ++ Y    +N++D  +L ++L S+  R +  +  + A                         + Y    N  L SE  Y+ +  R+ W P DP+ +S+ L+A+A V+SFSR+ Y++PA E  GPLQISL R + DI +FM +F  + VAF+VGM NLY Y+           NS            AF +   +F TL+W +FG S   S +I+ N                   I  +G  LYG Y  +++I+LLNMLIAM + SF EI+ D   EWKFARA LW  Y +   VLPVPFNLI S   +L     +R+ F +E  K       E   +  E K  L      K+ + +++R++ + Q   ++EN  G+ A
Sbjct:   33 EEIFLEAAEYGNIPEVRRMLEELPHIN--CVDYKGQNALQLAVANEHLEVAKLLLKQKEMKRIGDALLLAISKGYVRIVEAVLTHESFADG------GRLADSPAQTHDDFFSYDENGTRFSADITPIILASHFQEYEIVHMLFVRGARIQRPHDYLCGCGPCSEQQQRDSFSHSQSRIHAYKGLASPAYLCLSSQDPVMEALELSNELEVLANTEKEFKNDYKRLSMQCKDFVVGLLDLCRSTEEVEAVLNGGSPAHSGAAGRQSLIRLKLAIKYEVKKFVAHPNCQQQLRSIWYENLSGIRQQSMAVKVLLVLATAVGLPVLAFIHWIAPTSK--------------------VGKLMCGPFVKFVAHAASFWMFLSLLVLNAADRFAGTSLLPNMTTRDYPSQV-----FRMKTTPFSWMEILMISWIIGKIWEECKDIWLQDIREYISEPWNLLDFSTLAIFLTSFMARFMAFWHAHSAQNYI--------------------DRHYKSLSNLTLPSEVEYF-QLARVHWLPSDPQLISEGLYAIAVVLSFSRIAYILPANERFGPLQISLGRTVKDIFKFMVIFITVFVAFMVGMFNLYSYY------LGAKHNS------------AFTTVEESFKTLFWAIFGLSEVKSVVININHK----------------FIENIGYVLYGVYNIIMVIVLLNMLIAMFNSSFQEIEDDSDVEWKFARAKLWFSYFKQGSVLPVPFNLIPSPKSVLSTLQGIRE-FLWESQK-----STENSFDGMELKPSLISTRHQKIMSCLVKRFILKAQ--TDKENSEGNEA 762          
BLAST of Short transient receptor potential channel vs. Ensembl Medaka
Match: trpc7b (short transient receptor potential channel 7-like [Source:NCBI gene;Acc:101169118])

HSP 1 Score: 379.022 bits (972), Expect = 9.648e-116
Identity = 256/760 (33.68%), Postives = 404/760 (53.16%), Query Frame = 3
Query:  210 STHLKDKEYIYLNAVEFGEYEMVQKMVEDPE-INVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTF---IKAEKSHQRQRLRMQNAKKSYR---SQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTI--VKNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITV-ATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKE---YFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILS 2450
             + L  +E  +L+A E+G   +V+KM+E+ + +N NCVDYMG++A+ LA+ ++++E+ ELLL K     I D LL AIS   + +V+ I+ H  F   I+   S   Q +R ++A  +Y    ++FS D+TP++LAAH   +EI+ +LL +G  +D PHD  C C  C + + +DS      R++ Y+ L+S AYLAL++ D V +A  L NEL +LA  E +FK +Y  L++QC  F    +DLCR ++EV+++L+G +     +   R  L+ VKLA++   KKFV+H NCQ Q+   +Y  L  +R  +   K      +   LP L + Y   P +K                    +G  L+ P +KF+    S+ +FL L+ + A+ R +        +T T+    +    FR  T   S  ++ ++ W+ G I  EC ++++ G + Y    +N++D   L +++AS+  R +   K + A       ++       +E L +A   E   YF +  N                W P DP+ +S+ L+A+A V+SFSR+ Y++PA E  GPLQISL R + DI +FM +F ++ VAF++GM NLY Y+             A+++       PAF +   +F TL+W++FG S   S +      L Y         D  F I  +G  LYG Y   ++++LLNMLIAM++ S+ EI+ D   EWKFARA LWL Y +    LP PFNL+ S
Sbjct:   60 GSPLTAEEERFLDAAEYGNIPVVRKMLEESKTLNFNCVDYMGQNALQLAVGNEHLEVTELLLKKDGLARIGDGLLLAISKGYVRIVEAILAHPAFGGGIRLAVSPLEQEMR-EDAFYAYDEDGTRFSHDVTPIILAAHCQEYEIVHILLTKGARIDRPHDYFCKCSECVEKQKKDSFSHSRSRMNAYKGLASAAYLALSSEDPVLTALELSNELARLANIETEFKNDYRKLSMQCKDFVVGVLDLCRDTEEVEAILNGDVDLCPPSPYNRPCLSRVKLAIKYEVKKFVSHPNCQQQLLTIWYENLPGLRQQSFGVKCWTVLGVTVGLPFLAIAYWIMPCSK--------------------LGQILRSPFMKFVAHAVSFTIFLGLLVINASDRFE-GVKNLPNETITDHPRQV----FRVKTTQFSWTEMLIMKWVLGMIWSECKEIWSDGPREYIMHLWNVLDFGMLSIFVASFTARLMAFLKASKAQQYVDMHVR-------DEDLSNASLPEEVAYFTYARNK---------------WRPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYYL-----------GAKYN-------PAFTTVEESFKTLFWSIFGLSEVISVV------LKY---------DHKF-IENIGYVLYGVYNVTMVVVLLNMLIAMINSSYQEIEEDSDVEWKFARAKLWLSYFDEGRTLPAPFNLVPS 737          
BLAST of Short transient receptor potential channel vs. Ensembl Medaka
Match: trpc7b (short transient receptor potential channel 7-like [Source:NCBI gene;Acc:101169118])

HSP 1 Score: 382.104 bits (980), Expect = 1.286e-115
Identity = 268/805 (33.29%), Postives = 425/805 (52.80%), Query Frame = 3
Query:  102 ELVSKQLDS-LRSLIAGKNKKCTIVGQK--LQSESGLVF-----STHLKDKEYIYLNAVEFGEYEMVQKMVEDPE-INVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTF---IKAEKSHQRQRLRMQNAKKSYR---SQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTI--VKNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITV-ATFRLD-VEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKE---YFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILS 2450
            EL   + DS  R  +   N++ T + +K   Q+  G  +      + L  +E  +L+A E+G   +V+KM+E+ + +N NCVDYMG++A+ LA+ ++++E+ ELLL K     I D LL AIS   + +V+ I+ H  F   I+   S   Q +R ++A  +Y    ++FS D+TP++LAAH   +EI+ +LL +G  +D PHD  C C  C + + +DS      R++ Y+ L+S AYLAL++ D V +A  L NEL +LA  E +FK +Y  L++QC  F    +DLCR ++EV+++L+G +     +   R  L+ VKLA++   KKFV+H NCQ Q+   +Y  L  +R  +   K      +   LP L + Y   P +K                    +G  L+ P +KF+    S+ +FL L+ + A+ R + V+ L    +T T+    +    FR  T   S  ++ ++ W+ G I  EC ++++ G + Y    +N++D   L +++AS+  R +   K + A       ++       +E L +A   E   YF +  N                W P DP+ +S+ L+A+A V+SFSR+ Y++PA E  GPLQISL R + DI +FM +F ++ VAF++GM NLY Y+             A+++       PAF +   +F TL+W++FG S   S +      L Y         D  F I  +G  LYG Y   ++++LLNMLIAM++ S+ EI+ D   EWKFARA LWL Y +    LP PFNL+ S
Sbjct:  148 ELRDTEFDSETRQSVEAMNRRHTTLREKGRRQAVRGPAYMFNERGSPLTAEEERFLDAAEYGNIPVVRKMLEESKTLNFNCVDYMGQNALQLAVGNEHLEVTELLLKKDGLARIGDGLLLAISKGYVRIVEAILAHPAFGGGIRLAVSPLEQEMR-EDAFYAYDEDGTRFSHDVTPIILAAHCQEYEIVHILLTKGARIDRPHDYFCKCSECVEKQKKDSFSHSRSRMNAYKGLASAAYLALSSEDPVLTALELSNELARLANIETEFKNDYRKLSMQCKDFVVGVLDLCRDTEEVEAILNGDVDLCPPSPYNRPCLSRVKLAIKYEVKKFVSHPNCQQQLLTIWYENLPGLRQQSFGVKCWTVLGVTVGLPFLAIAYWIMPCSK--------------------LGQILRSPFMKFVAHAVSFTIFLGLLVINASDRFEGVKNLP--NETITDHPRQV----FRVKTTQFSWTEMLIMKWVLGMIWSECKEIWSDGPREYIMHLWNVLDFGMLSIFVASFTARLMAFLKASKAQQYVDMHVR-------DEDLSNASLPEEVAYFTYARNK---------------WRPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYYL-----------GAKYN-------PAFTTVEESFKTLFWSIFGLSEVISVV------LKY---------DHKF-IENIGYVLYGVYNVTMVVVLLNMLIAMINSSYQEIEEDSDVEWKFARAKLWLSYFDEGRTLPAPFNLVPS 869          
BLAST of Short transient receptor potential channel vs. Ensembl Medaka
Match: trpc4b (short transient receptor potential channel 4 [Source:NCBI gene;Acc:101154885])

HSP 1 Score: 326.25 bits (835), Expect = 6.555e-96
Identity = 261/828 (31.52%), Postives = 415/828 (50.12%), Query Frame = 3
Query:  219 LKDKEYIYLNAVEFGEYEMVQKMVEDPEI----NVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEKSHQRQRLRMQNAKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVIRYP--LATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIK---FFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLW--WSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLF----------GFEGLKVQEVNGYEEYIEANEQKKDLNKMKANMIRRYLFQLQRMKEQE 2639
            L   E  YL AVE G+Y  V++ +E+ EI    N+NC+D +GR+A+L+A++++N+E+IELLL    +  + DALL+AI  E +  V+L+++H+   + EK      L  Q       S F+ DITP++LAAHTNN+E+I+LLL RG ++  PH + C C  C    + D L     RL+ Y+AL+SP+ +AL++ D   +AF L  EL +L++ E +FK EY  L+  C QFAK  +D  R+S E++ +L+     N  +      LA +KLA++  +K+FVA  NCQ  + +++Y K    R  +   K+    F  LL P L I Y+I   FP ++                     GL ++ P +KFI    SY  FL L+ +A+  +D           +   N++  +D +      + ++  ++ WI G I  E  Q++ +GL+ Y+  ++NIMD     LYLA+ AL+ +   K+     LY                                         GCR    W  + P  +++ LFA+AN+ S  R+  L  A   LGPLQISL RM+ DI++F+ ++ L+++AF  G+  LY+Y+A            + + +       AF +   T  +L+W++FG  S   T                +V         VG+ ++GTY  + +++LLNMLIAMM+ S+  I      EWKFAR  LW+ Y E  G LP PFN+I S   +  +F  +RK F           FE L V+    ++ Y+  +E ++ L     N+++RY+  + R  + E
Sbjct:   29 LSPMEKAYLGAVEKGDYGSVKQALEEAEIYFRININCIDSLGRTALLIAIENENLEIIELLLSYNVH--VGDALLHAIRKEVVGAVELLLNHKK-PRGEKQVPGILLDKQ------FSDFTPDITPIILAAHTNNYEVIKLLLQRGVSIPQPHAVRCSCVECMSSTDVDCLRYSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELKELSRVENEFKSEYEELSHTCKQFAKDLLDQTRSSKELEIILNYRDDINPILDESTNDLARLKLAIKYCQKEFVAQPNCQQLLASRWYDKFPGWRRRHWAGKLITCFFIGLLFPLLSIFYLI---FPKSR--------------------YGLLIRKPFVKFICHTASYLTFLLLLFLASQHID-----------STGPNSL-SHDVQGPPP--TTVEWMILPWIIGFIWTEIKQMWDNGLEDYADDWWNIMDFIMNSLYLATIALKIVAYVKMK---VLYV----------------------------------------GCRPLDDWEVWHPTLLAESLFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYAT--------EEKSCYGIRCLQQNNAFSTLFETVQSLFWSVFGLVSLYVT----------------NVKPPHEFTEFVGTTMFGTYNIISLVVLLNMLIAMMNNSYQHIADHADMEWKFARTKLWMSYFEEGGTLPPPFNIIPSPKSVCYLFGWIRKRFCRKPAKRIRQTFETLGVRY---FQSYLLNHEYQEVLK----NLVKRYVAAMIRDAKTE 736          
BLAST of Short transient receptor potential channel vs. Ensembl Medaka
Match: trpc4b (short transient receptor potential channel 4 [Source:NCBI gene;Acc:101154885])

HSP 1 Score: 322.783 bits (826), Expect = 9.533e-95
Identity = 245/768 (31.90%), Postives = 389/768 (50.65%), Query Frame = 3
Query:  219 LKDKEYIYLNAVEFGEYEMVQKMVEDPEI----NVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEKSHQRQRLRMQNAKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVIRYP--LATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIK---FFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLF 2495
            L   E  YL AVE G+Y  V++ +E+ EI    N+NC+D +GR+A+L+A++++N+E+IELLL    +  + DALL+AI  E +  V+L+++H+   + EK      L  Q       S F+ DITP++LAAHTNN+E+I+LLL RG ++  PH + C C  C    + D L     RL+ Y+AL+SP+ +AL++ D   +AF L  EL +L++ E +FK EY  L+  C QFAK  +D  R+S E++ +L+     N  +      LA +KLA++  +K+FVA  NCQ  + +++Y K    R  +   K+    F  LL P L I Y+I   FP ++                     GL ++ P +KFI    SY  FL L+ +A+  +D           +   N++  +D +      + ++  ++ WI G I  E  Q++ +GL+ Y+  ++NIMD     LYLA+ AL+ +                                   Y + +N+ +              W  + P  +++ LFA+AN+ S  R+  L  A   LGPLQISL RM+ DI++F+ ++ L+++AF  G+  LY+Y+A            + + +       AF +   T  +L+W++FG  S   T                +V         VG+ ++GTY  + +++LLNMLIAMM+ S+  I      EWKFAR  LW+ Y E  G LP PFN+I S   +  +F  +RK F
Sbjct:   29 LSPMEKAYLGAVEKGDYGSVKQALEEAEIYFRININCIDSLGRTALLIAIENENLEIIELLLSYNVH--VGDALLHAIRKEVVGAVELLLNHKK-PRGEKQVPGILLDKQ------FSDFTPDITPIILAAHTNNYEVIKLLLQRGVSIPQPHAVRCSCVECMSSTDVDCLRYSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELKELSRVENEFKSEYEELSHTCKQFAKDLLDQTRSSKELEIILNYRDDINPILDESTNDLARLKLAIKYCQKEFVAQPNCQQLLASRWYDKFPGWRRRHWAGKLITCFFIGLLFPLLSIFYLI---FPKSR--------------------YGLLIRKPFVKFICHTASYLTFLLLLFLASQHID-----------STGPNSL-SHDVQGPPP--TTVEWMILPWIIGFIWTEIKQMWDNGLEDYADDWWNIMDFIMNSLYLATIALKIVA----------------------------------YVKMKNHCMDD------------WEVWHPTLLAESLFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYAT--------EEKSCYGIRCLQQNNAFSTLFETVQSLFWSVFGLVSLYVT----------------NVKPPHEFTEFVGTTMFGTYNIISLVVLLNMLIAMMNNSYQHIADHADMEWKFARTKLWMSYFEEGGTLPPPFNIIPSPKSVCYLFGWIRKRF 680          
BLAST of Short transient receptor potential channel vs. Planmine SMEST
Match: SMESG000051161.1 (SMESG000051161.1)

HSP 1 Score: 1878.22 bits (4864), Expect = 0.000e+0
Identity = 984/984 (100.00%), Postives = 984/984 (100.00%), Query Frame = 3
Query:   90 MWEIELVSKQLDSLRSLIAGKNKKCTIVGQKLQSESGLVFSTHLKDKEYIYLNAVEFGEYEMVQKMVEDPEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEKSHQRQRLRMQNAKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLFGFEGLKVQEVNGYEEYIEANEQKKDLNKMKANMIRRYLFQLQRMKEQENKSGDLAXXXXXXXXXXXXXXXXXNAPTDXXXXXXXXXXXXXXXXXXXXXARKQIIKDATNEEKIKNKPVLKRIVXXXXXXXXXXXXXXXRDIKDLHLRELYKVDEELDDFSINISSGRSSFRSTEYEELDRTL 3041
            MWEIELVSKQLDSLRSLIAGKNKKCTIVGQKLQSESGLVFSTHLKDKEYIYLNAVEFGEYEMVQKMVEDPEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEKSHQRQRLRMQNAKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAMVIIILLNMLIAMMSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLFGFEGLKVQEVNGYEEYIEANEQKKDLNKMKANMIRRYLFQLQRMKEQENKSGDLASIQFQRQQQLIQQLTSQNAPTDSLEPKSPPKKKGLSSLLLPPSARKQIIKDATNEEKIKNKPVLKRIVEIEENKEEEFTDKTERDIKDLHLRELYKVDEELDDFSINISSGRSSFRSTEYEELDRTL
Sbjct:    1 MWEIELVSKQLDSLRSLIAGKNKKCTIVGQKLQSESGLVFSTHLKDKEYIYLNAVEFGEYEMVQKMVEDPEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEKSHQRQRLRMQNAKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDVEFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVSDSSFLISAVGSFLYGTYCAMVIIILLNMLIAMMSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLFGFEGLKVQEVNGYEEYIEANEQKKDLNKMKANMIRRYLFQLQRMKEQENKSGDLASIQFQRQQQLIQQLTSQNAPTDSLEPKSPPKKKGLSSLLLPPSARKQIIKDATNEEKIKNKPVLKRIVEIEENKEEEFTDKTERDIKDLHLRELYKVDEELDDFSINISSGRSSFRSTEYEELDRTL 984          
BLAST of Short transient receptor potential channel vs. Planmine SMEST
Match: SMESG000018612.1 (SMESG000018612.1)

HSP 1 Score: 532.332 bits (1370), Expect = 2.261e-171
Identity = 327/855 (38.25%), Postives = 496/855 (58.01%), Query Frame = 3
Query:  195 SGLVFST----HLKDKEYIYLNAVEFGEYEMVQ---KMVEDPEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEKSHQRQRLRMQNAKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYG-KLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDV---------EFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLK-----SENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVS--DSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLFGFEGLKVQEVNGYEEYI---------EANEQKKDL--NKMKANMIRRYLFQLQRMKEQENKSGD 2654
            +G +FS      L D+E +YLNA   G+  +++   +  E+ ++NVNCVDYMGR+A+ LA+ S+NM+ IE+LLDK+ +  IE+ALL+AIS     LV+LII+H  ++  E   +R        + + +SQFS DITP++L+AH NNHE+IQ+ + R H+++ PH I C C  C+  ++ DSL     RL+ Y AL+SPAY+AL++ D + + F LR E+ +LA+ EK+FK EY  L  QCM+FA   +DLCR + EV++++S  + +N+  +R PL  ++ A+   EKKFVAH NCQ  + + +YG +  F++ ++L++KI    L +P +PIL M YI  P + +      AM                +CP IKF   + S+  FL L++ ATFR++V         EF+     T  +K+ ++ K   R  + II+PIQ++++ W+ G +VME  QV+  G+  Y    YNI++   L LY ASY LR IVD  ++ AD L++   ++A+  + N         ++  F N+L        E  Y++   R  W+  DPE VSD LFAVAN++SF R   LMPA+E+LGPLQIS  RMI DI RFM LF L++ AF+VG+ NLYWY+   ++      N  +       A   F+    T +TL+W +FGQ+S +S  +    G   P  S   +S   S+ ++  VG FL   Y  ++II+L+NMLIAMMS SF++IQ D   EWKFAR  LWL ++++   LPVPFNLI +    + +    +  F  +   V       ++I         E N +  +L  N +   ++RRYLF+L+R K+ E+K+ D
Sbjct:   43 TGGLFSNFEDVQLSDEERVYLNAAALGDIGVIRMSLEAAEEDKMNVNCVDYMGRNALHLAVDSENMDAIEMLLDKVAFECIEEALLHAISKGSTKLVRLIIEHPNYMAGEDKIKRMDYNNAFFRTTEKSQFSPDITPLILSAHYNNHEMIQMFISRSHSIEKPHSISCHCTDCQIKQDYDSLKRSRSRLNAYRALASPAYMALSSQDPIMTTFELRQEMMKLAEVEKEFKREYLELVEQCMEFACEMMDLCRGTQEVEAVISDNL-ENDPDVRDPLGRLRTAIHYEEKKFVAHPNCQQYLTSLWYGAETGFLQSWSLLKKISLSILSLPLMPILCMAYILVPTSYL----ARAM----------------RCPSIKFATHLLSHVCFLILLSAATFRVEVDYHPIRSTEEFINDQRLTHQQKSLSLLKEKLRPASIIITPIQISIVLWVLGLLVMEIKQVYFTGMLTYLHDGYNILNFCVLKLYTASYTLRIIVDQWVSEADKLFNGT-QVAREALKN--------SDFVTFNNHLANIGSSLDEKKYFMEASRFNWTADDPEIVSDVLFAVANLISFGRTICLMPAFEMLGPLQISFNRMIQDITRFMVLFVLVLFAFMVGLHNLYWYYGSQMIRITTAGNETKNV----RATEVFEGLTHTLYTLFWAMFGQTSLSSIPLKHPDGKD-PAYSDGMISSTSSTAIVEGVGMFLMAIYHVIIIIVLVNMLIAMMSHSFEDIQVDCDVEWKFARTKLWLNFVDNGSTLPVPFNLIPTPHSFMNMIKFSKGFFSGDPFLVGGGTRSTDFIRIRRERVCEENNFETNELGYNNIMQRLVRRYLFKLERQKDFEDKAKD 862          
BLAST of Short transient receptor potential channel vs. Planmine SMEST
Match: SMESG000018612.1 (SMESG000018612.1)

HSP 1 Score: 531.946 bits (1369), Expect = 2.759e-171
Identity = 327/855 (38.25%), Postives = 496/855 (58.01%), Query Frame = 3
Query:  195 SGLVFST----HLKDKEYIYLNAVEFGEYEMVQ---KMVEDPEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEKSHQRQRLRMQNAKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYG-KLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDV---------EFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLK-----SENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVS--DSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLFGFEGLKVQEVNGYEEYI---------EANEQKKDL--NKMKANMIRRYLFQLQRMKEQENKSGD 2654
            +G +FS      L D+E +YLNA   G+  +++   +  E+ ++NVNCVDYMGR+A+ LA+ S+NM+ IE+LLDK+ +  IE+ALL+AIS     LV+LII+H  ++  E   +R        + + +SQFS DITP++L+AH NNHE+IQ+ + R H+++ PH I C C  C+  ++ DSL     RL+ Y AL+SPAY+AL++ D + + F LR E+ +LA+ EK+FK EY  L  QCM+FA   +DLCR + EV++++S  + +N+  +R PL  ++ A+   EKKFVAH NCQ  + + +YG +  F++ ++L++KI    L +P +PIL M YI  P + +      AM                +CP IKF   + S+  FL L++ ATFR++V         EF+     T  +K+ ++ K   R  + II+PIQ++++ W+ G +VME  QV+  G+  Y    YNI++   L LY ASY LR IVD  ++ AD L++   ++A+  + N         ++  F N+L        E  Y++   R  W+  DPE VSD LFAVAN++SF R   LMPA+E+LGPLQIS  RMI DI RFM LF L++ AF+VG+ NLYWY+   ++      N  +       A   F+    T +TL+W +FGQ+S +S  +    G   P  S   +S   S+ ++  VG FL   Y  ++II+L+NMLIAMMS SF++IQ D   EWKFAR  LWL ++++   LPVPFNLI +    + +    +  F  +   V       ++I         E N +  +L  N +   ++RRYLF+L+R K+ E+K+ D
Sbjct:   45 TGGLFSNFEDVQLSDEERVYLNAAALGDIGVIRMSLEAAEEDKMNVNCVDYMGRNALHLAVDSENMDAIEMLLDKVAFECIEEALLHAISKGSTKLVRLIIEHPNYMAGEDKIKRMDYNNAFFRTTEKSQFSPDITPLILSAHYNNHEMIQMFISRSHSIEKPHSISCHCTDCQIKQDYDSLKRSRSRLNAYRALASPAYMALSSQDPIMTTFELRQEMMKLAEVEKEFKREYLELVEQCMEFACEMMDLCRGTQEVEAVISDNL-ENDPDVRDPLGRLRTAIHYEEKKFVAHPNCQQYLTSLWYGAETGFLQSWSLLKKISLSILSLPLMPILCMAYILVPTSYL----ARAM----------------RCPSIKFATHLLSHVCFLILLSAATFRVEVDYHPIRSTEEFINDQRLTHQQKSLSLLKEKLRPASIIITPIQISIVLWVLGLLVMEIKQVYFTGMLTYLHDGYNILNFCVLKLYTASYTLRIIVDQWVSEADKLFNGT-QVAREALKN--------SDFVTFNNHLANIGSSLDEKKYFMEASRFNWTADDPEIVSDVLFAVANLISFGRTICLMPAFEMLGPLQISFNRMIQDITRFMVLFVLVLFAFMVGLHNLYWYYGSQMIRITTAGNETKNV----RATEVFEGLTHTLYTLFWAMFGQTSLSSIPLKHPDGKD-PAYSDGMISSTSSTAIVEGVGMFLMAIYHVIIIIVLVNMLIAMMSHSFEDIQVDCDVEWKFARTKLWLNFVDNGSTLPVPFNLIPTPHSFMNMIKFSKGFFSGDPFLVGGGTRSTDFIRIRRERVCEENNFETNELGYNNIMQRLVRRYLFKLERQKDFEDKAKD 864          
BLAST of Short transient receptor potential channel vs. Planmine SMEST
Match: SMESG000018612.1 (SMESG000018612.1)

HSP 1 Score: 532.332 bits (1370), Expect = 3.560e-171
Identity = 327/855 (38.25%), Postives = 496/855 (58.01%), Query Frame = 3
Query:  195 SGLVFST----HLKDKEYIYLNAVEFGEYEMVQ---KMVEDPEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEKSHQRQRLRMQNAKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYG-KLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDV---------EFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLK-----SENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVS--DSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLFGFEGLKVQEVNGYEEYI---------EANEQKKDL--NKMKANMIRRYLFQLQRMKEQENKSGD 2654
            +G +FS      L D+E +YLNA   G+  +++   +  E+ ++NVNCVDYMGR+A+ LA+ S+NM+ IE+LLDK+ +  IE+ALL+AIS     LV+LII+H  ++  E   +R        + + +SQFS DITP++L+AH NNHE+IQ+ + R H+++ PH I C C  C+  ++ DSL     RL+ Y AL+SPAY+AL++ D + + F LR E+ +LA+ EK+FK EY  L  QCM+FA   +DLCR + EV++++S  + +N+  +R PL  ++ A+   EKKFVAH NCQ  + + +YG +  F++ ++L++KI    L +P +PIL M YI  P + +      AM                +CP IKF   + S+  FL L++ ATFR++V         EF+     T  +K+ ++ K   R  + II+PIQ++++ W+ G +VME  QV+  G+  Y    YNI++   L LY ASY LR IVD  ++ AD L++   ++A+  + N         ++  F N+L        E  Y++   R  W+  DPE VSD LFAVAN++SF R   LMPA+E+LGPLQIS  RMI DI RFM LF L++ AF+VG+ NLYWY+   ++      N  +       A   F+    T +TL+W +FGQ+S +S  +    G   P  S   +S   S+ ++  VG FL   Y  ++II+L+NMLIAMMS SF++IQ D   EWKFAR  LWL ++++   LPVPFNLI +    + +    +  F  +   V       ++I         E N +  +L  N +   ++RRYLF+L+R K+ E+K+ D
Sbjct:   60 TGGLFSNFEDVQLSDEERVYLNAAALGDIGVIRMSLEAAEEDKMNVNCVDYMGRNALHLAVDSENMDAIEMLLDKVAFECIEEALLHAISKGSTKLVRLIIEHPNYMAGEDKIKRMDYNNAFFRTTEKSQFSPDITPLILSAHYNNHEMIQMFISRSHSIEKPHSISCHCTDCQIKQDYDSLKRSRSRLNAYRALASPAYMALSSQDPIMTTFELRQEMMKLAEVEKEFKREYLELVEQCMEFACEMMDLCRGTQEVEAVISDNL-ENDPDVRDPLGRLRTAIHYEEKKFVAHPNCQQYLTSLWYGAETGFLQSWSLLKKISLSILSLPLMPILCMAYILVPTSYL----ARAM----------------RCPSIKFATHLLSHVCFLILLSAATFRVEVDYHPIRSTEEFINDQRLTHQQKSLSLLKEKLRPASIIITPIQISIVLWVLGLLVMEIKQVYFTGMLTYLHDGYNILNFCVLKLYTASYTLRIIVDQWVSEADKLFNGT-QVAREALKN--------SDFVTFNNHLANIGSSLDEKKYFMEASRFNWTADDPEIVSDVLFAVANLISFGRTICLMPAFEMLGPLQISFNRMIQDITRFMVLFVLVLFAFMVGLHNLYWYYGSQMIRITTAGNETKNV----RATEVFEGLTHTLYTLFWAMFGQTSLSSIPLKHPDGKD-PAYSDGMISSTSSTAIVEGVGMFLMAIYHVIIIIVLVNMLIAMMSHSFEDIQVDCDVEWKFARTKLWLNFVDNGSTLPVPFNLIPTPHSFMNMIKFSKGFFSGDPFLVGGGTRSTDFIRIRRERVCEENNFETNELGYNNIMQRLVRRYLFKLERQKDFEDKAKD 879          
BLAST of Short transient receptor potential channel vs. Planmine SMEST
Match: SMESG000018612.1 (SMESG000018612.1)

HSP 1 Score: 531.946 bits (1369), Expect = 3.931e-171
Identity = 327/855 (38.25%), Postives = 496/855 (58.01%), Query Frame = 3
Query:  195 SGLVFST----HLKDKEYIYLNAVEFGEYEMVQ---KMVEDPEINVNCVDYMGRSAILLAMKSDNMEMIELLLDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEKSHQRQRLRMQNAKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPHCEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQLAQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVIRYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYG-KLLFIRDFNLIEKIKFFSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCPVIKFIGQMYSYFMFLFLITVATFRLDV---------EFLTADTDTWTEKANTIFKYDFRTNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLGLYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEFRNNLLK-----SENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPAWEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTANPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMGLSYPGQSTLHVS--DSSFLISAVGSFLYGTYCAXXXXXXXXXXXXXXSKSFDEIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRKLFGFEGLKVQEVNGYEEYI---------EANEQKKDL--NKMKANMIRRYLFQLQRMKEQENKSGD 2654
            +G +FS      L D+E +YLNA   G+  +++   +  E+ ++NVNCVDYMGR+A+ LA+ S+NM+ IE+LLDK+ +  IE+ALL+AIS     LV+LII+H  ++  E   +R        + + +SQFS DITP++L+AH NNHE+IQ+ + R H+++ PH I C C  C+  ++ DSL     RL+ Y AL+SPAY+AL++ D + + F LR E+ +LA+ EK+FK EY  L  QCM+FA   +DLCR + EV++++S  + +N+  +R PL  ++ A+   EKKFVAH NCQ  + + +YG +  F++ ++L++KI    L +P +PIL M YI  P + +      AM                +CP IKF   + S+  FL L++ ATFR++V         EF+     T  +K+ ++ K   R  + II+PIQ++++ W+ G +VME  QV+  G+  Y    YNI++   L LY ASY LR IVD  ++ AD L++   ++A+  + N         ++  F N+L        E  Y++   R  W+  DPE VSD LFAVAN++SF R   LMPA+E+LGPLQIS  RMI DI RFM LF L++ AF+VG+ NLYWY+   ++      N  +       A   F+    T +TL+W +FGQ+S +S  +    G   P  S   +S   S+ ++  VG FL   Y  ++II+L+NMLIAMMS SF++IQ D   EWKFAR  LWL ++++   LPVPFNLI +    + +    +  F  +   V       ++I         E N +  +L  N +   ++RRYLF+L+R K+ E+K+ D
Sbjct:   45 TGGLFSNFEDVQLSDEERVYLNAAALGDIGVIRMSLEAAEEDKMNVNCVDYMGRNALHLAVDSENMDAIEMLLDKVAFECIEEALLHAISKGSTKLVRLIIEHPNYMAGEDKIKRMDYNNAFFRTTEKSQFSPDITPLILSAHYNNHEMIQMFISRSHSIEKPHSISCHCTDCQIKQDYDSLKRSRSRLNAYRALASPAYMALSSQDPIMTTFELRQEMMKLAEVEKEFKREYLELVEQCMEFACEMMDLCRGTQEVEAVISDNL-ENDPDVRDPLGRLRTAIHYEEKKFVAHPNCQQYLTSLWYGAETGFLQSWSLLKKISLSILSLPLMPILCMAYILVPTSYL----ARAM----------------RCPSIKFATHLLSHVCFLILLSAATFRVEVDYHPIRSTEEFINDQRLTHQQKSLSLLKEKLRPASIIITPIQISIVLWVLGLLVMEIKQVYFTGMLTYLHDGYNILNFCVLKLYTASYTLRIIVDQWVSEADKLFNGT-QVAREALKN--------SDFVTFNNHLANIGSSLDEKKYFMEASRFNWTADDPEIVSDVLFAVANLISFGRTICLMPAFEMLGPLQISFNRMIQDITRFMVLFVLVLFAFMVGLHNLYWYYGSQMIRITTAGNETKNV----RATEVFEGLTHTLYTLFWAMFGQTSLSSIPLKHPDGKD-PAYSDGMISSTSSTAIVEGVGMFLMAIYHVIIIIVLVNMLIAMMSHSFEDIQVDCDVEWKFARTKLWLNFVDNGSTLPVPFNLIPTPHSFMNMIKFSKGFFSGDPFLVGGGTRSTDFIRIRRERVCEENNFETNELGYNNIMQRLVRRYLFKLERQKDFEDKAKD 864          
The following BLAST results are available for this feature:
BLAST of Short transient receptor potential channel vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPC63.259e-12334.65transient receptor potential cation channel subfam... [more]
TRPC74.457e-11834.61transient receptor potential cation channel subfam... [more]
TRPC32.866e-11133.25transient receptor potential cation channel subfam... [more]
TRPC31.033e-11033.25transient receptor potential cation channel subfam... [more]
TRPC51.385e-8930.13transient receptor potential cation channel subfam... [more]
back to top
BLAST of Short transient receptor potential channel vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trp-21.303e-10231.79TRP (Transient receptor potential) channel family;... [more]
trp-22.164e-10231.40TRP (Transient receptor potential) channel family;... [more]
trp-15.064e-8629.29Transient-receptor-potential-like protein [Source... [more]
trp-16.331e-8629.29Transient-receptor-potential-like protein [Source... [more]
spe-418.579e-1723.87TRP homologous cation channel protein; TRP-3 chann... [more]
back to top
BLAST of Short transient receptor potential channel vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpgamma4.458e-10131.29gene:FBgn0032593 transcript:FBtr0080945[more]
Trpgamma4.458e-10131.29gene:FBgn0032593 transcript:FBtr0080946[more]
Trpgamma9.923e-10131.29gene:FBgn0032593 transcript:FBtr0335144[more]
trpl2.179e-8829.36gene:FBgn0005614 transcript:FBtr0088471[more]
trpl2.179e-8829.36gene:FBgn0005614 transcript:FBtr0301662[more]
back to top
BLAST of Short transient receptor potential channel vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpc6b4.508e-12432.89transient receptor potential cation channel, subfa... [more]
trpc6a2.312e-12133.21transient receptor potential cation channel, subfa... [more]
trpc6a2.945e-12133.06transient receptor potential cation channel, subfa... [more]
trpc6a5.263e-12133.06transient receptor potential cation channel, subfa... [more]
trpc7a2.948e-11933.99transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Short transient receptor potential channel vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nup1887.438e-12233.21nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-593... [more]
nup1881.207e-12133.06nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-593... [more]
nup1888.205e-12032.69nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-593... [more]
nup1889.593e-12033.68nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-593... [more]
nup1881.309e-11932.69nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-593... [more]
back to top
BLAST of Short transient receptor potential channel vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpc65.999e-12234.65transient receptor potential cation channel, subfa... [more]
Trpc74.774e-11834.21transient receptor potential cation channel, subfa... [more]
Trpc76.293e-11834.21transient receptor potential cation channel, subfa... [more]
Trpc39.983e-11233.25transient receptor potential cation channel, subfa... [more]
Trpc52.084e-8930.13transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Short transient receptor potential channel vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9MYW0|TRPC6_BOVIN1.400e-12333.58Short transient receptor potential channel 6 OS=Bo... [more]
sp|Q9Y210|TRPC6_HUMAN1.565e-12234.65Short transient receptor potential channel 6 OS=Ho... [more]
sp|Q61143|TRPC6_MOUSE4.196e-12134.65Short transient receptor potential channel 6 OS=Mu... [more]
sp|Q9HCX4|TRPC7_HUMAN2.140e-11734.61Short transient receptor potential channel 7 OS=Ho... [more]
sp|Q9WVC5|TRPC7_MOUSE3.340e-11734.21Short transient receptor potential channel 7 OS=Mu... [more]
back to top
BLAST of Short transient receptor potential channel vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A158QUN60.000e+055.17Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0X3PKC20.000e+054.64Short transient receptor potential channel 7 OS=Sc... [more]
G4VSU80.000e+053.81Putative transient receptor potential channel OS=S... [more]
A0A3Q0KRX80.000e+057.72Putative transient receptor potential channel OS=S... [more]
A0A068XXQ60.000e+051.74Short transient receptor potential channel 6 OS=Ec... [more]
back to top
BLAST of Short transient receptor potential channel vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpc6b4.002e-12333.01transient receptor potential cation channel, subfa... [more]
trpc6a1.437e-11732.48short transient receptor potential channel 6-like ... [more]
trpc6a8.323e-11733.59short transient receptor potential channel 6-like ... [more]
trpc7a1.206e-11634.17short transient receptor potential channel 7-like ... [more]
trpc7a2.211e-11633.59short transient receptor potential channel 7-like ... [more]
back to top
BLAST of Short transient receptor potential channel vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
trpc4b4.203e-5927.41transient receptor potential cation channel, subfa... [more]
trpc4b3.822e-5727.40transient receptor potential cation channel, subfa... [more]
trpc31.405e-5134.75transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Short transient receptor potential channel vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Short transient receptor potential channel vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO483461.568e-5026.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453112.231e-4626.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493025.673e-1921.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Short transient receptor potential channel vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPC62.711e-12033.17short transient receptor potential channel 6 [Sour... [more]
trpc7b9.648e-11633.68short transient receptor potential channel 7-like ... [more]
trpc7b1.286e-11533.29short transient receptor potential channel 7-like ... [more]
trpc4b6.555e-9631.52short transient receptor potential channel 4 [Sour... [more]
trpc4b9.533e-9531.90short transient receptor potential channel 4 [Sour... [more]
back to top
BLAST of Short transient receptor potential channel vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051161.10.000e+0100.00SMESG000051161.1[more]
SMESG000018612.12.261e-17138.25SMESG000018612.1[more]
SMESG000018612.12.759e-17138.25SMESG000018612.1[more]
SMESG000018612.13.560e-17138.25SMESG000018612.1[more]
SMESG000018612.13.931e-17138.25SMESG000018612.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020631 ID=SMED30020631|Name=Short transient receptor potential channel|organism=Schmidtea mediterranea sexual|type=transcript|length=3179bp
GAAAAATTTTATGTACCAATCGGTTTTATTTTTAGTTTAATTGTTTAATT
GCTAAATAAATGGTTTCATAAACGCGTATTTCTTCAAAGATGTGGGAAAT
AGAATTAGTATCTAAACAATTGGATAGTTTACGATCTTTGATCGCCGGTA
AAAATAAAAAATGCACAATAGTCGGTCAAAAACTTCAATCAGAAAGTGGA
TTAGTGTTTTCAACACATTTAAAAGACAAGGAGTATATTTACTTAAATGC
TGTTGAATTTGGCGAATATGAAATGGTTCAAAAGATGGTTGAAGATCCTG
AAATCAATGTCAACTGCGTTGATTATATGGGACGGAGCGCTATATTATTG
GCTATGAAAAGCGATAACATGGAAATGATTGAATTACTTTTAGATAAATT
GGAATATTGCCTTATTGAAGATGCATTATTAAATGCTATAAGTAACGAGA
AAATCAACTTAGTAAAATTGATAATTGATCACCAAACATTCATCAAAGCA
GAAAAGTCACATCAAAGGCAACGTTTAAGAATGCAAAATGCAAAAAAGTC
TTATCGAAGTCAATTTTCATCTGACATAACGCCTGTAATGTTAGCTGCTC
ATACGAATAATCACGAAATAATTCAATTGCTATTGGATAGAGGTCATGCG
CTCGACATGCCGCATGATATTGGGTGCATGTGTCCACACTGTGAGAAATT
AAAAAATGAGGACTCACTAATTTTGGAGTTACAAAGATTGCACACCTATG
AAGCTCTTTCGAGCCCAGCTTATCTCGCACTCACAACATCAGATTCAGTA
TCCTCAGCTTTTCTTCTTAGAAATGAGTTATACCAATTAGCTCAACAAGA
AAAGCAATTCAAAGAAGAATATACGACTCTTGCTATACAGTGTATGCAAT
TTGCAAAAGCTTGCGTTGACCTCTGCCGTACGAGTGATGAGGTTGATTCA
CTCTTGAGTGGAACTATCGTAAAAAACAATAAAGTCATTCGCTATCCTTT
AGCAACAGTAAAATTAGCAATGCAATGTTCAGAAAAAAAGTTTGTTGCTC
ATTCGAATTGTCAACACCAAGTTGAGAATAAATTCTACGGGAAATTACTT
TTCATACGAGATTTCAATTTAATAGAAAAAATCAAATTTTTCAGTTTATT
AATACCAAGTTTGCCTATCTTGTACATGATTTATATTTTCTTTCCAAATA
CAAAGATTCCCGTTCCAAAAGGTCACGCTATGAGTTTCTCAGAAATGATT
TCCAATAAAATGCCGATCGGATTATTTTTACAATGTCCAGTCATCAAGTT
CATTGGACAAATGTATTCTTATTTTATGTTTTTATTCTTGATCACAGTGG
CAACCTTTCGCCTCGATGTCGAATTCCTGACCGCAGACACGGACACATGG
ACTGAAAAAGCAAATACAATTTTTAAATATGATTTCCGTACAAATACACG
AATTATTTCACCAATTCAAGTTGCTCTTATCTTTTGGATATTTGGTCAAA
TAGTTATGGAATGTTGGCAGGTATTTACGCATGGGCTCAAAAGATACTCT
CAGAGTTTTTATAATATTATGGATACTTTCTCATTGGGACTTTATTTAGC
TTCGTATGCTTTACGTTGTATAGTCGATTATAAAATCAACGGAGCCGACG
CGCTTTATTCAGCAGAACTGAAAATTGCAAAATCTATGATTTTTAATGAA
ACATTATTTTCTGCTGGTTCTAAAGAATATTTTGAATTTAGAAATAATCT
TCTCAAGTCGGAAAATACTTATTGGCTAAGAGGATGTCGGCTATGGTGGT
CACCTTACGATCCAGAATTCGTGTCAGACTGCTTATTTGCTGTTGCAAAT
GTTATGTCATTCTCTCGAGTTACATATCTTATGCCAGCATGGGAAGTTTT
GGGTCCACTTCAAATTTCATTAGCTCGTATGATTTCTGACATTATTAGAT
TCATGGCTCTTTTTAGTTTGATTGTTGTTGCTTTTGTTGTCGGAATGACA
AATTTATATTGGTATTTTGCAAAGATTATCGTAACTGCAAATCCTTTGTC
AAATTCTGCAGAATTTTCGTTGACATTAGACAGTGCCATTCCAGCTTTCC
AAAGTACCGGAAGTACATTTCACACTCTATATTGGACTCTTTTCGGTCAA
TCATCTAACAATTCCACAATGATAGACGGAAATATGGGACTAAGCTATCC
TGGACAATCAACTCTTCATGTTTCAGATAGTTCATTTTTAATTAGTGCGG
TGGGGAGCTTTCTGTATGGAACGTATTGCGCAATGGTTATTATCATTCTA
CTTAATATGTTAATTGCTATGATGAGCAAATCGTTCGATGAAATTCAAGG
TGATCGTCTTGAAGAATGGAAATTCGCTCGAGCCGTTTTGTGGTTAGTTT
ATATAGAACACGAAGGAGTGCTTCCAGTTCCATTCAATCTCATTCTGTCA
AGAGATCAAATATTAATAATATTTTCAGAAGTTCGAAAGTTATTTGGTTT
TGAAGGACTGAAAGTGCAAGAAGTCAATGGCTATGAAGAATATATTGAAG
CTAATGAACAGAAAAAGGATTTAAACAAAATGAAAGCAAATATGATAAGA
CGATACTTATTCCAATTACAAAGAATGAAAGAACAAGAAAATAAAAGTGG
AGATCTTGCAAGCATTCAATTCCAGAGACAACAGCAACTCATTCAACAAT
TAACTAGTCAAAATGCACCAACAGATTCATTAGAGCCTAAATCTCCACCG
AAAAAGAAAGGTTTGAGCAGTTTATTATTGCCTCCAAGTGCCAGAAAACA
AATAATAAAAGATGCAACTAATGAAGAGAAAATAAAAAATAAACCAGTTT
TGAAAAGAATCGTAGAAATTGAAGAAAATAAGGAAGAAGAATTTACCGAT
AAAACGGAAAGAGACATAAAAGATCTTCATCTCAGAGAACTCTACAAAGT
CGATGAAGAATTAGATGATTTTTCAATCAATATTTCATCCGGTAGAAGCT
CATTCCGAAGTACTGAATATGAGGAGTTGGATAGAACTTTGTAAAATCCA
TCAGAATTTTTTATATCCAACTGAAATAGAAATTATGCCTCTATTAACTT
TTCTATATTAAAACTTAAATTAATATTGTTTTATTTTAAGAAATTTTATC
TACAATCTTTCTTTATGCTTCGATCTTAA
back to top

protein sequence of SMED30020631-orf-1

>SMED30020631-orf-1 ID=SMED30020631-orf-1|Name=SMED30020631-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=985bp
MWEIELVSKQLDSLRSLIAGKNKKCTIVGQKLQSESGLVFSTHLKDKEYI
YLNAVEFGEYEMVQKMVEDPEINVNCVDYMGRSAILLAMKSDNMEMIELL
LDKLEYCLIEDALLNAISNEKINLVKLIIDHQTFIKAEKSHQRQRLRMQN
AKKSYRSQFSSDITPVMLAAHTNNHEIIQLLLDRGHALDMPHDIGCMCPH
CEKLKNEDSLILELQRLHTYEALSSPAYLALTTSDSVSSAFLLRNELYQL
AQQEKQFKEEYTTLAIQCMQFAKACVDLCRTSDEVDSLLSGTIVKNNKVI
RYPLATVKLAMQCSEKKFVAHSNCQHQVENKFYGKLLFIRDFNLIEKIKF
FSLLIPSLPILYMIYIFFPNTKIPVPKGHAMSFSEMISNKMPIGLFLQCP
VIKFIGQMYSYFMFLFLITVATFRLDVEFLTADTDTWTEKANTIFKYDFR
TNTRIISPIQVALIFWIFGQIVMECWQVFTHGLKRYSQSFYNIMDTFSLG
LYLASYALRCIVDYKINGADALYSAELKIAKSMIFNETLFSAGSKEYFEF
RNNLLKSENTYWLRGCRLWWSPYDPEFVSDCLFAVANVMSFSRVTYLMPA
WEVLGPLQISLARMISDIIRFMALFSLIVVAFVVGMTNLYWYFAKIIVTA
NPLSNSAEFSLTLDSAIPAFQSTGSTFHTLYWTLFGQSSNNSTMIDGNMG
LSYPGQSTLHVSDSSFLISAVGSFLYGTYCAMVIIILLNMLIAMMSKSFD
EIQGDRLEEWKFARAVLWLVYIEHEGVLPVPFNLILSRDQILIIFSEVRK
LFGFEGLKVQEVNGYEEYIEANEQKKDLNKMKANMIRRYLFQLQRMKEQE
NKSGDLASIQFQRQQQLIQQLTSQNAPTDSLEPKSPPKKKGLSSLLLPPS
ARKQIIKDATNEEKIKNKPVLKRIVEIEENKEEEFTDKTERDIKDLHLRE
LYKVDEELDDFSINISSGRSSFRSTEYEELDRTL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR003133T_Ag_DNA-bd
IPR002153TRPC_channel
IPR002110Ankyrin_rpt
IPR013555TRP_dom
IPR005821Ion_trans_dom
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0070588calcium ion transmembrane transport
GO:0055085transmembrane transport
GO:0006811ion transport
Vocabulary: molecular function
TermDefinition
GO:0003688DNA replication origin binding
GO:0005262calcium channel activity
GO:0005515protein binding
GO:0005216ion channel activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 818..838
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 872..894
NoneNo IPR availableTMHMMTMhelixcoord: 350..369
NoneNo IPR availableTMHMMTMhelixcoord: 621..643
NoneNo IPR availableTMHMMTMhelixcoord: 716..738
NoneNo IPR availableTMHMMTMhelixcoord: 404..423
NoneNo IPR availableTMHMMTMhelixcoord: 490..512
NoneNo IPR availableTMHMMTMhelixcoord: 458..480
IPR002153Transient receptor potential channel, canonicalPRINTSPR01097TRNSRECEPTRPcoord: 727..748
score: 57.75
coord: 749..762
score: 41.18
coord: 777..790
score: 46.64
IPR002153Transient receptor potential channel, canonicalPANTHERPTHR10117TRANSIENT RECEPTOR POTENTIAL CHANNELcoord: 43..860
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 161..190
e-value: 0.04
score: 23.0
coord: 80..109
e-value: 21.0
score: 14.0
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 161..193
score: 9.564
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 51..257
e-value: 5.6E-19
score: 70.4
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 45..195
IPR013555Transient receptor ion channel domainPFAMPF08344TRP_2coord: 196..258
e-value: 9.3E-20
score: 70.6
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 412..754
e-value: 1.8E-16
score: 60.1
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 161..193
score: 9.543
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 54..103
score: 8.561