Echinoderm microtubule associated protein like 1

Overview
NameEchinoderm microtubule associated protein like 1
Smed IDSMED30020627
Length (bp)3656
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Echinoderm microtubule associated protein like 1 (SMED30020627) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Echinoderm microtubule associated protein like 1 (SMED30020627) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020627

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30020627SMESG000017256.1 SmedASXL_015803SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30020627SMESG000017256.1 SmedASXL_015804SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30020627SMESG000017256.1 dd_Smed_v4_14226_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30020627SMESG000017256.1 dd_Smed_v4_14226_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30020627SMESG000017256.1 dd_Smed_v6_14226_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neuronSMED30020627SMESG000017256.1 dd_Smed_v6_14226_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30020627SMESG000017256.1 dd_Smed_v6_14226_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30020627SMESG000017256.1 Contig5884newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30020627SMESG000017256.1 Contig5884uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Human
Match: EML1 (EMAP like 1 [Source:HGNC Symbol;Acc:HGNC:3330])

HSP 1 Score: 241.506 bits (615), Expect = 4.229e-66
Identity = 195/686 (28.43%), Postives = 304/686 (44.31%), Query Frame = 3
Query: 1434 PVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWT---ARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWD-IKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESY---NEIILSCGVTSIFNF-PDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPI---FGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAW-MTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCH-SNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            P + +F   +  V++ L G P  +  P D  +    L    +LPT +LK++WVYG+RGRD   NL LL  GE  YF   VVVL+   +  QRHY  H+ D++CL VH D I IA+ Q      + K      RIW S +L+TL++            I    S     L  +DDS DH+L++WD  K +KLA    S+ +V +  F   D NI VT G  H+ +W    L G    K    +    K +       + + + ITGDS+G + VW  G N ++  ++ AHE  I ALC+ +            KL  ++ N   L    +P+  G +R      +     +++IGTT N +LQ  L+                 G    I+QGH  ++  ++ +  + + F+T G D    ++DA     V    I+    +         +A+GT+ GR  + D    +LV  +   NE +      S+  + PD   + +G  D C+     ++N        K    S F T +       F+   S D +   WV +             K V ++ T +++ W+   C +   V G W       +  A+C   H+ K++L+ G   GK+ ++ +PC    A  H     S+ VTNV FL    HLIS  G+D+ I QW +I
Sbjct:  163 PKEPVFSAEEGYVKMFLRGRPVTMYMPKD-QVDSYSLEAKVELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGTNLCAVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWT---LEGSSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRKLISWSGNYQKLRKTEIPEQFGPIR----TVAEGKGDVILIGTTRNFVLQGTLS-----------------GDFTPITQGHTDELWGLA-IHASKSQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQL------SVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSA-----------CKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVC-RAHE-KKLLSTGDDFGKVHLFSYPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI 803          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Human
Match: EML1 (EMAP like 1 [Source:HGNC Symbol;Acc:HGNC:3330])

HSP 1 Score: 241.891 bits (616), Expect = 5.584e-66
Identity = 195/686 (28.43%), Postives = 304/686 (44.31%), Query Frame = 3
Query: 1434 PVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWT---ARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWD-IKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESY---NEIILSCGVTSIFNF-PDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPI---FGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAW-MTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCH-SNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            P + +F   +  V++ L G P  +  P D  +    L    +LPT +LK++WVYG+RGRD   NL LL  GE  YF   VVVL+   +  QRHY  H+ D++CL VH D I IA+ Q      + K      RIW S +L+TL++            I    S     L  +DDS DH+L++WD  K +KLA    S+ +V +  F   D NI VT G  H+ +W    L G    K    +    K +       + + + ITGDS+G + VW  G N ++  ++ AHE  I ALC+ +            KL  ++ N   L    +P+  G +R      +     +++IGTT N +LQ  L+                 G    I+QGH  ++  ++ +  + + F+T G D    ++DA     V    I+    +         +A+GT+ GR  + D    +LV  +   NE +      S+  + PD   + +G  D C+     ++N        K    S F T +       F+   S D +   WV +             K V ++ T +++ W+   C +   V G W       +  A+C   H+ K++L+ G   GK+ ++ +PC    A  H     S+ VTNV FL    HLIS  G+D+ I QW +I
Sbjct:  200 PKEPVFSAEEGYVKMFLRGRPVTMYMPKD-QVDSYSLEAKVELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGTNLCAVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWT---LEGSSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRKLISWSGNYQKLRKTEIPEQFGPIR----TVAEGKGDVILIGTTRNFVLQGTLS-----------------GDFTPITQGHTDELWGLA-IHASKSQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQL------SVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSA-----------CKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVC-RAHE-KKLLSTGDDFGKVHLFSYPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI 840          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Human
Match: EML1 (EMAP like 1 [Source:HGNC Symbol;Acc:HGNC:3330])

HSP 1 Score: 241.506 bits (615), Expect = 5.969e-66
Identity = 195/686 (28.43%), Postives = 304/686 (44.31%), Query Frame = 3
Query: 1434 PVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWT---ARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWD-IKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESY---NEIILSCGVTSIFNF-PDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPI---FGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAW-MTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCH-SNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            P + +F   +  V++ L G P  +  P D  +    L    +LPT +LK++WVYG+RGRD   NL LL  GE  YF   VVVL+   +  QRHY  H+ D++CL VH D I IA+ Q      + K      RIW S +L+TL++            I    S     L  +DDS DH+L++WD  K +KLA    S+ +V +  F   D NI VT G  H+ +W    L G    K    +    K +       + + + ITGDS+G + VW  G N ++  ++ AHE  I ALC+ +            KL  ++ N   L    +P+  G +R      +     +++IGTT N +LQ  L+                 G    I+QGH  ++  ++ +  + + F+T G D    ++DA     V    I+    +         +A+GT+ GR  + D    +LV  +   NE +      S+  + PD   + +G  D C+     ++N        K    S F T +       F+   S D +   WV +             K V ++ T +++ W+   C +   V G W       +  A+C   H+ K++L+ G   GK+ ++ +PC    A  H     S+ VTNV FL    HLIS  G+D+ I QW +I
Sbjct:  175 PKEPVFSAEEGYVKMFLRGRPVTMYMPKD-QVDSYSLEAKVELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGTNLCAVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWT---LEGSSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRKLISWSGNYQKLRKTEIPEQFGPIR----TVAEGKGDVILIGTTRNFVLQGTLS-----------------GDFTPITQGHTDELWGLA-IHASKSQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQL------SVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSA-----------CKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVC-RAHE-KKLLSTGDDFGKVHLFSYPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI 815          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Human
Match: EML1 (EMAP like 1 [Source:HGNC Symbol;Acc:HGNC:3330])

HSP 1 Score: 241.506 bits (615), Expect = 8.264e-66
Identity = 195/686 (28.43%), Postives = 304/686 (44.31%), Query Frame = 3
Query: 1434 PVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWT---ARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWD-IKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESY---NEIILSCGVTSIFNF-PDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPI---FGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAW-MTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCH-SNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            P + +F   +  V++ L G P  +  P D  +    L    +LPT +LK++WVYG+RGRD   NL LL  GE  YF   VVVL+   +  QRHY  H+ D++CL VH D I IA+ Q      + K      RIW S +L+TL++            I    S     L  +DDS DH+L++WD  K +KLA    S+ +V +  F   D NI VT G  H+ +W    L G    K    +    K +       + + + ITGDS+G + VW  G N ++  ++ AHE  I ALC+ +            KL  ++ N   L    +P+  G +R      +     +++IGTT N +LQ  L+                 G    I+QGH  ++  ++ +  + + F+T G D    ++DA     V    I+    +         +A+GT+ GR  + D    +LV  +   NE +      S+  + PD   + +G  D C+     ++N        K    S F T +       F+   S D +   WV +             K V ++ T +++ W+   C +   V G W       +  A+C   H+ K++L+ G   GK+ ++ +PC    A  H     S+ VTNV FL    HLIS  G+D+ I QW +I
Sbjct:  194 PKEPVFSAEEGYVKMFLRGRPVTMYMPKD-QVDSYSLEAKVELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGTNLCAVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWT---LEGSSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRKLISWSGNYQKLRKTEIPEQFGPIR----TVAEGKGDVILIGTTRNFVLQGTLS-----------------GDFTPITQGHTDELWGLA-IHASKSQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQL------SVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSA-----------CKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVC-RAHE-KKLLSTGDDFGKVHLFSYPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI 834          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Human
Match: EML2 (EMAP like 2 [Source:HGNC Symbol;Acc:HGNC:18035])

HSP 1 Score: 225.328 bits (573), Expect = 1.062e-61
Identity = 180/683 (26.35%), Postives = 301/683 (44.07%), Query Frame = 3
Query: 1431 KPVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWT---ARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWD-IKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESY---NEIILSCGVTSIFNF-PDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCHSNIA-SNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            K  + +F     +V++ L G P  ++ P +L+     L    +LP+ +LK++WVYG+RGRD   NL LL  GE+ YF   V VL++  +  QRHY  H+ DI+CL +H D + IA+ Q        K      RIW S SLSTL++    +       +    S   N L  +D+S DH+L++WD  K  K+     S+ +VL  +F   D  + +T G  HI +W    L G   +K    +    K +           +++TGDS G +YVW  G N +T  +  AH+  +  LC  +            ++ L+  +   L  + +P+D G VR      +  +   L +GTT NSILQ  + TG  +L                  QGH  ++  ++   +    F+T G+D  + ++ +D    +    I+    +         +A+GT+ GR ++LD    +LV  +   NE I      S+ +F PD   + +G  D  +   T ++         K    S F T    +D+ Q    D   ++  S  +   + ++    K + +   ++N+ W+   C +   V G W       +       H  K +LA     GK+ ++ +PC    A  H     S+ VTNV FL      ++  G+D+ + QW ++
Sbjct:    8 KTKEVIFSVEDGSVKMFLRGRPVPMMIPDELA-PTYSLDTRSELPSCRLKLEWVYGYRGRDCRANLYLLPTGEIVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPDMVTIATGQVAGTTKEGKPLPPHVRIWDSVSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDWAKETKVVDVKCSNEAVLVATFHPTDPTVLITCGKSHIYFWT---LEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQAVLGAHDGGVFGLCALRDGTLVSGGGRDRRVVLWGSDYSKLQEVEVPEDFGPVR----TVAEGHGDTLYVGTTRNSILQGSVHTGFSLL-----------------VQGHVEELWGLATHPSRAQ-FVTCGQDKLVHLWSSDSHQPLWSRIIEDPARSAGFHPSGSVLAVGTVTGRWLLLDTETHDLVAIHTDGNEQI------SVVSFSPDGAYLAVGSHDNLVYVYTVDQGGRKVSRLGKCSGHSSFITH---LDWAQ----DSSCFVTNSGDY-EILYWDPATCKQITSADAVRNMEWATATCVLGFGVFGIWSEGADGTDINAVARSHDGK-LLASADDFGKVHLFSYPCCQPRALSHKYGGHSSHVTNVAFLWDDSMALTTGGKDTSVLQWRVV 649          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Celegans
Match: elp-1 (Echinoderm microtubule-associated protein-like elp-1 [Source:UniProtKB/Swiss-Prot;Acc:O45487])

HSP 1 Score: 136.732 bits (343), Expect = 2.659e-32
Identity = 150/622 (24.12%), Postives = 268/622 (43.09%), Query Frame = 3
Query: 1554 KDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFC--QNTQRHYCEHSADIECLTVHTDGIVIASAQ-------------------------KELQVSNYKWTARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKK--NWLLVLDDSKDHILTLWD-IKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSF-LFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVST-NDNWFITAGRDSQICVFD-ADKRLGVQKTQIKGHQFTCVSWLVDDS-IALGTIEGRCIILDQHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFP 3317
            +D PT+K+ +  VY +RG+DV  N+ +L  GEL +F+  +VVL        +QR Y  H+ D++C+T+H + I++AS Q                         ++L++ + +   RIW +  L+TL +    L+        + FS     + L V+DDS  H++++W+  KG++     +S++ V    +     N+ V  G  H  ++ + P  G +  K VA + G  K +   +     +++++TGDSNGT+ +W       T      H   + +L + KS  + +G    M+  W     +     I LP ++G  R +L      N   LIIGT++N++L             F N+E   +  S+       G  GN++ + T + N  IT+ +   + +++  DK++   K  I      CV   V ++ I LG   G  I+++  +   ++   E   +  +T++  F  S   F        +T+ R    D  ++            PI  +DF    S D +Y    S   G  + +  +  +I    S +K+V W   +       IG     +         +V Q ++I A G   G I IY+ P
Sbjct:  273 QDPPTMKVTLKHVYSYRGKDVRSNIEMLPTGELVFFSANLVVLMNITGEDRSQRIYHGHTCDVKCITLHPNKILVASGQSSCHSVEKFQKPEHTSPIDSPEDLVRQLEMEHTEAHVRIWDTIKLTTLMV----LNGFEKGICHVAFSKTDSGSLLAVVDDSLKHLMSVWNWQKGKREGEVKASNDVVFECKWHPTIRNLIVLYGKGHFSFFNYDPATG-VLVKTVATFEGRDKPKTVLSMCFGENDQVVTGDSNGTISIWDPRTCKTTKQAHSVHPGGVYSLTLAKSGKILSGGKDRMVSEWDLQDLVRTRRPIELPDEKGFPRVIL-----QNGSELIIGTSSNTLL-------------FGNIENSTNLTSLI-----EGDPGNLTFLLTCSSNQLITSSQCGTLRIWNHIDKKVEFSKKFID--SVECVDVDVTNTHIILGFAAGLWIVMNITKQQTIQEKKE--GTAPITAV-KFAPSGATFAVATKDPHLTIYR---IDASKNLLVIARIHHIPAPIVALDF----SSDSQYLRGQS--IGAHLLFWTKAGEICDGTS-VKDVKWGSSRVK-----IGFETALVAHSSNGQVTAVAQCEDISACGMENGTIRIYKNP 846          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Celegans
Match: elp-1 (Echinoderm microtubule-associated protein-like elp-1 [Source:UniProtKB/Swiss-Prot;Acc:O45487])

HSP 1 Score: 136.732 bits (343), Expect = 2.659e-32
Identity = 150/622 (24.12%), Postives = 268/622 (43.09%), Query Frame = 3
Query: 1554 KDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFC--QNTQRHYCEHSADIECLTVHTDGIVIASAQ-------------------------KELQVSNYKWTARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKK--NWLLVLDDSKDHILTLWD-IKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSF-LFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVST-NDNWFITAGRDSQICVFD-ADKRLGVQKTQIKGHQFTCVSWLVDDS-IALGTIEGRCIILDQHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFP 3317
            +D PT+K+ +  VY +RG+DV  N+ +L  GEL +F+  +VVL        +QR Y  H+ D++C+T+H + I++AS Q                         ++L++ + +   RIW +  L+TL +    L+        + FS     + L V+DDS  H++++W+  KG++     +S++ V    +     N+ V  G  H  ++ + P  G +  K VA + G  K +   +     +++++TGDSNGT+ +W       T      H   + +L + KS  + +G    M+  W     +     I LP ++G  R +L      N   LIIGT++N++L             F N+E   +  S+       G  GN++ + T + N  IT+ +   + +++  DK++   K  I      CV   V ++ I LG   G  I+++  +   ++   E   +  +T++  F  S   F        +T+ R    D  ++            PI  +DF    S D +Y    S   G  + +  +  +I    S +K+V W   +       IG     +         +V Q ++I A G   G I IY+ P
Sbjct:  273 QDPPTMKVTLKHVYSYRGKDVRSNIEMLPTGELVFFSANLVVLMNITGEDRSQRIYHGHTCDVKCITLHPNKILVASGQSSCHSVEKFQKPEHTSPIDSPEDLVRQLEMEHTEAHVRIWDTIKLTTLMV----LNGFEKGICHVAFSKTDSGSLLAVVDDSLKHLMSVWNWQKGKREGEVKASNDVVFECKWHPTIRNLIVLYGKGHFSFFNYDPATG-VLVKTVATFEGRDKPKTVLSMCFGENDQVVTGDSNGTISIWDPRTCKTTKQAHSVHPGGVYSLTLAKSGKILSGGKDRMVSEWDLQDLVRTRRPIELPDEKGFPRVIL-----QNGSELIIGTSSNTLL-------------FGNIENSTNLTSLI-----EGDPGNLTFLLTCSSNQLITSSQCGTLRIWNHIDKKVEFSKKFID--SVECVDVDVTNTHIILGFAAGLWIVMNITKQQTIQEKKE--GTAPITAV-KFAPSGATFAVATKDPHLTIYR---IDASKNLLVIARIHHIPAPIVALDF----SSDSQYLRGQS--IGAHLLFWTKAGEICDGTS-VKDVKWGSSRVK-----IGFETALVAHSSNGQVTAVAQCEDISACGMENGTIRIYKNP 846          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Celegans
Match: elp-1 (Echinoderm microtubule-associated protein-like elp-1 [Source:UniProtKB/Swiss-Prot;Acc:O45487])

HSP 1 Score: 136.346 bits (342), Expect = 2.781e-32
Identity = 150/622 (24.12%), Postives = 268/622 (43.09%), Query Frame = 3
Query: 1554 KDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFC--QNTQRHYCEHSADIECLTVHTDGIVIASAQ-------------------------KELQVSNYKWTARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKK--NWLLVLDDSKDHILTLWD-IKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSF-LFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVST-NDNWFITAGRDSQICVFD-ADKRLGVQKTQIKGHQFTCVSWLVDDS-IALGTIEGRCIILDQHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFP 3317
            +D PT+K+ +  VY +RG+DV  N+ +L  GEL +F+  +VVL        +QR Y  H+ D++C+T+H + I++AS Q                         ++L++ + +   RIW +  L+TL +    L+        + FS     + L V+DDS  H++++W+  KG++     +S++ V    +     N+ V  G  H  ++ + P  G +  K VA + G  K +   +     +++++TGDSNGT+ +W       T      H   + +L + KS  + +G    M+  W     +     I LP ++G  R +L      N   LIIGT++N++L             F N+E   +  S+       G  GN++ + T + N  IT+ +   + +++  DK++   K  I      CV   V ++ I LG   G  I+++  +   ++   E   +  +T++  F  S   F        +T+ R    D  ++            PI  +DF    S D +Y    S   G  + +  +  +I    S +K+V W   +       IG     +         +V Q ++I A G   G I IY+ P
Sbjct:  270 QDPPTMKVTLKHVYSYRGKDVRSNIEMLPTGELVFFSANLVVLMNITGEDRSQRIYHGHTCDVKCITLHPNKILVASGQSSCHSVEKFQKPEHTSPIDSPEDLVRQLEMEHTEAHVRIWDTIKLTTLMV----LNGFEKGICHVAFSKTDSGSLLAVVDDSLKHLMSVWNWQKGKREGEVKASNDVVFECKWHPTIRNLIVLYGKGHFSFFNYDPATG-VLVKTVATFEGRDKPKTVLSMCFGENDQVVTGDSNGTISIWDPRTCKTTKQAHSVHPGGVYSLTLAKSGKILSGGKDRMVSEWDLQDLVRTRRPIELPDEKGFPRVIL-----QNGSELIIGTSSNTLL-------------FGNIENSTNLTSLI-----EGDPGNLTFLLTCSSNQLITSSQCGTLRIWNHIDKKVEFSKKFID--SVECVDVDVTNTHIILGFAAGLWIVMNITKQQTIQEKKE--GTAPITAV-KFAPSGATFAVATKDPHLTIYR---IDASKNLLVIARIHHIPAPIVALDF----SSDSQYLRGQS--IGAHLLFWTKAGEICDGTS-VKDVKWGSSRVK-----IGFETALVAHSSNGQVTAVAQCEDISACGMENGTIRIYKNP 843          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Celegans
Match: elp-1 (Echinoderm microtubule-associated protein-like elp-1 [Source:UniProtKB/Swiss-Prot;Acc:O45487])

HSP 1 Score: 136.346 bits (342), Expect = 2.781e-32
Identity = 150/622 (24.12%), Postives = 268/622 (43.09%), Query Frame = 3
Query: 1554 KDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFC--QNTQRHYCEHSADIECLTVHTDGIVIASAQ-------------------------KELQVSNYKWTARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKK--NWLLVLDDSKDHILTLWD-IKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSF-LFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVST-NDNWFITAGRDSQICVFD-ADKRLGVQKTQIKGHQFTCVSWLVDDS-IALGTIEGRCIILDQHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFP 3317
            +D PT+K+ +  VY +RG+DV  N+ +L  GEL +F+  +VVL        +QR Y  H+ D++C+T+H + I++AS Q                         ++L++ + +   RIW +  L+TL +    L+        + FS     + L V+DDS  H++++W+  KG++     +S++ V    +     N+ V  G  H  ++ + P  G +  K VA + G  K +   +     +++++TGDSNGT+ +W       T      H   + +L + KS  + +G    M+  W     +     I LP ++G  R +L      N   LIIGT++N++L             F N+E   +  S+       G  GN++ + T + N  IT+ +   + +++  DK++   K  I      CV   V ++ I LG   G  I+++  +   ++   E   +  +T++  F  S   F        +T+ R    D  ++            PI  +DF    S D +Y    S   G  + +  +  +I    S +K+V W   +       IG     +         +V Q ++I A G   G I IY+ P
Sbjct:  270 QDPPTMKVTLKHVYSYRGKDVRSNIEMLPTGELVFFSANLVVLMNITGEDRSQRIYHGHTCDVKCITLHPNKILVASGQSSCHSVEKFQKPEHTSPIDSPEDLVRQLEMEHTEAHVRIWDTIKLTTLMV----LNGFEKGICHVAFSKTDSGSLLAVVDDSLKHLMSVWNWQKGKREGEVKASNDVVFECKWHPTIRNLIVLYGKGHFSFFNYDPATG-VLVKTVATFEGRDKPKTVLSMCFGENDQVVTGDSNGTISIWDPRTCKTTKQAHSVHPGGVYSLTLAKSGKILSGGKDRMVSEWDLQDLVRTRRPIELPDEKGFPRVIL-----QNGSELIIGTSSNTLL-------------FGNIENSTNLTSLI-----EGDPGNLTFLLTCSSNQLITSSQCGTLRIWNHIDKKVEFSKKFID--SVECVDVDVTNTHIILGFAAGLWIVMNITKQQTIQEKKE--GTAPITAV-KFAPSGATFAVATKDPHLTIYR---IDASKNLLVIARIHHIPAPIVALDF----SSDSQYLRGQS--IGAHLLFWTKAGEICDGTS-VKDVKWGSSRVK-----IGFETALVAHSSNGQVTAVAQCEDISACGMENGTIRIYKNP 843          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Celegans
Match: pfs-2 (Polyadenylation Factor Subunit homolog [Source:UniProtKB/TrEMBL;Acc:U4PN22])

HSP 1 Score: 53.1434 bits (126), Expect = 1.056e-6
Identity = 35/127 (27.56%), Postives = 64/127 (50.39%), Query Frame = 3
Query: 1722 HSADIECLTVHTDGIVIASAQKELQVSNYKWTARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIKGQKLASTSSSH-NSVLSISFSKVDENIFVTTGHE-HIMWW 2096
            H A++ C+  H    +IA+  ++ Q        +IW   S S L   QE   S     + ++F+   NWLL     +DH++ ++DI+  K   T  +H   V+S+++  + E +FV+ G +  I++W
Sbjct:   53 HGAEVRCIDWHPTKGLIATGSRDTQQP-----VKIWDPKSGSCLATLQEHKSSV----MAVEFNKNGNWLLT--GGRDHLVKMYDIRMMKEMRTYRAHKKEVISLAWHPIHEGLFVSGGGDGSIVYW 168          

HSP 2 Score: 50.0618 bits (118), Expect = 9.335e-6
Identity = 47/229 (20.52%), Postives = 92/229 (40.17%), Query Frame = 3
Query: 1731 DIECLTVHTD----GIVIASAQKELQVSNYKWTARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIK-GQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIM-WWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYK--SFLFTGDCKGMIKLWLFNKNLDNL 2393
            +    + H D    G+  A    +   ++   TAR+W        Y  +  L  +  +   +D+ P K  +          + +WD K G  LA+     +SV+++ F+K + N  +T G +H++  ++ R +      K +  YR   K  I+      +    ++G  +G++  W          ++HAH+  I ++  +     L TG      K W  N+  D +
Sbjct:    3 NAHMFSAHKDEAIRGLAFAPTDVKFATASDDGTARVWDF----ARYTEERVLRGHGAEVRCIDWHPTKGLIATGSRDTQQPVKIWDPKSGSCLATLQEHKSSVMAVEFNK-NGNWLLTGGRDHLVKMYDIRMM------KEMRTYRAHKKEVISLAWHPIHEGLFVSGGGDGSIVYWMVDGEKEIGLLEHAHDQAIWSMKWHPLGHILATGSNDNNTKFWARNRPGDTV 220          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Fly
Match: DCX-EMAP (gene:FBgn0259099 transcript:FBtr0331181)

HSP 1 Score: 181.03 bits (458), Expect = 8.014e-46
Identity = 164/654 (25.08%), Postives = 295/654 (45.11%), Query Frame = 3
Query: 1545 PNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTARIWRSDSLSTLYIF-QEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIK-GQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVW---ANGANAV-TNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESYNEIILSCG--VTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDG--SKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQT--KEILAMGTAEGKIAIYRFPCLDKEAYCH-SNIASNPVTNVLFLNSGDH-LISVSGQDSCITQWEII*QYL 3464
            P     P  KL++ WV+G+RG D   NL +L +GEL Y+   V VLF   ++ QRHY  H+ DI C+ VH    ++AS QK  +    +   RIW ++SL TLY+F    LDS      F   +   +++L +D  ++ IL++W  + G  L   ++    +   +F  +D+N+ +T G  H+ +W  R   G  +   +       ++ +T +       ++IT DS+G + ++   ++GA  V T +  H      L +    + L  G+    I  W   +N   +    LP+  GGVR +       N   + +GTT N+IL+  L         F  V F           GH  Q+  ++    +D  + TAG D  + ++  +K +   +T   G++   +++    ++A G+ EG  ++++     ++ +    +  CG  +  +        I +G  +G +        +    DG   KK N      P+  +D+    S+DG +   V+  F   + ++ + +    +   +K+V W    C +   V G W          +  +  ++   ++LA G AEG + ++R+PC+   A  H S + S  +  V FL  GDH LI+V G D+ +  W+I+ + L
Sbjct:  467 PADNSPPDKKLQLQWVHGYRGIDARRNLWVLPSGELLYYVAAVAVLFDRDEDAQRHYTGHTEDIMCMDVHPSRELVASGQKAGRDRKSQAHVRIWSTESLQTLYVFGMGELDSGVTAVAFSQLN-GGSYILAVDSGRESILSVWQWQWGHLLGKVATLQEGLSGAAFHPLDDNLIITHGRGHLAFWHRRK-DGFFERTDIVKQPS--RSHVT-SVQFEPDGDVITADSDGFITIYSVDSDGAYFVRTEFEAHNKGIGCLIMLGEGTLLSGGEKDRKIAAWDSLQNYKKIADTKLPEAAGGVRTIYPQRPGRNDGNIYVGTTRNNILEGSLQ------RRFTQVVF-----------GHGRQLWGLA-AHPDDELYATAGHDKHVALWRKNKLIWTIQT---GYECVALAFHPFGTLAAGSTEGHLLVINCENGAVMLT----LRVCGSPLNCVAYNQVGDMIAMGSQNGSIYL------FRVSRDGFSYKKVNKIRGSQPLTHLDW----SMDGNFVQTVTIDF-DLLFWDAKSLSPERSPIAMKDVKWLTNNCTVGFLVAGQWSNRYYSTTNTIVATCSRSAAHDMLASGDAEGYLRLFRYPCISPRAEFHESKVYSGMLACVRFL-CGDHTLITVGGTDASLMVWDIVEEXL 1078          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Fly
Match: DCX-EMAP (gene:FBgn0259099 transcript:FBtr0299509)

HSP 1 Score: 180.644 bits (457), Expect = 8.782e-46
Identity = 163/650 (25.08%), Postives = 293/650 (45.08%), Query Frame = 3
Query: 1545 PNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTARIWRSDSLSTLYIF-QEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIK-GQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVW---ANGANAV-TNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESYNEIILSCG--VTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDG--SKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQT--KEILAMGTAEGKIAIYRFPCLDKEAYCH-SNIASNPVTNVLFLNSGDH-LISVSGQDSCITQWEII 3452
            P     P  KL++ WV+G+RG D   NL +L +GEL Y+   V VLF   ++ QRHY  H+ DI C+ VH    ++AS QK  +    +   RIW ++SL TLY+F    LDS      F   +   +++L +D  ++ IL++W  + G  L   ++    +   +F  +D+N+ +T G  H+ +W  R   G  +   +       ++ +T +       ++IT DS+G + ++   ++GA  V T +  H      L +    + L  G+    I  W   +N   +    LP+  GGVR +       N   + +GTT N+IL+  L         F  V F           GH  Q+  ++    +D  + TAG D  + ++  +K +   +T   G++   +++    ++A G+ EG  ++++     ++ +    +  CG  +  +        I +G  +G +        +    DG   KK N      P+  +D+    S+DG +   V+  F   + ++ + +    +   +K+V W    C +   V G W          +  +  ++   ++LA G AEG + ++R+PC+   A  H S + S  +  V FL  GDH LI+V G D+ +  W+I+
Sbjct:  467 PADNSPPDKKLQLQWVHGYRGIDARRNLWVLPSGELLYYVAAVAVLFDRDEDAQRHYTGHTEDIMCMDVHPSRELVASGQKAGRDRKSQAHVRIWSTESLQTLYVFGMGELDSGVTAVAFSQLN-GGSYILAVDSGRESILSVWQWQWGHLLGKVATLQEGLSGAAFHPLDDNLIITHGRGHLAFWHRRK-DGFFERTDIVKQPS--RSHVT-SVQFEPDGDVITADSDGFITIYSVDSDGAYFVRTEFEAHNKGIGCLIMLGEGTLLSGGEKDRKIAAWDSLQNYKKIADTKLPEAAGGVRTIYPQRPGRNDGNIYVGTTRNNILEGSLQ------RRFTQVVF-----------GHGRQLWGLA-AHPDDELYATAGHDKHVALWRKNKLIWTIQT---GYECVALAFHPFGTLAAGSTEGHLLVINCENGAVMLT----LRVCGSPLNCVAYNQVGDMIAMGSQNGSIYL------FRVSRDGFSYKKVNKIRGSQPLTHLDW----SMDGNFVQTVTIDF-DLLFWDAKSLSPERSPIAMKDVKWLTNNCTVGFLVAGQWSNRYYSTTNTIVATCSRSAAHDMLASGDAEGYLRLFRYPCISPRAEFHESKVYSGMLACVRFL-CGDHTLITVGGTDASLMVWDIV 1074          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Fly
Match: DCX-EMAP (gene:FBgn0259099 transcript:FBtr0330139)

HSP 1 Score: 179.104 bits (453), Expect = 1.125e-45
Identity = 163/650 (25.08%), Postives = 293/650 (45.08%), Query Frame = 3
Query: 1545 PNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTARIWRSDSLSTLYIF-QEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIK-GQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVW---ANGANAV-TNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESYNEIILSCG--VTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDG--SKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQT--KEILAMGTAEGKIAIYRFPCLDKEAYCH-SNIASNPVTNVLFLNSGDH-LISVSGQDSCITQWEII 3452
            P     P  KL++ WV+G+RG D   NL +L +GEL Y+   V VLF   ++ QRHY  H+ DI C+ VH    ++AS QK  +    +   RIW ++SL TLY+F    LDS      F   +   +++L +D  ++ IL++W  + G  L   ++    +   +F  +D+N+ +T G  H+ +W  R   G  +   +       ++ +T +       ++IT DS+G + ++   ++GA  V T +  H      L +    + L  G+    I  W   +N   +    LP+  GGVR +       N   + +GTT N+IL+  L         F  V F           GH  Q+  ++    +D  + TAG D  + ++  +K +   +T   G++   +++    ++A G+ EG  ++++     ++ +    +  CG  +  +        I +G  +G +        +    DG   KK N      P+  +D+    S+DG +   V+  F   + ++ + +    +   +K+V W    C +   V G W          +  +  ++   ++LA G AEG + ++R+PC+   A  H S + S  +  V FL  GDH LI+V G D+ +  W+I+
Sbjct:  242 PADNSPPDKKLQLQWVHGYRGIDARRNLWVLPSGELLYYVAAVAVLFDRDEDAQRHYTGHTEDIMCMDVHPSRELVASGQKAGRDRKSQAHVRIWSTESLQTLYVFGMGELDSGVTAVAFSQLN-GGSYILAVDSGRESILSVWQWQWGHLLGKVATLQEGLSGAAFHPLDDNLIITHGRGHLAFWHRRK-DGFFERTDIVKQPS--RSHVT-SVQFEPDGDVITADSDGFITIYSVDSDGAYFVRTEFEAHNKGIGCLIMLGEGTLLSGGEKDRKIAAWDSLQNYKKIADTKLPEAAGGVRTIYPQRPGRNDGNIYVGTTRNNILEGSLQ------RRFTQVVF-----------GHGRQLWGLA-AHPDDELYATAGHDKHVALWRKNKLIWTIQT---GYECVALAFHPFGTLAAGSTEGHLLVINCENGAVMLT----LRVCGSPLNCVAYNQVGDMIAMGSQNGSIYL------FRVSRDGFSYKKVNKIRGSQPLTHLDW----SMDGNFVQTVTIDF-DLLFWDAKSLSPERSPIAMKDVKWLTNNCTVGFLVAGQWSNRYYSTTNTIVATCSRSAAHDMLASGDAEGYLRLFRYPCISPRAEFHESKVYSGMLACVRFL-CGDHTLITVGGTDASLMVWDIV 849          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Fly
Match: DCX-EMAP (gene:FBgn0259099 transcript:FBtr0299510)

HSP 1 Score: 178.333 bits (451), Expect = 1.456e-45
Identity = 162/650 (24.92%), Postives = 293/650 (45.08%), Query Frame = 3
Query: 1545 PNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTARIWRSDSLSTLYIF-QEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIK-GQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVW---ANGANAV-TNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESYNEIILSCG--VTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDG--SKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQT--KEILAMGTAEGKIAIYRFPCLDKEAYCH-SNIASNPVTNVLFLNSGDH-LISVSGQDSCITQWEII 3452
            P     P  KL++ WV+G+RG D   NL +L +GEL Y+   V VLF   ++ QRHY  H+ DI C+ VH    ++AS QK  +    +   RIW ++SL TLY+F    LDS      F   +   +++L +D  ++ IL++W  + G  L   ++    +   +F  +D+N+ +T G  H+ +W  R   G  +   +       ++ +T +       ++IT DS+G + ++   ++GA  V T +  H      L +    + L  G+    I  W   +N   +    LP+  GGVR +       N   + +GTT N+IL+        +   F  V F           GH  Q+  ++    +D  + TAG D  + ++  +K +   +T   G++   +++    ++A G+ EG  ++++     ++ +    +  CG  +  +        I +G  +G +        +    DG   KK N      P+  +D+    S+DG +   V+  F   + ++ + +    +   +K+V W    C +   V G W          +  +  ++   ++LA G AEG + ++R+PC+   A  H S + S  +  V FL  GDH LI+V G D+ +  W+I+
Sbjct:  210 PADNSPPDKKLQLQWVHGYRGIDARRNLWVLPSGELLYYVAAVAVLFDRDEDAQRHYTGHTEDIMCMDVHPSRELVASGQKAGRDRKSQAHVRIWSTESLQTLYVFGMGELDSGVTAVAFSQLN-GGSYILAVDSGRESILSVWQWQWGHLLGKVATLQEGLSGAAFHPLDDNLIITHGRGHLAFWHRRK-DGFFERTDIVKQPS--RSHVT-SVQFEPDGDVITADSDGFITIYSVDSDGAYFVRTEFEAHNKGIGCLIMLGEGTLLSGGEKDRKIAAWDSLQNYKKIADTKLPEAAGGVRTIYPQRPGRNDGNIYVGTTRNNILE------GSLQRRFTQVVF-----------GHGRQLWGLA-AHPDDELYATAGHDKHVALWRKNKLIWTIQT---GYECVALAFHPFGTLAAGSTEGHLLVINCENGAVMLT----LRVCGSPLNCVAYNQVGDMIAMGSQNGSIYL------FRVSRDGFSYKKVNKIRGSQPLTHLDW----SMDGNFVQTVTIDF-DLLFWDAKSLSPERSPIAMKDVKWLTNNCTVGFLVAGQWSNRYYSTTNTIVATCSRSAAHDMLASGDAEGYLRLFRYPCISPRAEFHESKVYSGMLACVRFL-CGDHTLITVGGTDASLMVWDIV 817          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Zebrafish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 257.299 bits (656), Expect = 1.391e-71
Identity = 207/689 (30.04%), Postives = 319/689 (46.30%), Query Frame = 3
Query: 1431 KPVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTA---RIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIKGQ-KLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFL----KARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESY---NEIILSCGVTSIFNF-PDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHM-KIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPL-MLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCH-SNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            K  + +F   +  V++ L G P  +  P DL +    L    DLP  KLK+DWVYG+RGRD   NL LL  GE  YF   VVVL+   +  QRHY  H+ DI+CL VH D I IA+ Q     S+ K  A   R+W S SL+TL+I            +    S   +WL V+DDS DH+L++WD + + +LA    S+ SV +  F   D NI VT G  H+ +W        ++   +   +G      K +       + + + ITGDS+G + VW  G+N ++  I+ AHE  + ALC+ ++       K   KL  +++N   +  + +P+  G VR      +      ++IGTT N +LQ  L           N EF      I I+QGH  ++  ++ +    + F+T G D  I ++D+D    +    ++    +        ++A+G   GR ++LD    +LV  +   NE +      S+  F PD   + +G  D  +      EN        K    S F   I  +D+    S+D +Y   VSN     + Y I  + K V ++ T +++ W+   C +   V G W       +  A+C S    K +L  G   GK+ ++ FPC    A  H  +  S+ VTNV FL    HL+S  G+D  I QW ++
Sbjct:  160 KQREPVFSADEGYVKMYLKGRPITMYMPKDL-VDTYCLETKADLPPKKLKLDWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLYNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSDGKQLAPHVRVWDSVSLNTLHILGNGFFDRALVCLSFSKSNGGSWLCVVDDSNDHMLSVWDWQREDRLAEVKCSNESVFAADFHPTDANIIVTCGKSHLCFW-------SLEKGSLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRISLAIQGAHEASVFALCMLRNGTLVSGGKDR-KLISWDENFQKIQTVEVPELYGPVR----TVAEGRGETVLIGTTKNYVLQGSL-----------NGEF------IPITQGHTDELWGLT-IHPLKHQFLTCGHDKHIYLWDSDSHQPIWTKTLEDSAQSAGFHPSGATVAVGMQTGRWLVLDTESKDLVTVHTDGNEQL------SVIRFSPDGNFLAIGSHDNYIYIYAVAENGKKYSRVGKCSGHSSF---ITHLDW----SVDSQYL--VSNSGDYEILYWIPSVCKQVVSVETTRDIEWATFTCTLGFHVFGLWPDGSDGTDINAVCSSY--AKRLLVTGDDFGKVHLFSFPCSQSRAPSHIYSGHSSHVTNVNFLFDDSHLVSTGGKDMSIMQWRVV 800          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Zebrafish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 256.914 bits (655), Expect = 2.306e-71
Identity = 209/702 (29.77%), Postives = 323/702 (46.01%), Query Frame = 3
Query: 1392 TNTPAIPKPEIVIKPVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTA---RIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIKGQ-KLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFL----KARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESY---NEIILSCGVTSIFNF-PDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHM-KIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPL-MLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCH-SNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            T + +  K     K  + +F   +  V++ L G P  +  P DL +    L    DLP  KLK+DWVYG+RGRD   NL LL  GE  YF   VVVL+   +  QRHY  H+ DI+CL VH D I IA+ Q     S+ K  A   R+W S SL+TL+I            +    S   +WL V+DDS DH+L++WD + + +LA    S+ SV +  F   D NI VT G  H+ +W        ++   +   +G      K +       + + + ITGDS+G + VW  G+N ++  I+ AHE  + ALC+ ++       K   KL  +++N   +  + +P+  G VR      +      ++IGTT N +LQ  L           N EF      I I+QGH  ++  ++ +    + F+T G D  I ++D+D    +    ++    +        ++A+G   GR ++LD    +LV  +   NE +      S+  F PD   + +G  D  +      EN        K    S F   I  +D+    S+D +Y   VSN     + Y I  + K V ++ T +++ W+   C +   V G W       +  A+C S    K +L  G   GK+ ++ FPC    A  H  +  S+ VTNV FL    HL+S  G+D  I QW ++
Sbjct:  160 TGSNSSGKKTTETKQREPVFSADEGYVKMYLKGRPITMYMPKDL-VDTYCLETKADLPPKKLKLDWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLYNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSDGKQLAPHVRVWDSVSLNTLHILGNGFFDRALVCLSFSKSNGGSWLCVVDDSNDHMLSVWDWQREDRLAEVKCSNESVFAADFHPTDANIIVTCGKSHLCFW-------SLEKGSLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRISLAIQGAHEASVFALCMLRNGTLVSGGKDR-KLISWDENFQKIQTVEVPELYGPVR----TVAEGRGETVLIGTTKNYVLQGSL-----------NGEF------IPITQGHTDELWGLT-IHPLKHQFLTCGHDKHIYLWDSDSHQPIWTKTLEDSAQSAGFHPSGATVAVGMQTGRWLVLDTESKDLVTVHTDGNEQL------SVIRFSPDGNFLAIGSHDNYIYIYAVAENGKKYSRVGKCSGHSSF---ITHLDW----SVDSQYL--VSNSGDYEILYWIPSVCKQVVSVETTRDIEWATFTCTLGFHVFGLWPDGSDGTDINAVCSSY--AKRLLVTGDDFGKVHLFSFPCSQSRAPSHIYSGHSSHVTNVNFLFDDSHLVSTGGKDMSIMQWRVV 813          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Zebrafish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 254.988 bits (650), Expect = 8.694e-71
Identity = 206/681 (30.25%), Postives = 316/681 (46.40%), Query Frame = 3
Query: 1455 KPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTA---RIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIKGQ-KLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFL----KARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESY---NEIILSCGVTSIFNF-PDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHM-KIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPL-MLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCH-SNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            K +  V++ L G P  +  P DL +    L    DLP  KLK+DWVYG+RGRD   NL LL  GE  YF   VVVL+   +  QRHY  H+ DI+CL VH D I IA+ Q     S+ K  A   R+W S SL+TL+I            +    S   +WL V+DDS DH+L++WD + + +LA    S+ SV +  F   D NI VT G  H+ +W        ++   +   +G      K +       + + + ITGDS+G + VW  G+N ++  I+ AHE  + ALC+ ++       K   KL  +++N   +  + +P+  G VR      +      ++IGTT N +LQ  L           N EF      I I+QGH  ++  ++ +    + F+T G D  I ++D+D    +    ++    +        ++A+G   GR ++LD    +LV  +   NE +      S+  F PD   + +G  D  +      EN        K    S F   I  +D+    S+D +Y   VSN     + Y I  + K V ++ T +++ W+   C +   V G W       +  A+C S    K +L  G   GK+ ++ FPC    A  H  +  S+ VTNV FL    HL+S  G+D  I QW ++
Sbjct:  177 KDEGYVKMYLKGRPITMYMPKDL-VDTYCLETKADLPPKKLKLDWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLYNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSDGKQLAPHVRVWDSVSLNTLHILGNGFFDRALVCLSFSKSNGGSWLCVVDDSNDHMLSVWDWQREDRLAEVKCSNESVFAADFHPTDANIIVTCGKSHLCFW-------SLEKGSLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRISLAIQGAHEASVFALCMLRNGTLVSGGKDR-KLISWDENFQKIQTVEVPELYGPVR----TVAEGRGETVLIGTTKNYVLQGSL-----------NGEF------IPITQGHTDELWGLT-IHPLKHQFLTCGHDKHIYLWDSDSHQPIWTKTLEDSAQSAGFHPSGATVAVGMQTGRWLVLDTESKDLVTVHTDGNEQL------SVIRFSPDGNFLAIGSHDNYIYIYAVAENGKKYSRVGKCSGHSSF---ITHLDW----SVDSQYL--VSNSGDYEILYWIPSVCKQVVSVETTRDIEWATFTCTLGFHVFGLWPDGSDGTDINAVCSSY--AKRLLVTGDDFGKVHLFSFPCSQSRAPSHIYSGHSSHVTNVNFLFDDSHLVSTGGKDMSIMQWRVV 809          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Zebrafish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 254.988 bits (650), Expect = 8.899e-71
Identity = 206/681 (30.25%), Postives = 316/681 (46.40%), Query Frame = 3
Query: 1455 KPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTA---RIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIKGQ-KLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFL----KARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESY---NEIILSCGVTSIFNF-PDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHM-KIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPL-MLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCH-SNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            K +  V++ L G P  +  P DL +    L    DLP  KLK+DWVYG+RGRD   NL LL  GE  YF   VVVL+   +  QRHY  H+ DI+CL VH D I IA+ Q     S+ K  A   R+W S SL+TL+I            +    S   +WL V+DDS DH+L++WD + + +LA    S+ SV +  F   D NI VT G  H+ +W        ++   +   +G      K +       + + + ITGDS+G + VW  G+N ++  I+ AHE  + ALC+ ++       K   KL  +++N   +  + +P+  G VR      +      ++IGTT N +LQ  L           N EF      I I+QGH  ++  ++ +    + F+T G D  I ++D+D    +    ++    +        ++A+G   GR ++LD    +LV  +   NE +      S+  F PD   + +G  D  +      EN        K    S F   I  +D+    S+D +Y   VSN     + Y I  + K V ++ T +++ W+   C +   V G W       +  A+C S    K +L  G   GK+ ++ FPC    A  H  +  S+ VTNV FL    HL+S  G+D  I QW ++
Sbjct:  185 KDEGYVKMYLKGRPITMYMPKDL-VDTYCLETKADLPPKKLKLDWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLYNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSDGKQLAPHVRVWDSVSLNTLHILGNGFFDRALVCLSFSKSNGGSWLCVVDDSNDHMLSVWDWQREDRLAEVKCSNESVFAADFHPTDANIIVTCGKSHLCFW-------SLEKGSLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRISLAIQGAHEASVFALCMLRNGTLVSGGKDR-KLISWDENFQKIQTVEVPELYGPVR----TVAEGRGETVLIGTTKNYVLQGSL-----------NGEF------IPITQGHTDELWGLT-IHPLKHQFLTCGHDKHIYLWDSDSHQPIWTKTLEDSAQSAGFHPSGATVAVGMQTGRWLVLDTESKDLVTVHTDGNEQL------SVIRFSPDGNFLAIGSHDNYIYIYAVAENGKKYSRVGKCSGHSSF---ITHLDW----SVDSQYL--VSNSGDYEILYWIPSVCKQVVSVETTRDIEWATFTCTLGFHVFGLWPDGSDGTDINAVCSSY--AKRLLVTGDDFGKVHLFSFPCSQSRAPSHIYSGHSSHVTNVNFLFDDSHLVSTGGKDMSIMQWRVV 817          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Zebrafish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 254.988 bits (650), Expect = 1.476e-70
Identity = 206/681 (30.25%), Postives = 316/681 (46.40%), Query Frame = 3
Query: 1455 KPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTA---RIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIKGQ-KLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFL----KARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESY---NEIILSCGVTSIFNF-PDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHM-KIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPL-MLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCH-SNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            K +  V++ L G P  +  P DL +    L    DLP  KLK+DWVYG+RGRD   NL LL  GE  YF   VVVL+   +  QRHY  H+ DI+CL VH D I IA+ Q     S+ K  A   R+W S SL+TL+I            +    S   +WL V+DDS DH+L++WD + + +LA    S+ SV +  F   D NI VT G  H+ +W        ++   +   +G      K +       + + + ITGDS+G + VW  G+N ++  I+ AHE  + ALC+ ++       K   KL  +++N   +  + +P+  G VR      +      ++IGTT N +LQ  L           N EF      I I+QGH  ++  ++ +    + F+T G D  I ++D+D    +    ++    +        ++A+G   GR ++LD    +LV  +   NE +      S+  F PD   + +G  D  +      EN        K    S F   I  +D+    S+D +Y   VSN     + Y I  + K V ++ T +++ W+   C +   V G W       +  A+C S    K +L  G   GK+ ++ FPC    A  H  +  S+ VTNV FL    HL+S  G+D  I QW ++
Sbjct:  208 KDEGYVKMYLKGRPITMYMPKDL-VDTYCLETKADLPPKKLKLDWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLYNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSDGKQLAPHVRVWDSVSLNTLHILGNGFFDRALVCLSFSKSNGGSWLCVVDDSNDHMLSVWDWQREDRLAEVKCSNESVFAADFHPTDANIIVTCGKSHLCFW-------SLEKGSLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRISLAIQGAHEASVFALCMLRNGTLVSGGKDR-KLISWDENFQKIQTVEVPELYGPVR----TVAEGRGETVLIGTTKNYVLQGSL-----------NGEF------IPITQGHTDELWGLT-IHPLKHQFLTCGHDKHIYLWDSDSHQPIWTKTLEDSAQSAGFHPSGATVAVGMQTGRWLVLDTESKDLVTVHTDGNEQL------SVIRFSPDGNFLAIGSHDNYIYIYAVAENGKKYSRVGKCSGHSSF---ITHLDW----SVDSQYL--VSNSGDYEILYWIPSVCKQVVSVETTRDIEWATFTCTLGFHVFGLWPDGSDGTDINAVCSSY--AKRLLVTGDDFGKVHLFSFPCSQSRAPSHIYSGHSSHVTNVNFLFDDSHLVSTGGKDMSIMQWRVV 840          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Xenopus
Match: ccdc81 (coiled-coil domain containing 81 [Source:Xenbase;Acc:XB-GENE-967044])

HSP 1 Score: 245.743 bits (626), Expect = 1.431e-67
Identity = 196/682 (28.74%), Postives = 301/682 (44.13%), Query Frame = 3
Query: 1434 PVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWT---ARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWD-IKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPI---FGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAW-MTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCHSNIA-SNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            P + +F   +  V++ L G P  +  P +  +    L    +LP  KLK++WVYG+RGRD   NL LL  GE  YF   VVVL+   +  QRHY  H+ D++CL VH D I IA+ Q      + K      RIW S +L+TL++            +    S     L  +DDS DH+L++WD  K +KLA    S+ +V    F   D N+ VT G  H+ +W    L G    K    +    K +       + + + ITGDS+G + VW  G N +T+ ++ AH+  I ALC+ +        K   KL  ++ N   L  + +P+  G VR      +     +++IGTT N +LQ  L+            EF        I+QGH  ++  ++  S     F+T G+D QI ++DA     +    I+    +         +A+GT+ GR  +LD    +LV  + +      V  +   PD   + +G  D  +     NEN        K    S F T +       ++   S D +   W+ +             K V ++ T +++ W    C +   V G W       +  A+C S    K++LA G   GK+ ++ FPC    A  H+    S+ VTNV FL    HLIS  G+D  I QW  +
Sbjct:  155 PKEPMFSAEEGYVKMFLRGRPVTMYMPKE-QVETYSLEAKGELPAKKLKLEWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLYNVEEQLQRHYTGHTDDVKCLAVHPDKITIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIGMGFFDRAVTCVAFSKSNGGGNLCSVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFVADFHPTDTNVIVTCGKSHLYFWT---LEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNLLVWGKGTNRITHAVQGAHDGGIFALCMQRDGTLVSGGKDR-KLVSWDGNYQQLNKVEIPEQFGPVR----TVAEGRGDVVLIGTTRNFVLQGTLSG-----------EFNT------ITQGHTDELWGLAAHSLKPQ-FLTCGQDKQITLWDATSHRPIWTKIIEDPAQSSGFHPNGSVVAIGTLTGRWFVLDTETKDLVTVHTDGNEQLSV--MCYSPDGNFLAIGSHDNYIYIYAVNENGRKYSRIGKCSGHSSFITHLDWSINSQYLMSNSGDYEILYWIPSA-----------CKQVVSVETTRDIEWVTHTCTLGFQVFGVWPEGSDGTDLNAICRST--DKKLLATGDDFGKVHLFSFPCSQFRASGHAYGGHSSHVTNVSFLYDDRHLISTGGKDMSIMQWRAV 794          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Xenopus
Match: ccdc81 (coiled-coil domain containing 81 [Source:Xenbase;Acc:XB-GENE-967044])

HSP 1 Score: 244.973 bits (624), Expect = 3.492e-67
Identity = 196/682 (28.74%), Postives = 301/682 (44.13%), Query Frame = 3
Query: 1434 PVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWT---ARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWD-IKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPI---FGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAW-MTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCHSNIA-SNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            P + +F   +  V++ L G P  +  P +  +    L    +LP  KLK++WVYG+RGRD   NL LL  GE  YF   VVVL+   +  QRHY  H+ D++CL VH D I IA+ Q      + K      RIW S +L+TL++            +    S     L  +DDS DH+L++WD  K +KLA    S+ +V    F   D N+ VT G  H+ +W    L G    K    +    K +       + + + ITGDS+G + VW  G N +T+ ++ AH+  I ALC+ +        K   KL  ++ N   L  + +P+  G VR      +     +++IGTT N +LQ  L+            EF        I+QGH  ++  ++  S     F+T G+D QI ++DA     +    I+    +         +A+GT+ GR  +LD    +LV  + +      V  +   PD   + +G  D  +     NEN        K    S F T +       ++   S D +   W+ +             K V ++ T +++ W    C +   V G W       +  A+C S    K++LA G   GK+ ++ FPC    A  H+    S+ VTNV FL    HLIS  G+D  I QW  +
Sbjct:  176 PKEPMFSAEEGYVKMFLRGRPVTMYMPKE-QVETYSLEAKGELPAKKLKLEWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLYNVEEQLQRHYTGHTDDVKCLAVHPDKITIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIGMGFFDRAVTCVAFSKSNGGGNLCSVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFVADFHPTDTNVIVTCGKSHLYFW---TLEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNLLVWGKGTNRITHAVQGAHDGGIFALCMQRDGTLVSGGKDR-KLVSWDGNYQQLNKVEIPEQFGPVR----TVAEGRGDVVLIGTTRNFVLQGTLSG-----------EFNT------ITQGHTDELWGLAAHSLKPQ-FLTCGQDKQITLWDATSHRPIWTKIIEDPAQSSGFHPNGSVVAIGTLTGRWFVLDTETKDLVTVHTDGNEQLSV--MCYSPDGNFLAIGSHDNYIYIYAVNENGRKYSRIGKCSGHSSFITHLDWSINSQYLMSNSGDYEILYWIPSA-----------CKQVVSVETTRDIEWVTHTCTLGFQVFGVWPEGSDGTDLNAICRST--DKKLLATGDDFGKVHLFSFPCSQFRASGHAYGGHSSHVTNVSFLYDDRHLISTGGKDMSIMQWRAV 815          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Xenopus
Match: ccdc81 (coiled-coil domain containing 81 [Source:Xenbase;Acc:XB-GENE-967044])

HSP 1 Score: 241.121 bits (614), Expect = 2.115e-66
Identity = 204/706 (28.90%), Postives = 309/706 (43.77%), Query Frame = 3
Query: 1362 PRKSGNKKVVTNTPAIPKPEIVIKPVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWT---ARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWD-IKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPI---FGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAW-MTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCHSNIA-SNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            P  SG KK +   P I     +I     LF   +  V++ L G P  +  P +  +    L    +LP  KLK++WVYG+RGRD   NL LL  GE  YF   VVVL+   +  QRHY  H+ D++CL VH D I IA+ Q      + K      RIW S +L+TL++            +    S     L  +DDS DH+L++WD  K +KLA    S+ +V    F   D N+ VT G  H+ +W    L G    K    +    K +       + + + ITGDS+G + VW  G N +T+ ++ AH+  I ALC+ +        K   KL  ++ N   L  + +P+  G VR      +     +++IGTT N +LQ  L+            EF        I+QGH  ++  ++  S     F+T G+D QI ++DA     +    I+    +         +A+GT+ GR  +LD    +LV  + +      V  +   PD   + +G  D  +     NEN        K    S F T +       ++   S D +   W+ +             K V ++ T +++ W    C +   V G W       +  A+C S    K++LA G   GK+ ++ FPC    A  H+    S+ VTNV FL    HLIS  G+D  I QW  +
Sbjct:   81 PSPSGTKKDIV--PTIVSCIYLIF----LFVLEEGYVKMFLRGRPVTMYMPKE-QVETYSLEAKGELPAKKLKLEWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLYNVEEQLQRHYTGHTDDVKCLAVHPDKITIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIGMGFFDRAVTCVAFSKSNGGGNLCSVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFVADFHPTDTNVIVTCGKSHLYFWT---LEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNLLVWGKGTNRITHAVQGAHDGGIFALCMQRDGTLVSGGKDR-KLVSWDGNYQQLNKVEIPEQFGPVR----TVAEGRGDVVLIGTTRNFVLQGTLSG-----------EFN------TITQGHTDELWGLAAHSLKPQ-FLTCGQDKQITLWDATSHRPIWTKIIEDPAQSSGFHPNGSVVAIGTLTGRWFVLDTETKDLVTVHTDGNEQLSV--MCYSPDGNFLAIGSHDNYIYIYAVNENGRKYSRIGKCSGHSSFITHLDWSINSQYLMSNSGDYEILYWIPSA-----------CKQVVSVETTRDIEWVTHTCTLGFQVFGVWPEGSDGTDLNAICRST--DKKLLATGDDFGKVHLFSFPCSQFRASGHAYGGHSSHVTNVSFLYDDRHLISTGGKDMSIMQWRAV 738          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Xenopus
Match: ccdc81 (coiled-coil domain containing 81 [Source:Xenbase;Acc:XB-GENE-967044])

HSP 1 Score: 241.891 bits (616), Expect = 2.622e-66
Identity = 196/678 (28.91%), Postives = 299/678 (44.10%), Query Frame = 3
Query: 1446 LFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWT---ARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWD-IKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPI---FGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAW-MTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCHSNIA-SNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            LF   +  V++ L G P  +  P +  +    L    +LP  KLK++WVYG+RGRD   NL LL  GE  YF   VVVL+   +  QRHY  H+ D++CL VH D I IA+ Q      + K      RIW S +L+TL++            +    S     L  +DDS DH+L++WD  K +KLA    S+ +V    F   D N+ VT G  H+ +W    L G    K    +    K +       + + + ITGDS+G + VW  G N +T+ ++ AH+  I ALC+ +        K   KL  ++ N   L  + +P+  G VR      +     +++IGTT N +LQ  L+            EF        I+QGH  ++  ++  S     F+T G+D QI ++DA     +    I+    +         +A+GT+ GR  +LD    +LV  + +      V  +   PD   + +G  D  +     NEN        K    S F T +       ++   S D +   W+ +             K V ++ T +++ W    C +   V G W       +  A+C S    K++LA G   GK+ ++ FPC    A  H+    S+ VTNV FL    HLIS  G+D  I QW  +
Sbjct:  148 LFVLEEGYVKMFLRGRPVTMYMPKE-QVETYSLEAKGELPAKKLKLEWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLYNVEEQLQRHYTGHTDDVKCLAVHPDKITIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIGMGFFDRAVTCVAFSKSNGGGNLCSVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFVADFHPTDTNVIVTCGKSHLYFW---TLEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNLLVWGKGTNRITHAVQGAHDGGIFALCMQRDGTLVSGGKDR-KLVSWDGNYQQLNKVEIPEQFGPVR----TVAEGRGDVVLIGTTRNFVLQGTLSG-----------EFN------TITQGHTDELWGLAAHSLKPQ-FLTCGQDKQITLWDATSHRPIWTKIIEDPAQSSGFHPNGSVVAIGTLTGRWFVLDTETKDLVTVHTDGNEQLSV--MCYSPDGNFLAIGSHDNYIYIYAVNENGRKYSRIGKCSGHSSFITHLDWSINSQYLMSNSGDYEILYWIPSA-----------CKQVVSVETTRDIEWVTHTCTLGFQVFGVWPEGSDGTDLNAICRST--DKKLLATGDDFGKVHLFSFPCSQFRASGHAYGGHSSHVTNVSFLYDDRHLISTGGKDMSIMQWRAV 783          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Xenopus
Match: ccdc81 (coiled-coil domain containing 81 [Source:Xenbase;Acc:XB-GENE-967044])

HSP 1 Score: 240.736 bits (613), Expect = 9.242e-66
Identity = 196/678 (28.91%), Postives = 299/678 (44.10%), Query Frame = 3
Query: 1446 LFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWT---ARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWD-IKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPI---FGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAW-MTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCHSNIA-SNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            LF   +  V++ L G P  +  P +  +    L    +LP  KLK++WVYG+RGRD   NL LL  GE  YF   VVVL+   +  QRHY  H+ D++CL VH D I IA+ Q      + K      RIW S +L+TL++            +    S     L  +DDS DH+L++WD  K +KLA    S+ +V    F   D N+ VT G  H+ +W    L G    K    +    K +       + + + ITGDS+G + VW  G N +T+ ++ AH+  I ALC+ +        K   KL  ++ N   L  + +P+  G VR      +     +++IGTT N +LQ  L+            EF        I+QGH  ++  ++  S     F+T G+D QI ++DA     +    I+    +         +A+GT+ GR  +LD    +LV  + +      V  +   PD   + +G  D  +     NEN        K    S F T +       ++   S D +   W+ +             K V ++ T +++ W    C +   V G W       +  A+C S    K++LA G   GK+ ++ FPC    A  H+    S+ VTNV FL    HLIS  G+D  I QW  +
Sbjct:  177 LFVLEEGYVKMFLRGRPVTMYMPKE-QVETYSLEAKGELPAKKLKLEWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLYNVEEQLQRHYTGHTDDVKCLAVHPDKITIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIGMGFFDRAVTCVAFSKSNGGGNLCSVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFVADFHPTDTNVIVTCGKSHLYFW---TLEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNLLVWGKGTNRITHAVQGAHDGGIFALCMQRDGTLVSGGKDR-KLVSWDGNYQQLNKVEIPEQFGPVR----TVAEGRGDVVLIGTTRNFVLQGTLSG-----------EFNT------ITQGHTDELWGLAAHSLKPQ-FLTCGQDKQITLWDATSHRPIWTKIIEDPAQSSGFHPNGSVVAIGTLTGRWFVLDTETKDLVTVHTDGNEQLSV--MCYSPDGNFLAIGSHDNYIYIYAVNENGRKYSRIGKCSGHSSFITHLDWSINSQYLMSNSGDYEILYWIPSA-----------CKQVVSVETTRDIEWVTHTCTLGFQVFGVWPEGSDGTDLNAICRST--DKKLLATGDDFGKVHLFSFPCSQFRASGHAYGGHSSHVTNVSFLYDDRHLISTGGKDMSIMQWRAV 812          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Mouse
Match: Eml1 (echinoderm microtubule associated protein like 1 [Source:MGI Symbol;Acc:MGI:1915769])

HSP 1 Score: 241.121 bits (614), Expect = 3.145e-66
Identity = 197/686 (28.72%), Postives = 302/686 (44.02%), Query Frame = 3
Query: 1434 PVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWT---ARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWD-IKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESY---NEIILSCGVTSIFNF-PDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPI---FGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAW-MTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCH-SNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            P +  F   +  V++ L G P  +  P D  +    L    +LPT +LK++WVYG+RGRD   NL LL  GE  YF   VVVL+   +  QRHY  H+ D++CL VH D I IA+ Q      + K      RIW S +L+TL++            I    S     L  +DDS DH+L++WD  K ++LA    S+ +V +  F   D NI VT G  H+ +W    L G    K    +    K +       + + + ITGDS+G + VW  G N ++  ++ AHE  I ALC+ +            +L  +N N   L    +P+  G +R   VA    N  +++IGTT N +LQ  L+                 G    I+QGH  ++  ++ +  +   F+T G D    ++DA     V    I+    +         +A+GT+ GR  + D    +LV  +   NE +      S+  + PD   + +G  D C+      +N        K    S F T +       F+   S D +   WV +             K V ++ T +++ W+   C +   V G W       +  A+C   H+ K +L  G   GK+ ++ +PC    A  H  +  S+ VTNV FL    HLIS  G+D+ I QW +I
Sbjct:  143 PKEPAFSPEEGYVKMFLRGRPVTMYMPKD-QVDSYSLEAKAELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGGHLCAVDDSNDHVLSVWDWQKEERLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWT---LEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRRLISWNGNYQKLHKAEIPEQFGPIR--TVAEGKGN--VILIGTTRNFVLQGTLS-----------------GDFTPITQGHTDELWGLA-IHASKPQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQL------SVMRYSPDGNFLAIGSHDNCIYIYGVTDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSA-----------CKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVC-RAHERK-LLCTGDDFGKVHLFSYPCSQFRAPSHIYSGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI 783          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Mouse
Match: Eml1 (echinoderm microtubule associated protein like 1 [Source:MGI Symbol;Acc:MGI:1915769])

HSP 1 Score: 240.736 bits (613), Expect = 7.410e-66
Identity = 197/686 (28.72%), Postives = 302/686 (44.02%), Query Frame = 3
Query: 1434 PVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWT---ARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWD-IKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESY---NEIILSCGVTSIFNF-PDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPI---FGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAW-MTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCH-SNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            P +  F   +  V++ L G P  +  P D  +    L    +LPT +LK++WVYG+RGRD   NL LL  GE  YF   VVVL+   +  QRHY  H+ D++CL VH D I IA+ Q      + K      RIW S +L+TL++            I    S     L  +DDS DH+L++WD  K ++LA    S+ +V +  F   D NI VT G  H+ +W    L G    K    +    K +       + + + ITGDS+G + VW  G N ++  ++ AHE  I ALC+ +            +L  +N N   L    +P+  G +R   VA    N  +++IGTT N +LQ  L+                 G    I+QGH  ++  ++ +  +   F+T G D    ++DA     V    I+    +         +A+GT+ GR  + D    +LV  +   NE +      S+  + PD   + +G  D C+      +N        K    S F T +       F+   S D +   WV +             K V ++ T +++ W+   C +   V G W       +  A+C   H+ K +L  G   GK+ ++ +PC    A  H  +  S+ VTNV FL    HLIS  G+D+ I QW +I
Sbjct:  174 PKEPAFSPEEGYVKMFLRGRPVTMYMPKD-QVDSYSLEAKAELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGGHLCAVDDSNDHVLSVWDWQKEERLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWT---LEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRRLISWNGNYQKLHKAEIPEQFGPIR--TVAEGKGN--VILIGTTRNFVLQGTLS-----------------GDFTPITQGHTDELWGLA-IHASKPQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQL------SVMRYSPDGNFLAIGSHDNCIYIYGVTDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSA-----------CKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVC-RAHERK-LLCTGDDFGKVHLFSYPCSQFRAPSHIYSGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI 814          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Mouse
Match: Eml1 (echinoderm microtubule associated protein like 1 [Source:MGI Symbol;Acc:MGI:1915769])

HSP 1 Score: 239.195 bits (609), Expect = 1.869e-65
Identity = 196/679 (28.87%), Postives = 300/679 (44.18%), Query Frame = 3
Query: 1455 KPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWT---ARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWD-IKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESY---NEIILSCGVTSIFNF-PDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPI---FGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAW-MTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCH-SNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            K +  V++ L G P  +  P D  +    L    +LPT +LK++WVYG+RGRD   NL LL  GE  YF   VVVL+   +  QRHY  H+ D++CL VH D I IA+ Q      + K      RIW S +L+TL++            I    S     L  +DDS DH+L++WD  K ++LA    S+ +V +  F   D NI VT G  H+ +W    L G    K    +    K +       + + + ITGDS+G + VW  G N ++  ++ AHE  I ALC+ +            +L  +N N   L    +P+  G +R   VA    N  +++IGTT N +LQ  L+                 G    I+QGH  ++  ++ +  +   F+T G D    ++DA     V    I+    +         +A+GT+ GR  + D    +LV  +   NE +      S+  + PD   + +G  D C+      +N        K    S F T +       F+   S D +   WV +             K V ++ T +++ W+   C +   V G W       +  A+C   H+ K +L  G   GK+ ++ +PC    A  H  +  S+ VTNV FL    HLIS  G+D+ I QW +I
Sbjct:  167 KEEGYVKMFLRGRPVTMYMPKD-QVDSYSLEAKAELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGGHLCAVDDSNDHVLSVWDWQKEERLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWT---LEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRRLISWNGNYQKLHKAEIPEQFGPIR--TVAEGKGN--VILIGTTRNFVLQGTLS-----------------GDFTPITQGHTDELWGLA-IHASKPQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQL------SVMRYSPDGNFLAIGSHDNCIYIYGVTDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSA-----------CKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVC-RAHERK-LLCTGDDFGKVHLFSYPCSQFRAPSHIYSGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI 800          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Mouse
Match: Eml2 (echinoderm microtubule associated protein like 2 [Source:MGI Symbol;Acc:MGI:1919455])

HSP 1 Score: 227.254 bits (578), Expect = 1.428e-62
Identity = 182/682 (26.69%), Postives = 303/682 (44.43%), Query Frame = 3
Query: 1431 KPVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWT---ARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWD-IKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESY---NEIILSCGVTSIFNF-PDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCHSNIA-SNPVTNVLFLNSGDHLISVSGQDSCITQWEI 3449
            K  + +F   + +V++ L G P  +L P +L+     L    +LP+ +LK+DWVYG+RGRD   NL LL  GE+ YF   V VL++  +  QRHY  H+ DI+CL VH D + IA+ Q        K      R+W S SLSTL++    +       +    S   N L  +D+S DH+L++WD  K  K+  +  S+ +VL  +F   D ++ +T G  HI +W    L G   +K    +    K +           +++TGDS G +YVW  G N +T  ++ AH+  + ALC  +            ++ L+  +   +  + +P+D G VR      +      L +GTT NSIL   + TG  +L                  QGH  ++  ++   +    F+T G+D  + ++ ++    V    I+    +         +A+GT+ GR ++LD    +LV  +   NE I      S+ +F PD   + +G  D  +   T ++         K    S F   I  +D+ Q    D   ++  S  +   + ++    K + +  T++NV W+   C +   V G W       +       H  K +L      GK+ ++ +PC    A  H     S+ VTNV FL      ++  G+D+ + QW +
Sbjct:    8 KTKEVIFSMEEGSVKMFLRGRPVPMLIPDELA-PTYSLDTRSELPSSRLKLDWVYGYRGRDCRANLYLLPTGEVVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAVHPDMVTIATGQVAGTTKEGKPLPPHVRVWDSVSLSTLHVLGLGVFDRAVCCVAFSKSNGGNLLCAVDESNDHVLSVWDWAKESKVVDSKCSNEAVLVATFHPTDPSLLITCGKSHIYFWS---LEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQEVQGAHDGGVFALCALRDGTLVSGGGRDRRVVLWGSDYSKVQEVEVPEDFGPVR----TVAEGRGDTLYVGTTRNSILLGSVHTGFSLL-----------------VQGHVEELWGLATHPSRAQ-FVTCGQDKLVHLWSSETHQPVWSRSIEDPARSAGFHPSGSVLAVGTVTGRWLLLDTETHDLVAIHTDGNEQI------SVVSFSPDGAYLAVGSHDNLVYVYTVDQGGRKVSRLGKCSGHSSF---ITHLDWAQ----DSTCFVTNSGDY-EILYWDPVTCKQITSADTVRNVEWATATCVLGFGVFGIWPEGADGTDINAVARSHDGK-LLVSADDFGKVHLFSYPCCQPRALSHKYGGHSSHVTNVAFLWDDSMALTTGGKDTSVLQWRV 648          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Mouse
Match: Eml2 (echinoderm microtubule associated protein like 2 [Source:MGI Symbol;Acc:MGI:1919455])

HSP 1 Score: 229.565 bits (584), Expect = 5.193e-62
Identity = 182/682 (26.69%), Postives = 304/682 (44.57%), Query Frame = 3
Query: 1431 KPVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWT---ARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWD-IKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESY---NEIILSCGVTSIFNF-PDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCHSNIA-SNPVTNVLFLNSGDHLISVSGQDSCITQWEI 3449
            K  + +F   + +V++ L G P  +L P +L+ +   L    +LP+ +LK+DWVYG+RGRD   NL LL  GE+ YF   V VL++  +  QRHY  H+ DI+CL VH D + IA+ Q        K      R+W S SLSTL++    +       +    S   N L  +D+S DH+L++WD  K  K+  +  S+ +VL  +F   D ++ +T G  HI +W    L G   +K    +    K +           +++TGDS G +YVW  G N +T  ++ AH+  + ALC  +            ++ L+  +   +  + +P+D G VR      +      L +GTT NSIL   + TG  +L                  QGH  ++  ++   +    F+T G+D  + ++ ++    V    I+    +         +A+GT+ GR ++LD    +LV  +   NE I      S+ +F PD   + +G  D  +   T ++         K    S F   I  +D+ Q    D   ++  S  +   + ++    K + +  T++NV W+   C +   V G W       +       H  K +L      GK+ ++ +PC    A  H     S+ VTNV FL      ++  G+D+ + QW +
Sbjct:  200 KTKEVIFSMEEGSVKMFLRGRPVPMLIPDELAPT-YSLDTRSELPSSRLKLDWVYGYRGRDCRANLYLLPTGEVVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAVHPDMVTIATGQVAGTTKEGKPLPPHVRVWDSVSLSTLHVLGLGVFDRAVCCVAFSKSNGGNLLCAVDESNDHVLSVWDWAKESKVVDSKCSNEAVLVATFHPTDPSLLITCGKSHIYFWS---LEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQEVQGAHDGGVFALCALRDGTLVSGGGRDRRVVLWGSDYSKVQEVEVPEDFGPVR----TVAEGRGDTLYVGTTRNSILLGSVHTGFSLL-----------------VQGHVEELWGLATHPSRAQ-FVTCGQDKLVHLWSSETHQPVWSRSIEDPARSAGFHPSGSVLAVGTVTGRWLLLDTETHDLVAIHTDGNEQI------SVVSFSPDGAYLAVGSHDNLVYVYTVDQGGRKVSRLGKCSGHSSF---ITHLDWAQ----DSTCFVTNSGDY-EILYWDPVTCKQITSADTVRNVEWATATCVLGFGVFGIWPEGADGTDINAVARSHDGK-LLVSADDFGKVHLFSYPCCQPRALSHKYGGHSSHVTNVAFLWDDSMALTTGGKDTSVLQWRV 840          
BLAST of Echinoderm microtubule associated protein like 1 vs. UniProt/SwissProt
Match: sp|O00423|EMAL1_HUMAN (Echinoderm microtubule-associated protein-like 1 OS=Homo sapiens OX=9606 GN=EML1 PE=1 SV=3)

HSP 1 Score: 241.506 bits (615), Expect = 2.866e-65
Identity = 195/686 (28.43%), Postives = 304/686 (44.31%), Query Frame = 3
Query: 1434 PVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWT---ARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWD-IKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESY---NEIILSCGVTSIFNF-PDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPI---FGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAW-MTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCH-SNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            P + +F   +  V++ L G P  +  P D  +    L    +LPT +LK++WVYG+RGRD   NL LL  GE  YF   VVVL+   +  QRHY  H+ D++CL VH D I IA+ Q      + K      RIW S +L+TL++            I    S     L  +DDS DH+L++WD  K +KLA    S+ +V +  F   D NI VT G  H+ +W    L G    K    +    K +       + + + ITGDS+G + VW  G N ++  ++ AHE  I ALC+ +            KL  ++ N   L    +P+  G +R      +     +++IGTT N +LQ  L+                 G    I+QGH  ++  ++ +  + + F+T G D    ++DA     V    I+    +         +A+GT+ GR  + D    +LV  +   NE +      S+  + PD   + +G  D C+     ++N        K    S F T +       F+   S D +   WV +             K V ++ T +++ W+   C +   V G W       +  A+C   H+ K++L+ G   GK+ ++ +PC    A  H     S+ VTNV FL    HLIS  G+D+ I QW +I
Sbjct:  175 PKEPVFSAEEGYVKMFLRGRPVTMYMPKD-QVDSYSLEAKVELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGTNLCAVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWT---LEGSSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRKLISWSGNYQKLRKTEIPEQFGPIR----TVAEGKGDVILIGTTRNFVLQGTLS-----------------GDFTPITQGHTDELWGLA-IHASKSQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQL------SVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSA-----------CKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVC-RAHE-KKLLSTGDDFGKVHLFSYPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI 815          
BLAST of Echinoderm microtubule associated protein like 1 vs. UniProt/SwissProt
Match: sp|Q4V8C3|EMAL1_RAT (Echinoderm microtubule-associated protein-like 1 OS=Rattus norvegicus OX=10116 GN=Eml1 PE=1 SV=2)

HSP 1 Score: 241.121 bits (614), Expect = 3.250e-65
Identity = 196/686 (28.57%), Postives = 305/686 (44.46%), Query Frame = 3
Query: 1434 PVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWT---ARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWD-IKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESY---NEIILSCGVTSIFNF-PDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPI---FGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAW-MTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCH-SNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            P +  F   +  V++ L G P  +  P D  +    L    +LPT +LK++WVYG+RGRD   NL LL  GE  YF   VVVL+   +  QRHY  H+ D++CL VH D I IA+ Q      + K      RIW S +L+TL++            I    S   + L  +DDS DH+L++WD  + ++LA    S+ +V +  F   D NI VT G  H+ +W    L G    K    +    K +       + + + ITGDS+G + VW  G N ++  ++ AHE  I ALC+ +            +L  +N N   L    +P+  G +R   VA    N  +++IGTT N +LQ  L                  G    I+QGH  ++  ++ +  +   F+T G D    ++DA     V    I+    +         +A+GT+ GR  + D    +LV  +   NE +      S+  + PD   + +G  D C+     ++N        K    S F T +       F+   S D +   WV +             K V ++ T +++ W+   C +   V G W       +  A+C   H+ K++L+ G   GK+ ++ +PC    A  H  +  S+ VTNV FL    HLIS  G+D+ I QW +I
Sbjct:  174 PKEPTFSPEEGYVKMFLRGRPVTMYMPKD-QVDSYSLEAKAELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGSHLCAVDDSNDHVLSVWDWQREERLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWT---LEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRRLISWNGNYQKLHKAEIPEQFGPIR--TVAEGKGN--VILIGTTRNFVLQGTLT-----------------GDFTPITQGHTDELWGLA-IHASKPQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQL------SVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSA-----------CKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVC-RAHE-KKLLSTGDDFGKVHLFSYPCSQFRAPSHIYSGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI 814          
BLAST of Echinoderm microtubule associated protein like 1 vs. UniProt/SwissProt
Match: sp|Q05BC3|EMAL1_MOUSE (Echinoderm microtubule-associated protein-like 1 OS=Mus musculus OX=10090 GN=Eml1 PE=1 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 5.183e-65
Identity = 197/686 (28.72%), Postives = 302/686 (44.02%), Query Frame = 3
Query: 1434 PVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWT---ARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWD-IKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESY---NEIILSCGVTSIFNF-PDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPI---FGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAW-MTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCH-SNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            P +  F   +  V++ L G P  +  P D  +    L    +LPT +LK++WVYG+RGRD   NL LL  GE  YF   VVVL+   +  QRHY  H+ D++CL VH D I IA+ Q      + K      RIW S +L+TL++            I    S     L  +DDS DH+L++WD  K ++LA    S+ +V +  F   D NI VT G  H+ +W    L G    K    +    K +       + + + ITGDS+G + VW  G N ++  ++ AHE  I ALC+ +            +L  +N N   L    +P+  G +R   VA    N  +++IGTT N +LQ  L+                 G    I+QGH  ++  ++ +  +   F+T G D    ++DA     V    I+    +         +A+GT+ GR  + D    +LV  +   NE +      S+  + PD   + +G  D C+      +N        K    S F T +       F+   S D +   WV +             K V ++ T +++ W+   C +   V G W       +  A+C   H+ K +L  G   GK+ ++ +PC    A  H  +  S+ VTNV FL    HLIS  G+D+ I QW +I
Sbjct:  174 PKEPAFSPEEGYVKMFLRGRPVTMYMPKD-QVDSYSLEAKAELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGGHLCAVDDSNDHVLSVWDWQKEERLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWT---LEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRRLISWNGNYQKLHKAEIPEQFGPIR--TVAEGKGN--VILIGTTRNFVLQGTLS-----------------GDFTPITQGHTDELWGLA-IHASKPQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQL------SVMRYSPDGNFLAIGSHDNCIYIYGVTDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSA-----------CKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVC-RAHERK-LLCTGDDFGKVHLFSYPCSQFRAPSHIYSGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI 814          
BLAST of Echinoderm microtubule associated protein like 1 vs. UniProt/SwissProt
Match: sp|Q7TNG5|EMAL2_MOUSE (Echinoderm microtubule-associated protein-like 2 OS=Mus musculus OX=10090 GN=Eml2 PE=1 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 9.992e-62
Identity = 182/682 (26.69%), Postives = 303/682 (44.43%), Query Frame = 3
Query: 1431 KPVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWT---ARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWD-IKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESY---NEIILSCGVTSIFNF-PDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCHSNIA-SNPVTNVLFLNSGDHLISVSGQDSCITQWEI 3449
            K  + +F   + +V++ L G P  +L P +L+     L    +LP+ +LK+DWVYG+RGRD   NL LL  GE+ YF   V VL++  +  QRHY  H+ DI+CL VH D + IA+ Q        K      R+W S SLSTL++    +       +    S   N L  +D+S DH+L++WD  K  K+  +  S+ +VL  +F   D ++ +T G  HI +W    L G   +K    +    K +           +++TGDS G +YVW  G N +T  ++ AH+  + ALC  +            ++ L+  +   +  + +P+D G VR      +      L +GTT NSIL   + TG  +L                  QGH  ++  ++   +    F+T G+D  + ++ ++    V    I+    +         +A+GT+ GR ++LD    +LV  +   NE I      S+ +F PD   + +G  D  +   T ++         K    S F   I  +D+ Q    D   ++  S  +   + ++    K + +  T++NV W+   C +   V G W       +       H  K +L      GK+ ++ +PC    A  H     S+ VTNV FL      ++  G+D+ + QW +
Sbjct:    8 KTKEVIFSMEEGSVKMFLRGRPVPMLIPDELA-PTYSLDTRSELPSSRLKLDWVYGYRGRDCRANLYLLPTGEVVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAVHPDMVTIATGQVAGTTKEGKPLPPHVRVWDSVSLSTLHVLGLGVFDRAVCCVAFSKSNGGNLLCAVDESNDHVLSVWDWAKESKVVDSKCSNEAVLVATFHPTDPSLLITCGKSHIYFWS---LEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQEVQGAHDGGVFALCALRDGTLVSGGGRDRRVVLWGSDYSKVQEVEVPEDFGPVR----TVAEGRGDTLYVGTTRNSILLGSVHTGFSLL-----------------VQGHVEELWGLATHPSRAQ-FVTCGQDKLVHLWSSETHQPVWSRSIEDPARSAGFHPSGSVLAVGTVTGRWLLLDTETHDLVAIHTDGNEQI------SVVSFSPDGAYLAVGSHDNLVYVYTVDQGGRKVSRLGKCSGHSSF---ITHLDWAQ----DSTCFVTNSGDY-EILYWDPVTCKQITSADTVRNVEWATATCVLGFGVFGIWPEGADGTDINAVARSHDGK-LLVSADDFGKVHLFSYPCCQPRALSHKYGGHSSHVTNVAFLWDDSMALTTGGKDTSVLQWRV 648          
BLAST of Echinoderm microtubule associated protein like 1 vs. UniProt/SwissProt
Match: sp|Q6P6T4|EMAL2_RAT (Echinoderm microtubule-associated protein-like 2 OS=Rattus norvegicus OX=10116 GN=Eml2 PE=1 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 3.339e-61
Identity = 181/682 (26.54%), Postives = 302/682 (44.28%), Query Frame = 3
Query: 1431 KPVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWT---ARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWD-IKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESY---NEIILSCGVTSIFNF-PDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCHSNIA-SNPVTNVLFLNSGDHLISVSGQDSCITQWEI 3449
            K  + +F   + +V++ L G P  +L P +L+     L    +LP+ +LK+DWVYG+RGRD   NL LL  GE+ YF   V VL++  +  QRHY  H+ DI+CL VH D + IA+ Q        K      R+W S SLSTL++    +       +    S   N L  +D+S DH+L++WD  K  K+  +  S+ +VL  +F   D N+ +T G  HI +W    L G   +K    +    K +           +++TGDS G +YVW  G N +T  +  AH+  + ALC  +            ++ L+  +   +  + +P+D G VR      +      L +GTT NSIL   + TG  +L                  QGH  ++  ++   +    F++ G+D  + ++ ++    V    I+    +         +A+GT+ GR ++LD    +LV  +   NE I      S+ +F PD   + +G  D  +   T ++         K    S F T    +D+ Q    D   ++  S  +   + ++    K + +  T++NV W+   C +   V G W       +       H    +L      GK+ ++ +PC    A  H     S+ VTNV FL     +++  G+D+ + QW +
Sbjct:    8 KTKEVIFSMEEGSVKMFLRGRPVPMLIPDELA-PTYSLDTRSELPSSRLKLDWVYGYRGRDCRANLYLLPTGEVVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAVHPDMVTIATGQVAGTTKEGKPLPPHVRVWDSVSLSTLHVLGLGVFDRAVCCVAFSKSNGGNLLCAVDESNDHVLSVWDWAKESKVVDSKCSNEAVLVATFHPTDPNLLITCGKSHIYFWS---LEGGNLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQEVLGAHDGGVFALCALRDGTLVSGGGRDRRVVLWGSDYSKVQEVEVPEDFGPVR----TVAEGRGDTLYVGTTRNSILLGSVHTGFSLL-----------------VQGHVEELWGLATHPSRAQ-FVSCGQDKLVHLWSSETHQPVWSRSIEDPARSAGFHPSGSVLAVGTVTGRWLLLDTDTRDLVAIHTDGNEQI------SVVSFSPDGAYLAVGSHDNLVYVYTVDQGGRKVSRLGKCSGHSSFITH---LDWAQ----DSTCFVTNSGDY-EILYWDAATCKQITSADTVRNVQWATATCVLGFGVFGIWPEGADGTDINAVARSHD-GNLLVSADDFGKVHLFSYPCCQPRALSHKYGGHSSHVTNVAFLWDDSMVLTTGGKDTSVLQWRV 648          
BLAST of Echinoderm microtubule associated protein like 1 vs. TrEMBL
Match: A0A1S3JXG1 (echinoderm microtubule-associated protein-like 4 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106177030 PE=4 SV=1)

HSP 1 Score: 332.028 bits (850), Expect = 1.635e-90
Identity = 215/691 (31.11%), Postives = 341/691 (49.35%), Query Frame = 3
Query: 1476 LELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTARIWRSDSLSTLYI---------------------FQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIK-GQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQV--STNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDS---IALGTIEGRCIILD-QHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDG--CLVTLTRNE--NYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCHSNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            + + G   KL  P D+ L K    ++ D P  +LK++WVYG+RG D   N+ + S GE+ YF G + VL+    ++QRHY EH+ DI+C+ +H++G+ +A+ Q+  +  N     RIWR D+L TL++                       + +DSN    I       ++ L+ +DDS +H++++WD+  G++LA      + +  + F+  D  I VT G EHI WW+     G I+     +Y    KAR     +  +  +L+TGDSNGT+YVW  G N +TNYIKHAHE  + +L   +  L +G   G +  W +NKN+D  G + LP+ EGG+R + V         L+ GTT N+I+   +A+    L              I ++QGH+  +  +S V  S +  WF+TAG D  +C+FDA  R G+ K  +K    TCV   V  S   + LGT +G  I+L+    +NL E +   +    +  I   PD   I +   +    L+ +  NE  N   E  G  K + S     I G+D+     ++G + L  S        ++   ++ +  + T++NV W   QC +   V G W +    E   +   V+    IL MG   G+++++R PC     + H+  A   V  V F     H+ISV G+D+C+ QW+II
Sbjct:  811 MNIKGKDTKLYIP-DVYLGK---QHAIDPPKERLKLEWVYGYRGNDCRSNIHITSAGEILYFVGPISVLYNNESHSQRHYREHTEDIKCMALHSNGVTVATGQESSKQENNAHI-RIWRCDTLQTLHVCGMGFFEKSVVCMAFTRIKKSHGDSMDSNSQFKI-------QDRLVAVDDSAEHVMSIWDVSLGKRLAHVLIGVDVICDVGFNPRDPAILVTIGREHIAWWKAYVEGGMIEMNGNPNYEKHNKARFIICMMHNDKGDLVTGDSNGTIYVWGYGGNVITNYIKHAHEGPVFSLLSLRGTLLSGGRDGKLCAWAWNKNMDTAGEMKLPRTEGGLRMIQVCGDR-----LLCGTTMNAIVSAKMASQGPPLSDLTPE-------PIPLTQGHFDDLRGLSVVHNSEHSGWFLTAGYDGILCLFDAQTRRGLWKAYLKNTHVTCVD--VSHSGNLLTLGTKDGGVILLEFSSSMNLNEQHRIKLNKHRIDKIAFAPDCSMIAVASHNSPLHLIQVDVNEMMNRQLEVVGEFKGHMS----SITGLDW-SVEKVEGSWILRSSCCDHTAKFWDTNLLQEITEIKTLRNVDWGSMQCTLDYTVAGVWKSKQAQEADIMSLDVNAATNILVMGDGSGRLSLFRHPCSQDGGFSHTYRAHRCVYGVKFTADNSHVISVGGRDTCVLQWKII 1470          

HSP 2 Score: 110.153 bits (274), Expect = 2.088e-20
Identity = 88/269 (32.71%), Postives = 140/269 (52.04%), Query Frame = 3
Query:  294 KLRMIAKFSKLSSADGKSKDEEEQFAEEGSQNEDEDKKNEE---YSLHHQLIPALKEVSRQKLRSLRMALRKIHSSSEDGLVTINEAVQTIIDLKFNLPSRLLDILVLXXXXXXXXXXXXXXXSYFEK-------AHSLTGRXXXXXXXXXXXXXGLRVQSEIT----DAELFKRAELQLVKSREPFDLEKFRNVLKKMDTSHSGILKKLEIEKVANEFYCPIYGSLLHSVLSKSDQTKNNDIRWPEFINFLEKVYKSVVEKDSEFLEK 1058
            K R   + ++LS   G S      F EE    ED  K  EE     LH  L   LKE SRQ+LR+++M+LRK  S+ E   VT  E  Q + +    +P+R+  +LV     ++           FEK       A S TGRDS+ AI+        + QS++T    DA+L +R E Q+ +  E FD E+ +   +  D++ +G + K ++ ++      PIYG+LL+ ++++ D  KN  I WPE I+FLE+ ++++VEK  + L++
Sbjct:   75 KTRRTPRATELSLG-GNSIASFSAFQEE----EDRGKVTEEDPEIHLHSMLRGPLKECSRQRLRAVQMSLRKYGSNVE-SRVTSKELFQVLQENNLKIPNRVFQMLVERFTDQKGID--------FEKLYKCLVTAQSKTGRDSVIAINTRNDLDVDKCQSQLTQEEKDADLLRRLEEQMERGGEYFDAEELKQSFQTQDSNRTGKIAKKQMLEICLNHQIPIYGALLNGIMNRCDDEKNEMISWPEMISFLERSWQNLVEKKPQVLKR 329          
BLAST of Echinoderm microtubule associated protein like 1 vs. TrEMBL
Match: A0A1S3JYH3 (echinoderm microtubule-associated protein-like 4 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106177030 PE=4 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 2.402e-90
Identity = 215/691 (31.11%), Postives = 341/691 (49.35%), Query Frame = 3
Query: 1476 LELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTARIWRSDSLSTLYI---------------------FQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIK-GQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQV--STNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDS---IALGTIEGRCIILD-QHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDG--CLVTLTRNE--NYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCHSNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            + + G   KL  P D+ L K    ++ D P  +LK++WVYG+RG D   N+ + S GE+ YF G + VL+    ++QRHY EH+ DI+C+ +H++G+ +A+ Q+  +  N     RIWR D+L TL++                       + +DSN    I       ++ L+ +DDS +H++++WD+  G++LA      + +  + F+  D  I VT G EHI WW+     G I+     +Y    KAR     +  +  +L+TGDSNGT+YVW  G N +TNYIKHAHE  + +L   +  L +G   G +  W +NKN+D  G + LP+ EGG+R + V         L+ GTT N+I+   +A+    L              I ++QGH+  +  +S V  S +  WF+TAG D  +C+FDA  R G+ K  +K    TCV   V  S   + LGT +G  I+L+    +NL E +   +    +  I   PD   I +   +    L+ +  NE  N   E  G  K + S     I G+D+     ++G + L  S        ++   ++ +  + T++NV W   QC +   V G W +    E   +   V+    IL MG   G+++++R PC     + H+  A   V  V F     H+ISV G+D+C+ QW+II
Sbjct:  828 MNIKGKDTKLYIP-DVYLGK---QHAIDPPKERLKLEWVYGYRGNDCRSNIHITSAGEILYFVGPISVLYNNESHSQRHYREHTEDIKCMALHSNGVTVATGQESSKQENNAHI-RIWRCDTLQTLHVCGMGFFEKSVVCMAFTRIKKSHGDSMDSNSQFKI-------QDRLVAVDDSAEHVMSIWDVSLGKRLAHVLIGVDVICDVGFNPRDPAILVTIGREHIAWWKAYVEGGMIEMNGNPNYEKHNKARFIICMMHNDKGDLVTGDSNGTIYVWGYGGNVITNYIKHAHEGPVFSLLSLRGTLLSGGRDGKLCAWAWNKNMDTAGEMKLPRTEGGLRMIQVCGDR-----LLCGTTMNAIVSAKMASQGPPLSDLTPE-------PIPLTQGHFDDLRGLSVVHNSEHSGWFLTAGYDGILCLFDAQTRRGLWKAYLKNTHVTCVD--VSHSGNLLTLGTKDGGVILLEFSSSMNLNEQHRIKLNKHRIDKIAFAPDCSMIAVASHNSPLHLIQVDVNEMMNRQLEVVGEFKGHMS----SITGLDW-SVEKVEGSWILRSSCCDHTAKFWDTNLLQEITEIKTLRNVDWGSMQCTLDYTVAGVWKSKQAQEADIMSLDVNAATNILVMGDGSGRLSLFRHPCSQDGGFSHTYRAHRCVYGVKFTADNSHVISVGGRDTCVLQWKII 1487          

HSP 2 Score: 109.768 bits (273), Expect = 2.640e-20
Identity = 78/239 (32.64%), Postives = 131/239 (54.81%), Query Frame = 3
Query:  390 EDEDK-----KNEEYSLHHQLIPALKEVSRQKLRSLRMALRKIHSSSEDGLVTINEAVQTIIDLKFNLPSRLLDILVLXXXXXXXXXXXXXXXSYFEK-------AHSLTGRXXXXXXXXXXXXXGLRVQSEIT----DAELFKRAELQLVKSREPFDLEKFRNVLKKMDTSHSGILKKLEIEKVANEFYCPIYGSLLHSVLSKSDQTKNNDIRWPEFINFLEKVYKSVVEKDSEFLEK 1058
            E+ED+     ++ E  LH  L   LKE SRQ+LR+++M+LRK  S+ E   VT  E  Q + +    +P+R+  +LV     ++           FEK       A S TGRDS+ AI+        + QS++T    DA+L +R E Q+ +  E FD E+ +   +  D++ +G + K ++ ++      PIYG+LL+ ++++ D  KN  I WPE I+FLE+ ++++VEK  + L++
Sbjct:  100 EEEDRGKVTEEDPEIHLHSMLRGPLKECSRQRLRAVQMSLRKYGSNVE-SRVTSKELFQVLQENNLKIPNRVFQMLVERFTDQKGID--------FEKLYKCLVTAQSKTGRDSVIAINTRNDLDVDKCQSQLTQEEKDADLLRRLEEQMERGGEYFDAEELKQSFQTQDSNRTGKIAKKQMLEICLNHQIPIYGALLNGIMNRCDDEKNEMISWPEMISFLERSWQNLVEKKPQVLKR 329          
BLAST of Echinoderm microtubule associated protein like 1 vs. TrEMBL
Match: A0A1I8IK32 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 1.451e-79
Identity = 161/473 (34.04%), Postives = 248/473 (52.43%), Query Frame = 3
Query: 2049 DENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDP-EEDGS-KKWNSS----IFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCHSNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEI 3449
            D N+FVT G +H +WWE+   +G I  K   +Y+ F KAR   + L     +L+TGDSNG VYVW  G N +TNYIKHAHE  + +LC+Y+ +L TG     ++ W + +N+D +  + LP  EG  R  + A   +    LI+GTT NS+L   L   +  L P E V FG     + I+QGHY Q+ ++S V  +++ FITAG DSQ+C+F+AD    VQKT +K    T  SW    +I  GT  G  IIL +   NLVE +   I  C V++I      + + +GG DG +  L     + P EED + + W  +      +  +  +DF +   +D    +  +N  G     +  +  ++ +   +++V W           +GAW +    E       V   +E+LA+G   G I +Y++PC   +AYCH+ +    +T + F + G HLIS+ G+D+C+ QW +
Sbjct:    1 DPNLFVTVGKDHTVWWEYSEALGAINIKAAGEYQTFFKARYVVSLLHNRQGDLVTGDSNGNVYVWGGGGNLITNYIKHAHEGPVFSLCLYRGWLLTGGHDSALRCWQWGRNMDRVSELRLPVTEGAPR-CIRAHRGAEVDRLIVGTTANSMLDCPLCP-EPGLAPLEGVAFG----DVPITQGHYDQLQSLSLVPGHESLFITAGYDSQVCIFNADNHSSVQKTVLKKKCITYASWDESSTIIFGTRNGEIIILYEENSNLVELFKSSIAYCKVSAIAMSHTKETVAVGGSDGRVHFL----RFLPTEEDPTVRAWQPAGQLLATRHGVDALDFAE-DFIDESLIVCATNTSGERAICDATNFCLLEDEEKVRDVRWKTHNFLFAYYNVGAWNSKSSQESSITSVDVCIERELLAVGLNNGHILLYKYPCTKSDAYCHTFVGPTKITALKFTSDGRHLISIGGRDACVMQWRL 462          
BLAST of Echinoderm microtubule associated protein like 1 vs. TrEMBL
Match: A0A2T7PS68 (WD_REPEATS_REGION domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_03204 PE=4 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 8.088e-77
Identity = 191/670 (28.51%), Postives = 328/670 (48.96%), Query Frame = 3
Query: 1527 LSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQ-KELQVSNYKWTARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIKGQK---LASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGF-------LKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTN--DNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSW-LVDDSIALGTIEGRCIILDQH--EINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSL----------DGKYYLWVSNKFGGFVAY--EIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCHSNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            L  +++P   D P  +L+++WVYG RG D   N+ +L++GEL YF   +V++     + QRHY EHS D++C+ VH DG+ +A+ Q   +     K   R+WRSD L T+++    + S     + + FSP     +    +  H L +  I       + S  S  N +  + F+   ENI VT G EH+ WW   P    +    + DY  F       L+A+       T+  +LITGDSNGTVY+WA+G N +TN+IKH H+  +L+L   +  L TG   G ++ W ++KN+++   +M+P  EGG+R+++V     ++  L+I TT NS+L + +A       P +   F        ++QGH+  +  V+ + ++      +TAG D  +C F ++ R  V K  +KG +F CV      + +ALGT +G  ++L     ++ +VE  N+ + +  +  I   PD K +  G  D   + L R  ++D   DG   W      + + G     GG +          +G + L   + F G       +  ++I  N   + +  W+   C +   + G   +            V+ ++ ++A+G  +G + +YR+PC+    +CH+    + V  V F  SG  ++++ GQDS + QW+I+
Sbjct:   15 LKALDIP--VDPPNERLQLEWVYGCRGNDCRRNVHVLASGELTYFLSNIVIMLDCTNHVQRHYKEHSEDVKCMAVHKDGVTVATGQFASINRPENKAHIRLWRSDLLLTVHVLGADVFSK--AVMCVAFSPHA---VSCCGTPSHPLVITYIPATLSLIVVSQMSQINEMCDMDFNPKHENILVTCGKEHLAWWRVFPDAQRLSVSALPDYETFSIRLQKSLRAKYIVCLSHTDKGDLITGDSNGTVYIWADGGNKITNFIKHGHDGPVLSLLFCRQHLLTGGRDGQLRSWAWSKNMNHANNLMMPACEGGLRYMMV-----HEDSLVISTTMNSLLSVKMAPRGC---PLDKATFD----QTPVTQGHFDDVYGVAVIPSSVLKADVLTAGVDGVLCKFSSELRRPVWKLYLKGMEFLCVDCSSTGEHMALGTKDGHVVVLRLQVSDMTVVEVINQKVTADRLDCIKLSPDGKWLAAGSHDTA-IYLFRLTSHD---DGDVSWE---MYSKLKG----HGGRVTALDWSHENKNGSFLLRSCSSFSGEQKMWNTLTSIEIPLNDVDLDSFTWATNTCSVDHLLTGVVRSFQGSAPHITAVDVNPSQTLVAVGNNQGSLCLYRYPCVRTGIFCHTYRCHHVVAAVRFSPSGSSILTLGGQDSTLLQWKIV 654          
BLAST of Echinoderm microtubule associated protein like 1 vs. TrEMBL
Match: A0A5A9NQL1 (Echinoderm microtubule-associated protein-like 1 OS=Triplophysa tibetana OX=1572043 GN=E1301_Tti002643 PE=4 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 6.605e-72
Identity = 225/775 (29.03%), Postives = 352/775 (45.42%), Query Frame = 3
Query: 1173 GALSTEKESIKPSNIARKPSDDSPTEKPTVTKSQPXXXXXXXXXXXXXXXXXXXXXXXAVDTTPRKSGNKKVVTNTPAIPKPEIVIKPVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTA---RIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIKGQ-KLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFL----KARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESY---NEIILSCGVTSIFNF-PDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHM-KIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPL-MLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCH-SNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            G +   K  I PS  + K  + SP  K TV ++  ++++  + +      K  ++      +T   S  KK   N           K  + +F   +  V++ L G P  +  P DL +    L    DL   KLK+DWVYG+RGRD   NL LL  GE  YF   VVVLF   +  QRHY  H+ DI+CL VH D I IA+ Q     S+ K  A   R+W S SL+TL++            +    S   NWL V+DDS DHIL++WD + Q + A   SS+ SV +  F   D NI VT G  H+ +W        ++   +   +G      K +       + + + ITGDS+G + VW  G+N ++  I+ AHE+ + ALC+ ++       K   KL  +++N   +  + +P+  G +R      +     ++IIGTT N +LQ  L                 DG  I I+QGH  ++  ++ V    + F+T G D  +C++D+D    +    ++    +        ++A+GT+ GR ++LD    +LV  +   NE +      S+  F PD   + +G  D  +      EN        K    S F   I  +D+    S++ +Y   VSN     + Y I  + K V ++ T +++ W+   C +   V G W       +  A+C S    K +L  G   GK+ ++ FPC    A  H     S+ VTNV FL    H++S  G+D  I QW ++
Sbjct:  100 GTVLPRKSGILPSPSSSKKGNSSPATKSTVKRTSSSEHVGPNSRKDSFDSKTNRTH---AGSTGSNSSGKKATDN-----------KQREPVFSADEGYVKMYLKGRPITMYMPKDL-VDTYCLEAKTDLSPKKLKLDWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLFNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSDGKQLAPHVRVWDSVSLNTLHVLGTGFFDRALVCLSFSKSNGGNWLCVVDDSNDHILSVWDWQKQERTAEVKSSNESVFAADFHPTDANIVVTCGKSHLCFW-------SLEKGSLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRISLAIQGAHESSVFALCMLRNGTLVSGGKDR-KLISWDENHQKIQTVEVPEIYGPIR----TIAEGKGEMIIIGTTKNYVLQGSL-----------------DGEFIPITQGHIDELWGLT-VHPQKHQFLTCGHDKHVCLWDSDSHQPIWTKTMEDAAQSAGFHPTGATVAIGTLTGRWLVLDTETKDLVTVHTDGNEQL------SVMRFSPDGNFLAIGSHDNYIYIYAVGENGKKYSRVGKCSGHSSF---ITHLDW----SVNSQYL--VSNSGDYEILYWIPSVCKQVVSVETTRDIEWATFTCTLGFLVFGLWPDGSDGTDINAVCSS--NEKRLLITGDDFGKVHLFSFPCSQSRAPSHVYGGHSSHVTNVNFLFDDSHVVSTGGKDMSIMQWRVV 812          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Cavefish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 263.462 bits (672), Expect = 1.324e-73
Identity = 206/690 (29.86%), Postives = 327/690 (47.39%), Query Frame = 3
Query: 1431 KPVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTA---RIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWD-IKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFL----KARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKS-FLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESY---NEIILSCGVTSIFNF-PDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHM-KIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPL-MLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCHSNIA-SNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            K  + +F   +  V++ L G P  +  P DL +    L    +LP  KLK++WVYG+RGRD   NL LL  GE  YF   VVVL+   +  QRHY  H+ DI+CL VH D I IA+ Q     S+ K  A   R+W S SL+TL++            +    S   +WL V+DDS DH+L++WD  + ++LA    S+ SV +  F   D N  VT G  H+ +W        ++   +   +G      K +       + + + ITGDS+G + VW  G+N ++  ++ AHE+ +LALC+ ++  L +G     I  W  + N   +  + +P+  G +R      +      ++IGTT N +LQ  L                 DG    I+QGH  ++  ++ V    + F+T G D  +C++D D+   +    ++    +        ++A+GT  GR ++LD    +LV  +   NE I      S+ +F PD   + +G  D  +     +EN        K    S F   I  +D+    S+D +Y   VSN     + Y I  + K V ++ T +++PWS   C +   V G W       +  A+C S ++T+ +LA G   GK+ ++ FPC    A  H     S+ VTNV FL +  HL+S  G+D  + QW ++
Sbjct:  191 KQREPVFSAEEGYVKMYLKGRPITMYLPKDL-VDSYCLEAKAELPVKKLKLEWVYGYRGRDCRSNLYLLPTGETLYFIASVVVLYNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSDGKQLAPHVRVWDSVSLNTLHVLGSGFFDRALVCLSFSKSNGGSWLCVVDDSNDHVLSVWDWQREERLAEVKCSNESVFATDFHPTDANTIVTCGKSHLYFW-------SLEKNSLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRISLAVQAAHESSVLALCMLRNGTLLSGGKDRRITAW--DGNYQKIQTVEIPEVYGPIR----TVAEGRGETVLIGTTKNYVLQGSL-----------------DGEFTPITQGHTDELWGLA-VHPLKHQFLTCGHDKLVCLWDCDQHQPLWTKTMEDAAQSAGFHPSGATVAIGTQTGRWLVLDTETKDLVTMHTDGNEQI------SVMSFSPDGNFLAIGSHDNYIYIYAVSENGRKYSRVGKCSGHSSF---ITHLDW----SVDSQYL--VSNSGDYEILYWIPSVCKQVVSVETTRDIPWSSFTCTLSFHVFGLWPDGSDGTDVNAVCRS-NETR-LLATGDDFGKVHLFSFPCSQSRAPSHMYGGHSSHVTNVHFLFNDSHLVSTGGKDMSVMQWRVV 831          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Cavefish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 263.077 bits (671), Expect = 6.044e-73
Identity = 205/690 (29.71%), Postives = 323/690 (46.81%), Query Frame = 3
Query: 1431 KPVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTA---RIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDI-KGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFL----KARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKS-FLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESY---NEIILSCGVTSIFNF-PDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHM-KIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPL-MLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCHSNIA-SNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            K  + +F   +  V++ L G P  +  P DL +    L    +LP  KLK++WVYG+RGRD   NL LL  GE  YF   VVVL+   +  QRHY  H+ DI+CL VH D I IA+ Q     S+ K  A   R+W S SL+TL++            +    S   +WL V+DDS DH+L++WD  + ++LA    S+ SV +  F   D N  VT G  H+ +W        ++   +   +G      K +       + + + ITGDS+G + VW  G+N ++  ++ AHE+ +LALC+ ++  L +G     I  W  + N   +  + +P+  G +R      +      ++IGTT N +LQ  L                 DG    I+QGH  ++  ++ V    + F+T G D  +C++D D+   +    ++    +        ++A+GT  GR ++LD    +LV  +   NE I      S+ +F PD   + +G  D  +     +EN        K    S F   I  +D+    S+D +Y   VSN     + Y I  + K V ++ T +++PWS   C +   V G W       +  A+C S      +LA G   GK+ ++ FPC    A  H     S+ VTNV FL +  HL+S  G+D  + QW ++
Sbjct:  281 KQREPVFSAEEGYVKMYLKGRPITMYLPKDL-VDSYCLEAKAELPVKKLKLEWVYGYRGRDCRSNLYLLPTGETLYFIASVVVLYNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSDGKQLAPHVRVWDSVSLNTLHVLGSGFFDRALVCLSFSKSNGGSWLCVVDDSNDHVLSVWDWQREERLAEVKCSNESVFATDFHPTDANTIVTCGKSHLYFW-------SLEKNSLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRISLAVQAAHESSVLALCMLRNGTLLSGGKDRRITAW--DGNYQKIQTVEIPEVYGPIR----TVAEGRGETVLIGTTKNYVLQGSL-----------------DGEFTPITQGHTDELWGLA-VHPLKHQFLTCGHDKLVCLWDCDQHQPLWTKTMEDAAQSAGFHPSGATVAIGTQTGRWLVLDTETKDLVTMHTDGNEQI------SVMSFSPDGNFLAIGSHDNYIYIYAVSENGRKYSRVGKCSGHSSF---ITHLDW----SVDSQYL--VSNSGDYEILYWIPSVCKQVVSVETTRDIPWSSFTCTLSFHVFGLWPDGSDGTDVNAVCRS--NETRLLATGDDFGKVHLFSFPCSQSRAPSHMYGGHSSHVTNVHFLFNDSHLVSTGGKDMSVMQWRVV 921          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Cavefish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 262.692 bits (670), Expect = 6.983e-73
Identity = 205/690 (29.71%), Postives = 323/690 (46.81%), Query Frame = 3
Query: 1431 KPVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTA---RIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDI-KGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFL----KARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKS-FLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESY---NEIILSCGVTSIFNF-PDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHM-KIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPL-MLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCHSNIA-SNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            K  + +F   +  V++ L G P  +  P DL +    L    +LP  KLK++WVYG+RGRD   NL LL  GE  YF   VVVL+   +  QRHY  H+ DI+CL VH D I IA+ Q     S+ K  A   R+W S SL+TL++            +    S   +WL V+DDS DH+L++WD  + ++LA    S+ SV +  F   D N  VT G  H+ +W        ++   +   +G      K +       + + + ITGDS+G + VW  G+N ++  ++ AHE+ +LALC+ ++  L +G     I  W  + N   +  + +P+  G +R      +      ++IGTT N +LQ  L                 DG    I+QGH  ++  ++ V    + F+T G D  +C++D D+   +    ++    +        ++A+GT  GR ++LD    +LV  +   NE I      S+ +F PD   + +G  D  +     +EN        K    S F   I  +D+    S+D +Y   VSN     + Y I  + K V ++ T +++PWS   C +   V G W       +  A+C S      +LA G   GK+ ++ FPC    A  H     S+ VTNV FL +  HL+S  G+D  + QW ++
Sbjct:  264 KQREPVFSAEEGYVKMYLKGRPITMYLPKDL-VDSYCLEAKAELPVKKLKLEWVYGYRGRDCRSNLYLLPTGETLYFIASVVVLYNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSDGKQLAPHVRVWDSVSLNTLHVLGSGFFDRALVCLSFSKSNGGSWLCVVDDSNDHVLSVWDWQREERLAEVKCSNESVFATDFHPTDANTIVTCGKSHLYFW-------SLEKNSLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRISLAVQAAHESSVLALCMLRNGTLLSGGKDRRITAW--DGNYQKIQTVEIPEVYGPIR----TVAEGRGETVLIGTTKNYVLQGSL-----------------DGEFTPITQGHTDELWGLA-VHPLKHQFLTCGHDKLVCLWDCDQHQPLWTKTMEDAAQSAGFHPSGATVAIGTQTGRWLVLDTETKDLVTMHTDGNEQI------SVMSFSPDGNFLAIGSHDNYIYIYAVSENGRKYSRVGKCSGHSSF---ITHLDW----SVDSQYL--VSNSGDYEILYWIPSVCKQVVSVETTRDIPWSSFTCTLSFHVFGLWPDGSDGTDVNAVCRS--NETRLLATGDDFGKVHLFSFPCSQSRAPSHMYGGHSSHVTNVHFLFNDSHLVSTGGKDMSVMQWRVV 904          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Cavefish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 258.07 bits (658), Expect = 1.464e-72
Identity = 203/677 (29.99%), Postives = 318/677 (46.97%), Query Frame = 3
Query: 1470 VELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTA---RIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWD-IKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFL----KARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKS-FLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESY---NEIILSCGVTSIFNF-PDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHM-KIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPL-MLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCHSNIA-SNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            V++ L G P  +  P DL +    L    +LP  KLK++WVYG+RGRD   NL LL  GE  YF   VVVL+   +  QRHY  H+ DI+CL VH D I IA+ Q     S+ K  A   R+W S SL+TL++            +    S   +WL V+DDS DH+L++WD  + ++LA    S+ SV +  F   D N  VT G  H+ +W        ++   +   +G      K +       + + + ITGDS+G + VW  G+N ++  ++ AHE+ +LALC+ ++  L +G     I  W  + N   +  + +P+  G +R      +      ++IGTT N +LQ  L                 DG    I+QGH  ++  ++ V    + F+T G D  +C++D D+   +    ++    +        ++A+GT  GR ++LD    +LV  +   NE I      S+ +F PD   + +G  D  +     +EN        K    S F   I  +D+    S+D +Y   VSN     + Y I  + K V ++ T +++PWS   C +   V G W       +  A+C S      +LA G   GK+ ++ FPC    A  H     S+ VTNV FL +  HL+S  G+D  + QW ++
Sbjct:  105 VKMYLKGRPITMYLPKDL-VDSYCLEAKAELPVKKLKLEWVYGYRGRDCRSNLYLLPTGETLYFIASVVVLYNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSDGKQLAPHVRVWDSVSLNTLHVLGSGFFDRALVCLSFSKSNGGSWLCVVDDSNDHVLSVWDWQREERLAEVKCSNESVFATDFHPTDANTIVTCGKSHLYFW-------SLEKNSLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRISLAVQAAHESSVLALCMLRNGTLLSGGKDRRITAW--DGNYQKIQTVEIPEVYGPIR----TVAEGRGETVLIGTTKNYVLQGSL-----------------DGEFTPITQGHTDELWGLA-VHPLKHQFLTCGHDKLVCLWDCDQHQPLWTKTMEDAAQSAGFHPSGATVAIGTQTGRWLVLDTETKDLVTMHTDGNEQI------SVMSFSPDGNFLAIGSHDNYIYIYAVSENGRKYSRVGKCSGHSSF---ITHLDW----SVDSQYL--VSNSGDYEILYWIPSVCKQVVSVETTRDIPWSSFTCTLSFHVFGLWPDGSDGTDVNAVCRS--NETRLLATGDDFGKVHLFSFPCSQSRAPSHMYGGHSSHVTNVHFLFNDSHLVSTGGKDMSVMQWRVV 732          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Cavefish
Match: eml2 (echinoderm microtubule-associated protein-like 2 [Source:NCBI gene;Acc:103040481])

HSP 1 Score: 241.121 bits (614), Expect = 2.044e-67
Identity = 195/676 (28.85%), Postives = 303/676 (44.82%), Query Frame = 3
Query: 1452 EKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTA---RIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIKGQK-LASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESY---NEIILSCGVTSIFNF-PDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPL-MLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCH-SNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEI 3449
             K    V + L G P  +  P  L      L N   LP  KLK+ WVYG+RGRD   NL LL  GE+ YF   VVVL+   +  QRHY  H+ D++CL VH D + IA+ Q      + K  A   R+W S SL+TL+     +       +    S     L  +DD+ DHIL++WD + +K LA    S++SVL   F  ++ N+ VT G  H+ +W      G    K    +    K +         + + ITGDS+G +Y+WA G N ++  +  AHE  I ++CV K            K+ L++        + +P+  G VR L    +   Q  L +GTT N++LQ    +    L P              I QGH  ++  +  V    + F+T G+D Q+ ++D D    +    I+    +         +A+GT+  R ++LD    +L+  +   NEII      S+  + PD   + +G  D  +   +  EN        K    S F T    +D+    S + +Y +  S  +   + +E    K V +   ++N+ W+   C +  +V G W       +  A+C S    + +LA G   GK+ ++ +PC    A  H     S+ VTNV FL+   HLIS  G+D+ I QW +
Sbjct:   13 RKCDGYVRMFLRGRPVTMHIPDQLR-DGYNLDNKVALPERKLKLQWVYGYRGRDCRSNLYLLPTGEIVYFNASVVVLYNVDEQQQRHYLGHNDDVKCLAVHPDMVTIATGQVAGTSKDGKLLAPHVRVWDSVSLNTLHSIGMGVFDRAVTCVAFSKSNGGAHLCAVDDANDHILSVWDWQKEKQLADVKCSNDSVLGAVFHPMEANLIVTCGKSHLNFWTVE---GSTLTKRQGLFEKHEKPKYVLCVAFAENGDAITGDSSGNIYIWAKGGNKISQVVAGAHEGGIFSVCVLKDGRLVSGGGKDRKVVLWDHEYHKQSEMEVPEAHGPVRTL----AEGKQEELFVGTTRNAVLQ---GSFSGTLKP--------------IVQGHTDELWGL-DVHPGADQFVTCGQDKQVHLWDTDSHQPLWSKTIEDPGRSVGFHPSGTVLAVGTMTARWLVLDTDTRDLISMHTDGNEII------SVIKYSPDGAYLAVGSHDNFVYIYSVTENGRKYSRVGKCTGHSSFVTH---LDW----STNSQYIVTNSGDY-EILYWEASSGKHVTSADVVRNLEWATSTCVLGFNVFGIWPDGADGTDINAVCRS--NDRGVLAAGDDFGKVHLFSYPCSQPRAPSHVYGGHSSHVTNVAFLHDNSHLISTGGKDTSILQWAL 646          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001632.1 (pep scaffold:Pmarinus_7.0:GL476536:457691:473572:-1 gene:ENSPMAG00000001473.1 transcript:ENSPMAT00000001632.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 178.333 bits (451), Expect = 7.051e-47
Identity = 165/688 (23.98%), Postives = 290/688 (42.15%), Query Frame = 3
Query: 1431 KPVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYK---WTARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIKGQ-KLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWAN-GANAVTNYIKHAHENYILALCVYKSFLF-TGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILD---QHEINLVESYNEIILSCGVTSIFNF-PDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPI---FGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPL-MLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCHSNIA-SNPVTNVLFLNSGDHLISVSGQDSCITQWEI 3449
            K  +  F K    V + L G P  +  P D ++   ++    +LP  KL ++W YG+RG+D   N+ LL +GEL +F   V VL       QRHY  H  DI+C+ VH D +++A+ Q   +  + K      R+W S SL TL++    +       I    +     L  +DD  + ++++W+ K + K+  +  S+  V S  F   +EN+ VT G  +I +W    L G   +K    +    K +     +  ++ + ++GDS+G +YVW   G   +T  I   H + ++ALC      F +G   G +  W  +  ++  G   +P+D G VR L      S      +GTT N ILQ    +      P              + QGH  ++  ++ V  N + F+T  +D Q  ++++          +K    +         +A+GT     ++LD   Q E++   + NE I      ++  + PD   + +G  D  +   + +E         K    S F T +      +F+   S D +   W              + K V  ++T+++V W+   C +     G W       +  ALC S   + ++  +G   GK+ ++R       +  H+     + VTNV F +    + +  G+D  + QW +
Sbjct:    7 KAKEPTFNKEDGYVRMYLRGRPITMFMPQD-AVEGYKIGAKLELPAEKLSLEWAYGYRGKDCRANVELLPSGELVFFVAAVGVLQHVESGVQRHYLGHDDDIKCMAVHPDKVIVATGQVVGKSKDGKVLPAHVRVWSSASLETLHLIGGGVFDRGVLCISFSRAGGGGLLCAVDDGNEKMISVWNWKKETKVTDSKCSNEVVYSADFHPKEENVIVTCGKNNINFW---ALDGRNLSKKQGIFEKHEKPKHVLCLIYLDNGDAVSGDSSGNIYVWGKAGGYRITRAITGVHASGVMALCERADGTFISGGRDGHVVFW--DSKMEKTGESRIPKDLGTVRSLADGADGS----FWVGTTENGILQ---GSAHGEFSP--------------VVQGHTDELWGLA-VHQNQDAFLTCAQDKQAILWNSATHRPTWIKTLKDPLQSADFHPSGKVVAIGTQAASWLVLDLKTQKELHHESAGNEQI------AVMRYSPDGSHLAVGSNDNFIYVYSVSEEGHKYNAVGKCTGHSSFVTHLDWSTNGEFLMSNSGDYETLYWTP-----------ANCKQVTAMATVRDVEWATMTCVLGFSTFGVWSEGADGTDINALCRS--GSGKLCVLGDDFGKVRLFRSSAFQPRSPSHAYGGHCSHVTNVAFSSDDSFVFTTGGKDMGVLQWRV 647          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006636.1 (pep scaffold:Pmarinus_7.0:GL476567:332173:347209:1 gene:ENSPMAG00000005975.1 transcript:ENSPMAT00000006636.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.591 bits (366), Expect = 1.913e-37
Identity = 93/287 (32.40%), Postives = 142/287 (49.48%), Query Frame = 3
Query: 1431 KPVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVY-GFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYK---WTARIWRSDSLSTLYIFQEPLDSNPGQPIF------MDFSPKKNWLL-VLDDSKDHILTLWD-IKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGA 2255
            KP   ++   +  V++ L G P  +  P D+ +    L    + P  KLK++WVY G+RG+D   NL LL  GE+ YF   VVVL++  +  QRHY EH+ D++CL +H D I IA+ Q      + K      R+W S SL TL++         G  +F      + FS     LL  +DD  +H+L++WD  +G KLA    S+ +V +  F  +D    VT G  H+ +W    L G   +K    +    K +         + + ITGDS+G ++VW  G+
Sbjct:  167 KPKDPVYNYEEGYVKMYLRGRPITMYLPQDM-VEDYRLDTKLEPPAEKLKLNWVYYGYRGKDCRNNLYLLPTGEMVYFIASVVVLYSPEEGNQRHYLEHNDDVKCLAIHPDRITIATGQVVGTGKDGKTLPAHVRVWDSVSLKTLHVI--------GTGVFERGILCLAFSKTNCGLLCAVDDGNEHVLSVWDWQQGNKLADIKCSNEAVFAADFHPMDPRAIVTCGKSHVHFWT---LEGNSLSKKQGIFEKHDKPKYVLCVTFAENGDAITGDSSGNIFVWGRGS 441          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007278.1 (pep scaffold:Pmarinus_7.0:GL476503:8:51230:-1 gene:ENSPMAG00000006561.1 transcript:ENSPMAT00000007278.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 7.230e-10
Identity = 56/202 (27.72%), Postives = 92/202 (45.54%), Query Frame = 3
Query: 1497 KKLLWPSDLSLSKIE-LPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHS-ADIECLTVHTDGIVIASAQKELQVSNYKWTARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWW 2096
            ++LL    LSL K +  P ++ L  +K+ ++ V G              +G LAY  G VVVL    +N Q H    S   I  +    DG  + + +     S +    R+W     S +Y FQ     +      + FSP   +++ +    D I+ +WD K + LA+T+   + V ++SFS  D + FVT G+ H+ +W
Sbjct:   14 RRLLRSPSLSLKKTKPTPLTERLACLKVTLEKVLGITVTSSSGLACEPKSGLLAYPAGCVVVLLNPKKNKQSHILNASRKTITAVAFSPDGKYLVTGE-----SGHMPAVRVWDVAEGSQVYEFQ----GHKYGVACVVFSPNMKYIVSVGHHHDMIVNVWDWKRRVLAATNKVSSKVSAVSFS-ADSSTFVTVGNRHVKFW 205          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009409.1 (pep scaffold:Pmarinus_7.0:GL476782:177851:212682:1 gene:ENSPMAG00000008506.1 transcript:ENSPMAT00000009409.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 2.476e-7
Identity = 89/420 (21.19%), Postives = 169/420 (40.24%), Query Frame = 3
Query: 1575 LKIDWVYGFRGR---DVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYK---WTARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPL----IGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVW-ANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENV-EFGVDGLS--------------IAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSW 2756
            L++  V GF G    +V+ N     +G  AY  G ++VL       QRH   H+ +I  L    D  V+ASA      +  +   W AR  R      L   +  + +       M FS   + LL + D ++ ++ LWD +   + + + S   +  +         F+  G   I +   + L    + ++ A  + +  G   A      +M   + L T  + G V  W A+    + ++   A    I  LC + + L +G     I+LW     ++++   M    EGGVR  +   S++++ + + G         ++  G  V   F++V E G+ G +              + +  GH G++ +++  S + +  ++   D  + V+   +   V + Q+     TCV+W
Sbjct: 1190 LRLSMVVGFNGNARGNVIWNPD---SGLFAYTCGSLLVLEDLHTGAQRHLQAHTEEISTLASSHDAEVLASASGGRGDTGSQICVWDAR--RGSCERVLSRHRHEVQA-------MAFSADNSVLLSVGDYREMMVVLWDTRTYAVIAATRSVFPINDVCPDPSAAGAFLCVGSGAIAFCRAQNLGETAVLQLSAAPLPNGAG---ASELSAAVMGPDSLLFTASACGRVAAWDADRRRCLLSW--DADTADIGVLCCHGNRLLSGSSSKRIRLWC----VESVSATM----EGGVRESVT--STASEFVSMEGE--------MVLDGAVVSAAFDDVMEMGIVGTAAGTLWYINWTERACVRLVSGHRGKVNDIA-FSPDGSQLVSGSEDGLLRVWSVPEMELVVQFQVLHRSCTCVAW 1573          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Nematostella
Match: EDO49877 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REY9])

HSP 1 Score: 170.629 bits (431), Expect = 1.851e-44
Identity = 169/635 (26.61%), Postives = 285/635 (44.88%), Query Frame = 3
Query: 1593 YGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKE-LQVSNYKWTA-RIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKN--WLLVLDDSKDHI-LTLWDIKGQKLASTSSS--HNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARIT---YTCL-MTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVY--KSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFS---SSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDS-IALGTIEGRCIILDQHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCHSNIA-SNPVTNVLFLNSGDHLISVSGQDSCITQW 3443
            YG++G     NL +L +GE+ YF  R+VV++    N QRHY  H+ DI+C+ VH +   IA+ Q   L +   + +  R+W +++L TL +   PLD        + FS + N   L+ +D + D   L LW+ + + L + S       VL I+F   D    V+ G EHI +W +    G+++ K      G+ +        TC+    + ++ TGDS+GTV VW   +  +   +++AHE  I  L V    + L  G   G +  W  NK          P  E  VR L         S+   L++GTT N IL+    +           +F      I + +GH  ++  ++ V  + + FI+A  D    ++ A        T + G    C ++    S +ALG+ +GR I+LD      V S+ +      +T I   P+ + + +   DG +     +  YD      +    S    P+  +D+    S+DG +   +S ++   + +EI   +   + + I++  W+ +   +  DV G W +    E       +  + ++LA+G   G I ++R+PC  + A  H   A S  V  VLFL S   L+S +GQD  + QW
Sbjct:    1 YGYQGTQR--NLHVLPSGEILYFISRIVVIYNKKSNIQRHYTGHADDIKCMAVHPNQWYIATGQASGLSLDQNEMSHIRLWDAETLITLVVL--PLDDYSLSVETLAFSVEDNGKQLVCIDSNDDSFRLNLWEWEDRSLLTQSKVGIQTPVLDIAFDPDDSKTIVSCGKEHIYFWRWHN--GKLERK-----NGYFEKYPVPQYLTCMDFAPNGDICTGDSSGTVTVWGKVSKKIKFVVRNAHEKSIFCLRVLPNGTLLTAGGVDGRVCAWDSNK------YFTTPLHEAQVRQLTQQIRLKFHSDDVTLLVGTTANKILEGSFTS-----------DF------IPLVKGHSDEVPALA-VHPSKDLFISASMDKFAYLWSAKDHKTAWSTDV-GFSIKCAAFYNTGSVVALGSTKGRWIVLDGQTGMHVCSFQDGTEP--LTDIEYSPEGEHVAIASKDGNIYV---HSVYDDGMTYRRVGCCSNHTAPVMFLDW----SVDGCFIQSISTEY-EHITWEIGAFQREESQNVIRDTEWNTRNVVLGYDVAGVWRSTPTEENLVTSSDLSWSHDLLAVGDELGYIRLFRYPCCIEGAQYHQVRAHSMSVARVLFLASDKFLLSTAGQDRAVLQW 589          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Nematostella
Match: EDO42394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1N5])

HSP 1 Score: 160.614 bits (405), Expect = 3.624e-41
Identity = 163/579 (28.15%), Postives = 265/579 (45.77%), Query Frame = 3
Query: 1545 PNSK-DLPTVKLKIDWVYGFRGRDVLCNLSLLS-NGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQ----KELQVSNYKWTARIWRSDSLSTLYI-----FQEPLDSNPGQPIFMDFSPKKN--WLLVLDDSKDHILTLWDIKGQKLASTSSSH-NSVLSISFS--KVDENI--FVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHN-ELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKS--FLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFD-ADKRLGVQKTQIKGHQFTCVSWLVD-----DSIALGTIEGRCIILDQHEINLVESYNEIILS--CGVTSIFNF---PDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPI---FGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQC 3176
            PN+  D P  +L ++WVYG+RG+D   NL +++  GELAYFT  +VVL+   ++TQRHY +H+ D++ L VH DG  IAS Q    +E+Q   +    RIW    L T+ +     F   ++S       + FS K +  +++ +DD   H +T+WD +  K+ +++  H + VL  SF+  +++E +   V+ G +H+ +W     I E + KC           +  +CL    N ++ITGD+NGT+YVW  G N +++ + +AH+  + AL V  +   L  G   G ++ W   K L   G + L     G+R L  AF  SN   L IGTT N I  +              + F +   S++  QGH   +  ++   +   +F TAG D  + V++ AD  + + +          +   V      D+IA+G  +G   I +      V+S   I     C    I +    PD K + +   D  +   T        E   K    + + T      G DFIQ  S D +   W + K         E +K+  ++   +N  W+ Q C
Sbjct:   27 PNTNPDKPDQRLALEWVYGYRGKDCRNNLVVVNETGELAYFTAAIVVLYNLKKHTQRHYTQHTDDVKSLAVHPDGRTIASGQVAGHEEVQGEPH---FRIWDVVRLETIAVIGLGHFGRAVNS-------LAFSKKDHGRYIVSVDDDDYHTITVWDWERNKIVASARGHMDQVLVASFTPFEINEGVLSLVSCGKQHVSFWN----IEEGRLKCDRGRFDHHVKPLYISCLTFARNGDVITGDTNGTIYVWREGTNEISSSVTNAHQGPVYALLVLPNGDLLSGGGKDGTVRAWNNMKELSPTG-VELRYGVTGIRTL--AFDDSN--TLYIGTTDNCIWTV------------RPIPFTLHLKSLSF-QGHSDSLQGLAAHPSEPKFF-TAGSDMTVRVWNSADHSVQLFRPPADNRDKKLIPCAVSVSSTADTIAVGYKDGSFGIFN------VKSGEPIFFKKRCAQEKISDLKYSPDGKCLAVASHDNNIYVYTLENGGRSMELCGKCEGHTSYVTHFDWSVGSDFIQSTSGDYELLFWDAKK--------CEQIKLAKDM---RNTEWATQNC 555          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Nematostella
Match: EDO31013 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ48])

HSP 1 Score: 142.124 bits (357), Expect = 3.508e-35
Identity = 157/581 (27.02%), Postives = 249/581 (42.86%), Query Frame = 3
Query: 1545 PNSK-DLPTVKLKIDWVYGFRGRDVLCNLSLLS-NGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQ--------KELQVSNYKWTARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIKGQKLASTSSSH-NSVLSISFS--KVDENIF--VTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHN-ELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKS--FLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFD-ADKRLGVQKTQIKGHQFTCVSWLVD-----DSIALGTIEGRCIILDQHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPI---FGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAW 3206
            PN+  D P  +L ++WVYG+RG+D   NL +++  GELAYFT  +VVL+   ++TQRHY +H+ D++ L VH DG  IAS Q         EL V+++  T      D +  L +    L       + +      N   +     D ++       Q        H + VL  SF+  +++E +   V+ G +H+ +W     I E + KC           +  +CL    N ++ITGD+NGT+YVW  G N +++ + +AH+  + AL V  +   L  G   G ++ W   K L   G + L     G+R L  AF  SN   L IGTT N I           + P   +   +  LS   SQGH   +  ++   +   +F TAG D  + V++ AD  + + +          +   V      D+IA+G  +GRC           E  +++  S         PD K + +   D  +   T        E   K    + + T      G DFIQ  S D +   W + K         E +K+  ++   +N  W+ Q C +   V+G W
Sbjct:   27 PNTNPDKPDQRLALEWVYGYRGKDCRNNLVVVNETGELAYFTAAIVVLYNLKKHTQRHYTQHTDDVKSLAVHPDGRTIASGQVAGHEEVQGELMVNHHYLT-----QDHMDQLMVNHHYLTYGHTDQLIL------NHHYLTQGHMDQLMVYHHYLTQDHMDQLMGHMDQVLVASFTPFEINEGVLSLVSCGKQHVSFWN----IEEGRLKCDRGRFDHHVKPLYISCLTFARNGDVITGDTNGTIYVWREGTNEISSSVTNAHQGPVYALLVLPNGDLLSGGGKDGTVRAWNNMKELSPTG-VELRYGVTGIRTL--AFDDSN--TLYIGTTDNCIW---------TVRPIP-LTLHLKSLS---SQGHSDSLQGLAAHPSEPKFF-TAGSDMTVRVWNSADHSVQLFRPPADNRDKKLIPCAVSVSSTADTIAVGYKDGRCA---------QEKISDLKYS---------PDGKCLAVASHDNNIYVYTLENGGKSMELCGKCEGHTSYVTHFDWSVGSDFIQSTSGDYELLFWDAKK--------CEQIKLAKDM---RNTEWATQNCVLGYPVLGIW 544          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Nematostella
Match: EDO48487 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIZ6])

HSP 1 Score: 130.183 bits (326), Expect = 5.464e-31
Identity = 151/652 (23.16%), Postives = 278/652 (42.64%), Query Frame = 3
Query: 1563 PTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQ--KELQVSNYKWTARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIK-GQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFR-----------PLIGEIQAK-CVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHY-GQIGNVSQVSTNDNWFITAGRDSQICVFD-ADKRLGVQKTQIKGHQFTCVSWLVDDS-IALGTIEGRCIIL---DQHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCHSNIA-SNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            P+ +++++WVYG+RG     NL   ++ E+ YF   V V++   +NTQR +  H  DI  L +H + +++A+ Q  K+  +        +W S S  T+ I +   D++      + F+P  N+L+ +     H++ +WD K G++LAST    + +  + F+   EN+ V+ G +HI++W  R              GEIQ   C+A    F    +TY           +G  +G +Y W  G N +   I +AH   + ++        +G   G + LW  +     +  + L     G   L +         +++GT    + +++     K                  I QGH  G++  ++        F T   D  + ++  ADK L + +T +   +   V++  D + +A+G  +G  +IL   D  E+  +    E++     +     PD + + +G  D  +      + Y  ++ G  K +SS     I  +D+    S D K YL  ++     + Y +   K + N   IK++ W+   C +  +V G W       +     +  Q   ++  G   G + +++FP + K +     +  S  VTNV F N  + +ISV G D  + QW  +
Sbjct:    7 PSSQIRLEWVYGYRGHQCRNNLYYTASKEIVYFVAGVGVVYNTRENTQRFFLGHDDDIISLALHPEKVLVATGQVGKDPYIC-------VWDSHSTETVSILK---DAHQRGITCLAFNPSGNYLVSVGLEDYHMVVVWDWKRGKQLASTRGHTDRIFDMQFNPYKENVLVSCGVKHIIFWTLRGNSLNPKKGIFGKTGEIQTNLCLA----FGSDDVTY-----------SGTLSGEIYKW-KGQN-LAGAIPNAHTGAVFSIFGGADGFASGSKDGTVVLW--DAEFKPIAKLDLINTRVGYEGLSIRSVCWLGEKILVGTNAGEVFEVMATDKDK---------------PRTIVQGHAEGELWALA-AHPKKGIFATGSDDKSVRLWSMADKSL-LARTDVD-QKVRSVAFNADGTHLAVGLSDGSFMILKARDLSEVTRINDRKEVLHEMKYS-----PDGQFLAVGSNDNFVDIYAVAQKY--KKVGECKGSSSF----ITHLDW----SEDSK-YLQTNSGAAERLFYRMPTGKRITNKEEIKSIHWATWTCVVGTEVNGIWGKYSDTNDVNALDACFQ-HNVMVTGDDFGLVKLFKFPSVRKGSKFRKYVGHSAHVTNVRFSNDFNRVISVGGGDHAVFQWRFL 594          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Nematostella
Match: EDO36826 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHH0])

HSP 1 Score: 62.3882 bits (150), Expect = 9.813e-10
Identity = 98/469 (20.90%), Postives = 184/469 (39.23%), Query Frame = 3
Query: 1641 NGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIKGQKLASTSSSHNSVLSISFSKVDENIFVTTGH-EHIMWWEFRPLIGEIQAKC--------VADYRGFLKARITYTCL-MTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSIL--QLLLATGKKVLHPFENV-EFGVDG--------------LSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSW-----------LVDDSIALGTIEGRCIILDQHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCL 2933
             G  AY +G +VV+       Q+H   H  ++  +T   DG+V+ASA    + S       IW     +   +    L  +P + + + +S     L+ + D +D  + +W+ +   + ++S +   V  I +     N F T G    +M+W     I  I  K         +       K  + +TCL     + +  G+S G +  W    N+   + + A +  I+ L  ++  L  G   G ++LW    ++  +  + LP +   + +  V  S+     L    +++S+     ++  G  +   F++V E G+ G               SI +  GH  QI N+    ++D +F T  +D  + ++  D  L   + Q+ G    CV++           +     A G  +G   + D  ++ +         +C VT I    D   +  GG DG L
Sbjct:  277 TGLFAYTSGSIVVIEDLHSGGQKHLIGHVEEVSTITCQNDGLVLASASGSSETSESS-QIYIWDIQEETCTKV----LSYHPHEVVCLAYSRDDRMLISVGDFRDCSVVVWNTQTYDVITSSYARLPVHDILWDPYTVNEFATVGEGGSVMFWLVDETIPNISLKVHEPAVPSELTTSIKPDKPTVHFTCLSYAGDSVMYAGNSEGVLSAWDTRQNSCFLHWQ-ADKTEIVVLISHRGQLIAGSSGGNLRLW----SVVGVAEMRLPGENNRLFNETVCVST-----LCFRLSSDSLTMEDEMVLDGAIISTSFDDVLETGIVGTASGTLWYINWSERTSIRLVSGHAEQITNIVFSGSDDKYFATCAKDGVLHLWTTDN-LEHMQFQVVGQSCNCVAFCPIPPATPTNAIHPSHCAAGYSDGTVRMFDLGKVEMFMKMQP--HACAVTVIGFSVDGHVVISGGSDGVL 727          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Medaka
Match: eml1 (EMAP like 1 [Source:NCBI gene;Acc:101173348])

HSP 1 Score: 234.958 bits (598), Expect = 5.044e-64
Identity = 196/676 (28.99%), Postives = 301/676 (44.53%), Query Frame = 3
Query: 1446 LFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTA---RIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIKGQ-KLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHM-KIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPL-MLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCH-SNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            +F   +  V++ L G P  +    D  +    L    +LP+ KLK+DWVYG+RGRD   NL LL  GE  YF   VVVLF   +  QRHY  H+ DI+CL VH D I IA+ Q     S+ K  A   R+W S SL+TL++            +    S   N L V+DDS DHIL+LWD + + +LA    S+ SV +  F   D N+ VT G  H+ +W        I  K    +    K +         + + ITGDSNG + VW  G N +++ I+ AHE  + A+C+ ++       K   +L  ++ +   +  + +P   G +R      +      ++IGTT N +LQ  L                 DG    I+QGH  ++  ++ V      F+T G D Q+C++D+     +    +     +         +A+GT  GR ++LD    +LV  + +      V  I   P+   + +G  D  +      EN        K    S F   I  +D+    S D +Y   VSN     + Y I  + K V ++ T +++ W+   C +   V G W       +  A C S    K +L  G   GK+ ++ +PC    A  H     S+ VTNV FL+    ++S  G+D  + QW I+
Sbjct:  179 VFNADEGYVKMYLKGRPITMYMNKD-QMDSYCLEARAELPSNKLKLDWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLFNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSDGKQLAPHVRVWDSVSLNTLHVLGAGFFDRAVVCLAFSKSNGGNTLCVVDDSNDHILSLWDWQREDRLAEVKGSNESVFAADFHPTDSNVVVTCGKSHLCFWTLEK---GILVKKQGLFEKQEKPKFVICVTFAENGDAITGDSNGNILVWGKGTNRISHVIQGAHEASVFAVCMLRNGTLVSGGKDR-RLISWDGSYQQIQTMEVPDLFGPIR----TVAEGRGETVLIGTTKNFVLQGSL-----------------DGEFKCITQGHTDELWGLA-VHPCKPQFLTCGYDRQVCLWDSSSHQLIWTKTVDDAAQSAGFHPSGAVVAVGTQTGRWLVLDTDSKDLVTVHTDGNEQLSV--IRYGPEGNFLAIGSHDNYIYIYAVAENGRKYSRVGKCSGHSSF---ITHLDW----SADSQYL--VSNSGDYEILYWIPSVCKQVVSVETTRDIEWATYTCTLGFQVFGLWPDGSDGTDINAACRS--NAKNLLVSGDDFGKVHLFLYPCSQFRAPSHVYGGHSSHVTNVTFLHDDSSVVSTGGKDMSVMQWRIV 814          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Medaka
Match: eml1 (EMAP like 1 [Source:NCBI gene;Acc:101173348])

HSP 1 Score: 234.572 bits (597), Expect = 6.635e-64
Identity = 196/673 (29.12%), Postives = 300/673 (44.58%), Query Frame = 3
Query: 1455 KPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTA---RIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIKGQ-KLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHM-KIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPL-MLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCH-SNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            K +  V++ L G P  +    D  +    L    +LP+ KLK+DWVYG+RGRD   NL LL  GE  YF   VVVLF   +  QRHY  H+ DI+CL VH D I IA+ Q     S+ K  A   R+W S SL+TL++            +    S   N L V+DDS DHIL+LWD + + +LA    S+ SV +  F   D N+ VT G  H+ +W        I  K    +    K +         + + ITGDSNG + VW  G N +++ I+ AHE  + A+C+ ++       K   +L  ++ +   +  + +P   G +R      +      ++IGTT N +LQ  L                 DG    I+QGH  ++  ++ V      F+T G D Q+C++D+     +    +     +         +A+GT  GR ++LD    +LV  + +      V  I   P+   + +G  D  +      EN        K    S F   I  +D+    S D +Y   VSN     + Y I  + K V ++ T +++ W+   C +   V G W       +  A C S    K +L  G   GK+ ++ +PC    A  H     S+ VTNV FL+    ++S  G+D  + QW I+
Sbjct:  196 KDEGYVKMYLKGRPITMYMNKD-QMDSYCLEARAELPSNKLKLDWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLFNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSDGKQLAPHVRVWDSVSLNTLHVLGAGFFDRAVVCLAFSKSNGGNTLCVVDDSNDHILSLWDWQREDRLAEVKGSNESVFAADFHPTDSNVVVTCGKSHLCFWTLEK---GILVKKQGLFEKQEKPKFVICVTFAENGDAITGDSNGNILVWGKGTNRISHVIQGAHEASVFAVCMLRNGTLVSGGKDR-RLISWDGSYQQIQTMEVPDLFGPIR----TVAEGRGETVLIGTTKNFVLQGSL-----------------DGEFKCITQGHTDELWGLA-VHPCKPQFLTCGYDRQVCLWDSSSHQLIWTKTVDDAAQSAGFHPSGAVVAVGTQTGRWLVLDTDSKDLVTVHTDGNEQLSV--IRYGPEGNFLAIGSHDNYIYIYAVAENGRKYSRVGKCSGHSSF---ITHLDW----SADSQYL--VSNSGDYEILYWIPSVCKQVVSVETTRDIEWATYTCTLGFQVFGLWPDGSDGTDINAACRS--NAKNLLVSGDDFGKVHLFLYPCSQFRAPSHVYGGHSSHVTNVTFLHDDSSVVSTGGKDMSVMQWRIV 828          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Medaka
Match: eml1 (EMAP like 1 [Source:NCBI gene;Acc:101173348])

HSP 1 Score: 234.572 bits (597), Expect = 7.129e-64
Identity = 196/676 (28.99%), Postives = 301/676 (44.53%), Query Frame = 3
Query: 1446 LFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTA---RIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIKGQ-KLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHM-KIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPL-MLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCH-SNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            +F   +  V++ L G P  +    D  +    L    +LP+ KLK+DWVYG+RGRD   NL LL  GE  YF   VVVLF   +  QRHY  H+ DI+CL VH D I IA+ Q     S+ K  A   R+W S SL+TL++            +    S   N L V+DDS DHIL+LWD + + +LA    S+ SV +  F   D N+ VT G  H+ +W        I  K    +    K +         + + ITGDSNG + VW  G N +++ I+ AHE  + A+C+ ++       K   +L  ++ +   +  + +P   G +R      +      ++IGTT N +LQ  L                 DG    I+QGH  ++  ++ V      F+T G D Q+C++D+     +    +     +         +A+GT  GR ++LD    +LV  + +      V  I   P+   + +G  D  +      EN        K    S F   I  +D+    S D +Y   VSN     + Y I  + K V ++ T +++ W+   C +   V G W       +  A C S    K +L  G   GK+ ++ +PC    A  H     S+ VTNV FL+    ++S  G+D  + QW I+
Sbjct:  197 VFNADEGYVKMYLKGRPITMYMNKD-QMDSYCLEARAELPSNKLKLDWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLFNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSDGKQLAPHVRVWDSVSLNTLHVLGAGFFDRAVVCLAFSKSNGGNTLCVVDDSNDHILSLWDWQREDRLAEVKGSNESVFAADFHPTDSNVVVTCGKSHLCFWTLEK---GILVKKQGLFEKQEKPKFVICVTFAENGDAITGDSNGNILVWGKGTNRISHVIQGAHEASVFAVCMLRNGTLVSGGKDR-RLISWDGSYQQIQTMEVPDLFGPIR----TVAEGRGETVLIGTTKNFVLQGSL-----------------DGEFKCITQGHTDELWGLA-VHPCKPQFLTCGYDRQVCLWDSSSHQLIWTKTVDDAAQSAGFHPSGAVVAVGTQTGRWLVLDTDSKDLVTVHTDGNEQLSV--IRYGPEGNFLAIGSHDNYIYIYAVAENGRKYSRVGKCSGHSSF---ITHLDW----SADSQYL--VSNSGDYEILYWIPSVCKQVVSVETTRDIEWATYTCTLGFQVFGLWPDGSDGTDINAACRS--NAKNLLVSGDDFGKVHLFLYPCSQFRAPSHVYGGHSSHVTNVTFLHDDSSVVSTGGKDMSVMQWRIV 832          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Medaka
Match: eml1 (EMAP like 1 [Source:NCBI gene;Acc:101173348])

HSP 1 Score: 234.187 bits (596), Expect = 1.059e-63
Identity = 196/673 (29.12%), Postives = 300/673 (44.58%), Query Frame = 3
Query: 1455 KPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTA---RIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIKGQ-KLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHM-KIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPL-MLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCH-SNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            K +  V++ L G P  +    D  +    L    +LP+ KLK+DWVYG+RGRD   NL LL  GE  YF   VVVLF   +  QRHY  H+ DI+CL VH D I IA+ Q     S+ K  A   R+W S SL+TL++            +    S   N L V+DDS DHIL+LWD + + +LA    S+ SV +  F   D N+ VT G  H+ +W        I  K    +    K +         + + ITGDSNG + VW  G N +++ I+ AHE  + A+C+ ++       K   +L  ++ +   +  + +P   G +R      +      ++IGTT N +LQ  L                 DG    I+QGH  ++  ++ V      F+T G D Q+C++D+     +    +     +         +A+GT  GR ++LD    +LV  + +      V  I   P+   + +G  D  +      EN        K    S F   I  +D+    S D +Y   VSN     + Y I  + K V ++ T +++ W+   C +   V G W       +  A C S    K +L  G   GK+ ++ +PC    A  H     S+ VTNV FL+    ++S  G+D  + QW I+
Sbjct:  209 KDEGYVKMYLKGRPITMYMNKD-QMDSYCLEARAELPSNKLKLDWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLFNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSDGKQLAPHVRVWDSVSLNTLHVLGAGFFDRAVVCLAFSKSNGGNTLCVVDDSNDHILSLWDWQREDRLAEVKGSNESVFAADFHPTDSNVVVTCGKSHLCFWTLEK---GILVKKQGLFEKQEKPKFVICVTFAENGDAITGDSNGNILVWGKGTNRISHVIQGAHEASVFAVCMLRNGTLVSGGKDR-RLISWDGSYQQIQTMEVPDLFGPIR----TVAEGRGETVLIGTTKNFVLQGSL-----------------DGEFKCITQGHTDELWGLA-VHPCKPQFLTCGYDRQVCLWDSSSHQLIWTKTVDDAAQSAGFHPSGAVVAVGTQTGRWLVLDTDSKDLVTVHTDGNEQLSV--IRYGPEGNFLAIGSHDNYIYIYAVAENGRKYSRVGKCSGHSSF---ITHLDW----SADSQYL--VSNSGDYEILYWIPSVCKQVVSVETTRDIEWATYTCTLGFQVFGLWPDGSDGTDINAACRS--NAKNLLVSGDDFGKVHLFLYPCSQFRAPSHVYGGHSSHVTNVTFLHDDSSVVSTGGKDMSVMQWRIV 841          
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Medaka
Match: eml1 (EMAP like 1 [Source:NCBI gene;Acc:101173348])

HSP 1 Score: 233.802 bits (595), Expect = 1.351e-63
Identity = 196/673 (29.12%), Postives = 300/673 (44.58%), Query Frame = 3
Query: 1455 KPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTA---RIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIKGQ-KLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHM-KIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPL-MLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCH-SNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            K +  V++ L G P  +    D  +    L    +LP+ KLK+DWVYG+RGRD   NL LL  GE  YF   VVVLF   +  QRHY  H+ DI+CL VH D I IA+ Q     S+ K  A   R+W S SL+TL++            +    S   N L V+DDS DHIL+LWD + + +LA    S+ SV +  F   D N+ VT G  H+ +W        I  K    +    K +         + + ITGDSNG + VW  G N +++ I+ AHE  + A+C+ ++       K   +L  ++ +   +  + +P   G +R      +      ++IGTT N +LQ  L                 DG    I+QGH  ++  ++ V      F+T G D Q+C++D+     +    +     +         +A+GT  GR ++LD    +LV  + +      V  I   P+   + +G  D  +      EN        K    S F   I  +D+    S D +Y   VSN     + Y I  + K V ++ T +++ W+   C +   V G W       +  A C S    K +L  G   GK+ ++ +PC    A  H     S+ VTNV FL+    ++S  G+D  + QW I+
Sbjct:  191 KDEGYVKMYLKGRPITMYMNKD-QMDSYCLEARAELPSNKLKLDWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLFNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSDGKQLAPHVRVWDSVSLNTLHVLGAGFFDRAVVCLAFSKSNGGNTLCVVDDSNDHILSLWDWQREDRLAEVKGSNESVFAADFHPTDSNVVVTCGKSHLCFWTLEK---GILVKKQGLFEKQEKPKFVICVTFAENGDAITGDSNGNILVWGKGTNRISHVIQGAHEASVFAVCMLRNGTLVSGGKDR-RLISWDGSYQQIQTMEVPDLFGPIR----TVAEGRGETVLIGTTKNFVLQGSL-----------------DGEFKCITQGHTDELWGLA-VHPCKPQFLTCGYDRQVCLWDSSSHQLIWTKTVDDAAQSAGFHPSGAVVAVGTQTGRWLVLDTDSKDLVTVHTDGNEQLSV--IRYGPEGNFLAIGSHDNYIYIYAVAENGRKYSRVGKCSGHSSF---ITHLDW----SADSQYL--VSNSGDYEILYWIPSVCKQVVSVETTRDIEWATYTCTLGFQVFGLWPDGSDGTDINAACRS--NAKNLLVSGDDFGKVHLFLYPCSQFRAPSHVYGGHSSHVTNVTFLHDDSSVVSTGGKDMSVMQWRIV 823          
BLAST of Echinoderm microtubule associated protein like 1 vs. Planmine SMEST
Match: SMESG000017256.1 (SMESG000017256.1)

HSP 1 Score: 2212.19 bits (5731), Expect = 0.000e+0
Identity = 1129/1137 (99.30%), Postives = 1131/1137 (99.47%), Query Frame = 3
Query:   42 LLIDCQPKFQPPMSSTTDQKPAVEEGKDAKPKSKLKPRSVVKSTFDQAKAPVKTSRPSKHSISTKTAAANKQKPLVKAPSRGVMKLRMIAKFSKLSSADGKSKDEEEQFAEEGSQNEDEDKKNEEYSLHHQLIPALKEVSRQKLRSLRMALRKIHSSSEDGLVTINEAVQTIIDLKFNLPSRLLDILVLXXXXXXXXXXXXXXXSYFEKAHSLTGRXXXXXXXXXXXXXGLRVQSEITDAELFKRAELQLVKSREPFDLEKFRNVLKKMDTSHSGILKKLEIEKVANEFYCPIYGSLLHSVLSKSDQTKNNDIRWPEFINFLEKVYKSVVEKDSEFLEKLKKKEIAKPLPSREMLRNKFKSIAVKAREVERQKNNSPGALSTEKESIKPSNIARKPSDDSPTEKPTVTKSQPXXXXXXXXXXXXXXXXXXXXXXXAVDTTPRKSGNKKVVTNTPAIPKPEIVIKPVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCHSNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            LLIDCQPKFQPPMSSTTDQKPAVEEGKDAKPKSKLKPRS VKSTFDQAK PVKTSRPSKHSISTKTAAANKQKPLVKAPSRGVMKLRMIAKFSKLSSA+GKSKDEEEQFAEEGSQNEDEDKKNEEYSLHHQLIPALKEVSRQKLRSLRMALRKIHSSSEDG VTINEAVQTIIDLKFNLPSRLLDILVLECKIKE+KIQHEKIISYFEKAHSLTGRDSIDAIDADEIDSGLRVQSEITDAELFKRAELQLVKSREPFDLEKFRNVLKKMDTSHSGILKKLEIEKVANEFYCPIYGSLLHSVLSKSDQTKNNDIRWPEFINFLEKVYKSVVEKD EFLEKLKKKEIAKPLPSREMLRNKFKSIAVKAREVERQKNNSPGALSTEKESIKPSNIARKPSDDSPTEKPTVTKSQPAKNISRDKKDKKPKGKILKSKAPAVD TPRKSGNKKVVTNTPAIPKPEIVIKPVQELFEKPKNAVELEL GFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCHSNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII
Sbjct:   46 LLIDCQPKFQPPMSSTTDQKPAVEEGKDAKPKSKLKPRSAVKSTFDQAKPPVKTSRPSKHSISTKTAAANKQKPLVKAPSRGVMKLRMIAKFSKLSSANGKSKDEEEQFAEEGSQNEDEDKKNEEYSLHHQLIPALKEVSRQKLRSLRMALRKIHSSSEDGFVTINEAVQTIIDLKFNLPSRLLDILVLECKIKEDKIQHEKIISYFEKAHSLTGRDSIDAIDADEIDSGLRVQSEITDAELFKRAELQLVKSREPFDLEKFRNVLKKMDTSHSGILKKLEIEKVANEFYCPIYGSLLHSVLSKSDQTKNNDIRWPEFINFLEKVYKSVVEKDPEFLEKLKKKEIAKPLPSREMLRNKFKSIAVKAREVERQKNNSPGALSTEKESIKPSNIARKPSDDSPTEKPTVTKSQPAKNISRDKKDKKPKGKILKSKAPAVDITPRKSGNKKVVTNTPAIPKPEIVIKPVQELFEKPKNAVELELLGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCHSNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII 1182          
BLAST of Echinoderm microtubule associated protein like 1 vs. Planmine SMEST
Match: SMESG000017256.1 (SMESG000017256.1)

HSP 1 Score: 2209.88 bits (5725), Expect = 0.000e+0
Identity = 1129/1137 (99.30%), Postives = 1131/1137 (99.47%), Query Frame = 3
Query:   42 LLIDCQPKFQPPMSSTTDQKPAVEEGKDAKPKSKLKPRSVVKSTFDQAKAPVKTSRPSKHSISTKTAAANKQKPLVKAPSRGVMKLRMIAKFSKLSSADGKSKDEEEQFAEEGSQNEDEDKKNEEYSLHHQLIPALKEVSRQKLRSLRMALRKIHSSSEDGLVTINEAVQTIIDLKFNLPSRLLDILVLXXXXXXXXXXXXXXXSYFEKAHSLTGRXXXXXXXXXXXXXGLRVQSEITDAELFKRAELQLVKSREPFDLEKFRNVLKKMDTSHSGILKKLEIEKVANEFYCPIYGSLLHSVLSKSDQTKNNDIRWPEFINFLEKVYKSVVEKDSEFLEKLKKKEIAKPLPSREMLRNKFKSIAVKAREVERQKNNSPGALSTEKESIKPSNIARKPSDDSPTEKPTVTKSQPXXXXXXXXXXXXXXXXXXXXXXXAVDTTPRKSGNKKVVTNTPAIPKPEIVIKPVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCHSNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII 3452
            LLIDCQPKFQPPMSSTTDQKPAVEEGKDAKPKSKLKPRS VKSTFDQAK PVKTSRPSKHSISTKTAAANKQKPLVKAPSRGVMKLRMIAKFSKLSSA+GKSKDEEEQFAEEGSQNEDEDKKNEEYSLHHQLIPALKEVSRQKLRSLRMALRKIHSSSEDG VTINEAVQTIIDLKFNLPSRLLDILVLECKIKE+KIQHEKIISYFEKAHSLTGRDSIDAIDADEIDSGLRVQSEITDAELFKRAELQLVKSREPFDLEKFRNVLKKMDTSHSGILKKLEIEKVANEFYCPIYGSLLHSVLSKSDQTKNNDIRWPEFINFLEKVYKSVVEKD EFLEKLKKKEIAKPLPSREMLRNKFKSIAVKAREVERQKNNSPGALSTEKESIKPSNIARKPSDDSPTEKPTVTKSQPAKNISRDKKDKKPKGKILKSKAPAVD TPRKSGNKKVVTNTPAIPKPEIVIKPVQELFEKPKNAVELEL GFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCHSNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII
Sbjct:   57 LLIDCQPKFQPPMSSTTDQKPAVEEGKDAKPKSKLKPRSAVKSTFDQAKPPVKTSRPSKHSISTKTAAANKQKPLVKAPSRGVMKLRMIAKFSKLSSANGKSKDEEEQFAEEGSQNEDEDKKNEEYSLHHQLIPALKEVSRQKLRSLRMALRKIHSSSEDGFVTINEAVQTIIDLKFNLPSRLLDILVLECKIKEDKIQHEKIISYFEKAHSLTGRDSIDAIDADEIDSGLRVQSEITDAELFKRAELQLVKSREPFDLEKFRNVLKKMDTSHSGILKKLEIEKVANEFYCPIYGSLLHSVLSKSDQTKNNDIRWPEFINFLEKVYKSVVEKDPEFLEKLKKKEIAKPLPSREMLRNKFKSIAVKAREVERQKNNSPGALSTEKESIKPSNIARKPSDDSPTEKPTVTKSQPAKNISRDKKDKKPKGKILKSKAPAVDITPRKSGNKKVVTNTPAIPKPEIVIKPVQELFEKPKNAVELELLGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVSNYKWTARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSIFQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFPCLDKEAYCHSNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII 1193          
BLAST of Echinoderm microtubule associated protein like 1 vs. Planmine SMEST
Match: SMESG000021391.1 (SMESG000021391.1)

HSP 1 Score: 204.527 bits (519), Expect = 1.621e-54
Identity = 188/707 (26.59%), Postives = 299/707 (42.29%), Query Frame = 3
Query: 1359 TPRKSGNKKVVTNTPAIPKPEIVIKPVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVS-NYKWTARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIKGQKLASTS-SSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYK--SFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDA-DKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGR---CIILDQHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCL-VTLTRNENYDPEEDGSKKWNSSIFQTPIFGID--FIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFP-CLDKEAYCHSNIASNPVTNVLFLNSGDHLISVSGQDSCITQW 3443
            +PR       ++ TP       ++   +  F K +  + + + G P  L  P+ L+    +  +    P   L+++WVYG+RG+D   NL  L  G++ YF   +V+L      TQRHY EH+ DI+C+ +H D +  A+ Q         K   RIW S +L TL+             +    S     L+ +D++ DH +TLW+    K   TS SS   V+   F+  D N+  T G  H+ +W    L      K +A +  + K + T     TN+ ELITGDS+G +Y W+    ++T+ I  AH   I +L + +  + L  G     I  W  +        I L  D G  R ++          L++GTT+N+I+++    G      F+N           +  GH  ++  V    + +  F+T G D +I ++DA   ++ + K   K  Q   VS    D +A+G IEG    C + +  EI+  +  NE I     +     PD     +G  D  + +    +E  +    G    +SS      +  D  F++  S D +   W            I   K +   ST+ +V W    C +  +V G W       +       H  K I+A     GK+ +YR+P C  K A+      S+ VT V FL     L S  GQD+ I QW
Sbjct:   73 SPRTPVKATRLSGTPTRRSTNDLVNHKEATFIKGEGILRIFIRGRPINLYVPNSLA-DGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWATTKSICTSKSSTEPVIEAEFNPTDSNVIATCGKNHLAFW---ILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEI-----DDKLVVGTTSNAIVEITGNDG------FDN-----------LLNGHSDEVWGVDSHPSKEQ-FVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNA-DLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFS-----PDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFW-----------NIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHN-KLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 734          
BLAST of Echinoderm microtubule associated protein like 1 vs. Planmine SMEST
Match: SMESG000021391.1 (SMESG000021391.1)

HSP 1 Score: 204.527 bits (519), Expect = 2.019e-54
Identity = 188/707 (26.59%), Postives = 299/707 (42.29%), Query Frame = 3
Query: 1359 TPRKSGNKKVVTNTPAIPKPEIVIKPVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVS-NYKWTARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIKGQKLASTS-SSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYK--SFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDA-DKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGR---CIILDQHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCL-VTLTRNENYDPEEDGSKKWNSSIFQTPIFGID--FIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFP-CLDKEAYCHSNIASNPVTNVLFLNSGDHLISVSGQDSCITQW 3443
            +PR       ++ TP       ++   +  F K +  + + + G P  L  P+ L+    +  +    P   L+++WVYG+RG+D   NL  L  G++ YF   +V+L      TQRHY EH+ DI+C+ +H D +  A+ Q         K   RIW S +L TL+             +    S     L+ +D++ DH +TLW+    K   TS SS   V+   F+  D N+  T G  H+ +W    L      K +A +  + K + T     TN+ ELITGDS+G +Y W+    ++T+ I  AH   I +L + +  + L  G     I  W  +        I L  D G  R ++          L++GTT+N+I+++    G      F+N           +  GH  ++  V    + +  F+T G D +I ++DA   ++ + K   K  Q   VS    D +A+G IEG    C + +  EI+  +  NE I     +     PD     +G  D  + +    +E  +    G    +SS      +  D  F++  S D +   W            I   K +   ST+ +V W    C +  +V G W       +       H  K I+A     GK+ +YR+P C  K A+      S+ VT V FL     L S  GQD+ I QW
Sbjct:   80 SPRTPVKATRLSGTPTRRSTNDLVNHKEATFIKGEGILRIFIRGRPINLYVPNSLA-DGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWATTKSICTSKSSTEPVIEAEFNPTDSNVIATCGKNHLAFW---ILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEI-----DDKLVVGTTSNAIVEITGNDG------FDN-----------LLNGHSDEVWGVDSHPSKEQ-FVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNA-DLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFS-----PDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFW-----------NIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHN-KLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 741          
BLAST of Echinoderm microtubule associated protein like 1 vs. Planmine SMEST
Match: SMESG000021391.1 (SMESG000021391.1)

HSP 1 Score: 205.297 bits (521), Expect = 4.138e-54
Identity = 188/707 (26.59%), Postives = 298/707 (42.15%), Query Frame = 3
Query: 1359 TPRKSGNKKVVTNTPAIPKPEIVIKPVQELFEKPKNAVELELPGFPKKLLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGELAYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVS-NYKWTARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSKDHILTLWDIKGQKLASTS-SSHNSVLSISFSKVDENIFVTTGHEHIMWWEFRPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANGANAVTNYIKHAHENYILALCVYK--SFLFTGDCKGMIKLWLFNKNLDNLGMIMLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFENVEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDA-DKRLGVQKTQIKGHQFTCVSWLVDDSIALGTIEGR---CIILDQHEINLVESYNEIILSCGVTSIFNFPDSKKIFLGGLDGCL-VTLTRNENYDPEEDGSKKWNSSIFQTPIFGID--FIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKNVPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQTKEILAMGTAEGKIAIYRFP-CLDKEAYCHSNIASNPVTNVLFLNSGDHLISVSGQDSCITQW 3443
            +PR       ++ TP       ++   +  F K +  + + + G P  L  P+ L+    +  +    P   L+++WVYG+RG+D   NL  L  G++ YF   +V+L      TQRHY EH+ DI+C+ +H D +  A+ Q         K   RIW S +L TL+             +    S     L+ +D++ DH +TLW+    K   TS SS   V+   F+  D N+  T G  H+ +W    L      K +A +  + K + T     TN+ ELITGDS+G +Y W+    ++T+ I  AH   I +L + +  + L  G     I  W  +        I L  D G  R ++          L++GTT+N+I+++                 G DG    +  GH  ++  V    + +  F+T G D +I ++DA   ++ + K   K  Q   VS    D +A+G IEG    C + +  EI+  +  NE I     +     PD     +G  D  + +    +E  +    G    +SS      +  D  F++  S D +   W            I   K +   ST+ +V W    C +  +V G W       +       H  K I+A     GK+ +YR+P C  K A+      S+ VT V FL     L S  GQD+ I QW
Sbjct:  223 SPRTPVKATRLSGTPTRRSTNDLVNHKEATFIKGEGILRIFIRGRPINLYVPNSLA-DGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWATTKSICTSKSSTEPVIEAEFNPTDSNVIATCGKNHLAFW---ILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEIDDK-----LVVGTTSNAIVEIT----------------GNDGFD-NLLNGHSDEVWGVDSHPSKEQ-FVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNA-DLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFS-----PDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFW-----------NIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHN-KLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 884          
The following BLAST results are available for this feature:
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EML14.229e-6628.43EMAP like 1 [Source:HGNC Symbol;Acc:HGNC:3330][more]
EML15.584e-6628.43EMAP like 1 [Source:HGNC Symbol;Acc:HGNC:3330][more]
EML15.969e-6628.43EMAP like 1 [Source:HGNC Symbol;Acc:HGNC:3330][more]
EML18.264e-6628.43EMAP like 1 [Source:HGNC Symbol;Acc:HGNC:3330][more]
EML21.062e-6126.35EMAP like 2 [Source:HGNC Symbol;Acc:HGNC:18035][more]
back to top
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
elp-12.659e-3224.12Echinoderm microtubule-associated protein-like elp... [more]
elp-12.659e-3224.12Echinoderm microtubule-associated protein-like elp... [more]
elp-12.781e-3224.12Echinoderm microtubule-associated protein-like elp... [more]
elp-12.781e-3224.12Echinoderm microtubule-associated protein-like elp... [more]
pfs-21.056e-627.56Polyadenylation Factor Subunit homolog [Source:Un... [more]
back to top
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
DCX-EMAP8.014e-4625.08gene:FBgn0259099 transcript:FBtr0331181[more]
DCX-EMAP8.782e-4625.08gene:FBgn0259099 transcript:FBtr0299509[more]
DCX-EMAP1.125e-4525.08gene:FBgn0259099 transcript:FBtr0330139[more]
DCX-EMAP1.456e-4524.92gene:FBgn0259099 transcript:FBtr0299510[more]
back to top
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eml11.391e-7130.04EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
eml12.306e-7129.77EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
eml18.694e-7130.25EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
eml18.899e-7130.25EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
eml11.476e-7030.25EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
back to top
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccdc811.431e-6728.74coiled-coil domain containing 81 [Source:Xenbase;A... [more]
ccdc813.492e-6728.74coiled-coil domain containing 81 [Source:Xenbase;A... [more]
ccdc812.115e-6628.90coiled-coil domain containing 81 [Source:Xenbase;A... [more]
ccdc812.622e-6628.91coiled-coil domain containing 81 [Source:Xenbase;A... [more]
ccdc819.242e-6628.91coiled-coil domain containing 81 [Source:Xenbase;A... [more]
back to top
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eml13.145e-6628.72echinoderm microtubule associated protein like 1 [... [more]
Eml17.410e-6628.72echinoderm microtubule associated protein like 1 [... [more]
Eml11.869e-6528.87echinoderm microtubule associated protein like 1 [... [more]
Eml21.428e-6226.69echinoderm microtubule associated protein like 2 [... [more]
Eml25.193e-6226.69echinoderm microtubule associated protein like 2 [... [more]
back to top
BLAST of Echinoderm microtubule associated protein like 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O00423|EMAL1_HUMAN2.866e-6528.43Echinoderm microtubule-associated protein-like 1 O... [more]
sp|Q4V8C3|EMAL1_RAT3.250e-6528.57Echinoderm microtubule-associated protein-like 1 O... [more]
sp|Q05BC3|EMAL1_MOUSE5.183e-6528.72Echinoderm microtubule-associated protein-like 1 O... [more]
sp|Q7TNG5|EMAL2_MOUSE9.992e-6226.69Echinoderm microtubule-associated protein-like 2 O... [more]
sp|Q6P6T4|EMAL2_RAT3.339e-6126.54Echinoderm microtubule-associated protein-like 2 O... [more]
back to top
BLAST of Echinoderm microtubule associated protein like 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JXG11.635e-9031.11echinoderm microtubule-associated protein-like 4 i... [more]
A0A1S3JYH32.402e-9031.11echinoderm microtubule-associated protein-like 4 i... [more]
A0A1I8IK321.451e-7934.04Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2T7PS688.088e-7728.51WD_REPEATS_REGION domain-containing protein OS=Pom... [more]
A0A5A9NQL16.605e-7229.03Echinoderm microtubule-associated protein-like 1 O... [more]
back to top
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eml11.324e-7329.86EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
eml16.044e-7329.71EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
eml16.983e-7329.71EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
eml11.464e-7229.99EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
eml22.044e-6728.85echinoderm microtubule-associated protein-like 2 [... [more]
back to top
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000001632.17.051e-4723.98pep scaffold:Pmarinus_7.0:GL476536:457691:473572:-... [more]
ENSPMAT00000006636.11.913e-3732.40pep scaffold:Pmarinus_7.0:GL476567:332173:347209:1... [more]
ENSPMAT00000007278.17.230e-1027.72pep scaffold:Pmarinus_7.0:GL476503:8:51230:-1 gene... [more]
ENSPMAT00000009409.12.476e-721.19pep scaffold:Pmarinus_7.0:GL476782:177851:212682:1... [more]
back to top
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO498771.851e-4426.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO423943.624e-4128.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO310133.508e-3527.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484875.464e-3123.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368269.813e-1020.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Echinoderm microtubule associated protein like 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eml15.044e-6428.99EMAP like 1 [Source:NCBI gene;Acc:101173348][more]
eml16.635e-6429.12EMAP like 1 [Source:NCBI gene;Acc:101173348][more]
eml17.129e-6428.99EMAP like 1 [Source:NCBI gene;Acc:101173348][more]
eml11.059e-6329.12EMAP like 1 [Source:NCBI gene;Acc:101173348][more]
eml11.351e-6329.12EMAP like 1 [Source:NCBI gene;Acc:101173348][more]
back to top
BLAST of Echinoderm microtubule associated protein like 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017256.10.000e+099.30SMESG000017256.1[more]
SMESG000017256.10.000e+099.30SMESG000017256.1[more]
SMESG000021391.11.621e-5426.59SMESG000021391.1[more]
SMESG000021391.12.019e-5426.59SMESG000021391.1[more]
SMESG000021391.14.138e-5426.59SMESG000021391.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020627 ID=SMED30020627|Name=Echinoderm microtubule associated protein like 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3656bp
TAATGCAACAGTTGATGAGCAACTCGACTCGTTTGGCTGTGCTTCTCATT
GATTGCCAGCCGAAATTCCAACCCCCGATGTCTTCAACAACAGATCAGAA
ACCGGCTGTAGAAGAGGGGAAAGATGCAAAGCCAAAATCTAAACTAAAAC
CTCGAAGTGTGGTGAAGTCAACTTTTGACCAAGCAAAAGCACCTGTTAAA
ACCTCAAGGCCATCAAAACATTCAATATCAACTAAAACTGCGGCTGCGAA
CAAACAAAAGCCTTTAGTGAAGGCTCCAAGCAGGGGAGTCATGAAATTGA
GGATGATAGCTAAATTCAGCAAATTGTCTTCAGCCGATGGTAAATCCAAG
GATGAAGAAGAGCAGTTTGCAGAAGAAGGGTCACAAAATGAGGATGAGGA
TAAAAAGAATGAAGAATATTCTTTGCACCATCAGCTGATTCCGGCATTAA
AAGAAGTTAGCCGTCAGAAACTGAGGAGCTTAAGAATGGCATTGAGAAAG
ATCCATTCGAGTTCGGAAGACGGATTAGTGACAATTAACGAGGCGGTTCA
GACTATTATTGACCTGAAGTTCAACTTACCTTCCAGACTTCTCGACATTT
TGGTTCTGGAATGCAAGATAAAGGAAGAGAAAATTCAGCATGAGAAAATT
ATAAGCTACTTTGAGAAGGCCCATTCACTGACTGGCAGGGATAGCATAGA
CGCAATTGATGCTGATGAAATTGACTCGGGGCTGAGAGTTCAATCTGAAA
TCACGGACGCAGAATTATTCAAAAGAGCTGAATTGCAATTGGTTAAGTCC
AGGGAACCTTTTGATTTGGAGAAATTTAGAAATGTTCTGAAAAAGATGGA
TACCAGTCACAGTGGGATTTTAAAGAAACTTGAGATTGAAAAGGTCGCCA
ATGAATTCTACTGCCCAATTTATGGGTCCCTTCTCCATTCTGTTCTATCG
AAAAGTGATCAAACAAAGAACAATGATATAAGGTGGCCAGAATTTATCAA
TTTTCTTGAAAAGGTTTATAAGTCTGTAGTGGAGAAGGATTCAGAATTTT
TAGAAAAACTGAAAAAAAAAGAGATAGCAAAGCCACTCCCGTCTAGAGAA
ATGCTTCGAAACAAGTTCAAAAGTATTGCAGTAAAAGCGAGAGAAGTAGA
AAGACAAAAGAATAATTCTCCAGGCGCTTTATCGACAGAAAAAGAATCAA
TAAAACCTTCAAATATTGCCAGGAAACCATCCGATGATTCACCAACAGAA
AAACCAACTGTAACAAAATCTCAACCAGCAAAGAATATAAGTCGCGATAA
AAAGGATAAAAAACCAAAAGGAAAGATATTAAAATCAAAAGCTCCCGCAG
TAGACACCACTCCGAGGAAGTCCGGAAATAAGAAAGTTGTTACGAATACT
CCTGCAATCCCGAAACCGGAAATCGTTATCAAACCGGTGCAAGAACTGTT
TGAGAAACCGAAAAATGCAGTTGAATTAGAACTCCCGGGCTTTCCAAAGA
AGCTATTATGGCCCAGTGATTTATCATTAAGCAAAATCGAATTACCCAAT
TCCAAAGACCTCCCAACCGTAAAATTGAAAATTGACTGGGTGTATGGATT
TCGAGGTCGAGATGTGCTCTGCAATTTATCACTGTTGAGCAATGGAGAAT
TGGCCTACTTTACAGGGCGAGTTGTGGTCCTATTTGCATTCTGTCAGAAT
ACTCAAAGGCATTATTGCGAACATTCGGCAGATATTGAATGCTTAACCGT
CCATACAGATGGCATAGTGATAGCCTCAGCTCAAAAAGAACTCCAAGTTT
CAAATTATAAATGGACAGCGAGAATTTGGAGGTCCGACAGTTTGAGTACA
CTTTATATCTTTCAGGAACCTCTCGATTCAAATCCAGGACAACCTATTTT
TATGGATTTCTCTCCTAAAAAAAATTGGCTTCTTGTTTTAGATGACAGCA
AAGATCACATTTTAACTTTATGGGACATCAAAGGTCAAAAGCTTGCTAGT
ACCTCGAGTAGCCACAATAGCGTGCTGTCGATTTCCTTTAGCAAAGTTGA
TGAAAATATTTTTGTTACTACTGGACATGAGCACATCATGTGGTGGGAAT
TCCGCCCGCTTATTGGGGAAATCCAAGCCAAATGCGTGGCCGATTACAGG
GGATTTCTTAAAGCCCGGATAACCTATACTTGCCTTATGACCAATCACAA
TGAACTAATTACCGGTGATTCCAACGGCACAGTATATGTTTGGGCCAATG
GCGCCAACGCAGTTACCAACTATATTAAACATGCACATGAGAATTACATT
CTAGCTTTATGTGTTTACAAGAGTTTTCTATTCACTGGAGATTGCAAAGG
TATGATAAAGCTGTGGCTATTCAACAAGAACCTTGACAACCTTGGAATGA
TAATGTTGCCTCAAGATGAAGGTGGAGTTCGGCACTTGCTAGTTGCTTTT
TCCTCTTCAAATCAGCCAATTTTAATAATAGGAACCACTACAAATTCAAT
TCTTCAATTACTCTTGGCTACCGGTAAAAAGGTGCTTCATCCATTTGAAA
ATGTTGAATTCGGTGTTGATGGTCTCTCAATCGCAATCAGTCAAGGTCAT
TACGGGCAAATAGGCAACGTCTCTCAGGTCAGCACTAATGACAATTGGTT
TATTACAGCGGGGCGGGATAGTCAGATCTGCGTTTTTGACGCAGACAAGC
GACTCGGAGTTCAGAAAACACAAATAAAAGGGCATCAATTCACTTGTGTC
AGTTGGTTGGTTGATGACAGTATTGCCCTCGGAACTATAGAAGGGAGGTG
TATCATTCTGGATCAGCACGAAATCAATTTAGTTGAATCATATAATGAGA
TCATTTTGTCTTGCGGTGTCACCTCTATTTTCAATTTTCCAGACAGTAAA
AAGATTTTCCTTGGAGGACTTGACGGTTGTCTTGTCACTTTAACAAGAAA
TGAGAATTATGACCCAGAAGAAGATGGTTCCAAAAAATGGAATAGTTCTA
TTTTTCAGACCCCAATTTTTGGAATTGACTTCATACAAGGGGGCAGCCTG
GATGGTAAATATTATTTATGGGTCTCCAATAAATTCGGTGGTTTTGTTGC
TTACGAGATTGAACATATGAAAATAGTGGGAAATTTGAGCACTATTAAAA
ATGTCCCTTGGTCACGACAACAATGTGGAATAATACCAGATGTGATCGGA
GCTTGGATGACACCTCTCATGCTCGAGGAAAAGGCTCTTTGTGGATCAGT
TCATCAAACAAAAGAGATATTAGCAATGGGGACCGCAGAAGGAAAAATAG
CAATTTACCGATTTCCTTGCCTGGATAAAGAAGCCTACTGTCACAGCAAT
ATAGCTAGCAATCCAGTGACAAATGTGTTATTTTTGAACTCTGGGGACCA
CCTCATTTCAGTCTCTGGGCAAGATTCGTGTATAACTCAATGGGAAATCA
TATAACAATATTTAGGGCACTCATGTCACTTCAGGATTTCATGAAATTTC
ATTAATTTTTATATTTGCCGGTCTGACGTAATTTATGCCAATTCTTGCGT
TATCGTGTCCCCTATTGAATACCCCATTCAATTTTGGATTTGCAAATGTA
GATATTAAATTTTAAATTATTAAATTTTTATATTTAAATAAATTTCAAAA
ATGGTG
back to top

protein sequence of SMED30020627-orf-1

>SMED30020627-orf-1 ID=SMED30020627-orf-1|Name=SMED30020627-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1151bp
MQQLMSNSTRLAVLLIDCQPKFQPPMSSTTDQKPAVEEGKDAKPKSKLKP
RSVVKSTFDQAKAPVKTSRPSKHSISTKTAAANKQKPLVKAPSRGVMKLR
MIAKFSKLSSADGKSKDEEEQFAEEGSQNEDEDKKNEEYSLHHQLIPALK
EVSRQKLRSLRMALRKIHSSSEDGLVTINEAVQTIIDLKFNLPSRLLDIL
VLECKIKEEKIQHEKIISYFEKAHSLTGRDSIDAIDADEIDSGLRVQSEI
TDAELFKRAELQLVKSREPFDLEKFRNVLKKMDTSHSGILKKLEIEKVAN
EFYCPIYGSLLHSVLSKSDQTKNNDIRWPEFINFLEKVYKSVVEKDSEFL
EKLKKKEIAKPLPSREMLRNKFKSIAVKAREVERQKNNSPGALSTEKESI
KPSNIARKPSDDSPTEKPTVTKSQPAKNISRDKKDKKPKGKILKSKAPAV
DTTPRKSGNKKVVTNTPAIPKPEIVIKPVQELFEKPKNAVELELPGFPKK
LLWPSDLSLSKIELPNSKDLPTVKLKIDWVYGFRGRDVLCNLSLLSNGEL
AYFTGRVVVLFAFCQNTQRHYCEHSADIECLTVHTDGIVIASAQKELQVS
NYKWTARIWRSDSLSTLYIFQEPLDSNPGQPIFMDFSPKKNWLLVLDDSK
DHILTLWDIKGQKLASTSSSHNSVLSISFSKVDENIFVTTGHEHIMWWEF
RPLIGEIQAKCVADYRGFLKARITYTCLMTNHNELITGDSNGTVYVWANG
ANAVTNYIKHAHENYILALCVYKSFLFTGDCKGMIKLWLFNKNLDNLGMI
MLPQDEGGVRHLLVAFSSSNQPILIIGTTTNSILQLLLATGKKVLHPFEN
VEFGVDGLSIAISQGHYGQIGNVSQVSTNDNWFITAGRDSQICVFDADKR
LGVQKTQIKGHQFTCVSWLVDDSIALGTIEGRCIILDQHEINLVESYNEI
ILSCGVTSIFNFPDSKKIFLGGLDGCLVTLTRNENYDPEEDGSKKWNSSI
FQTPIFGIDFIQGGSLDGKYYLWVSNKFGGFVAYEIEHMKIVGNLSTIKN
VPWSRQQCGIIPDVIGAWMTPLMLEEKALCGSVHQTKEILAMGTAEGKIA
IYRFPCLDKEAYCHSNIASNPVTNVLFLNSGDHLISVSGQDSCITQWEII
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0036368cone photoresponse recovery
GO:0000226microtubule cytoskeleton organization
GO:0002244hematopoietic progenitor cell differentiation
GO:0007052mitotic spindle organization
GO:0007405neuroblast proliferation
GO:0007420brain development
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR005108HELP
IPR011992EF-hand-dom_pair
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005509calcium ion binding
GO:0008017microtubule binding
GO:0015631tubulin binding
Vocabulary: cellular component
TermDefinition
GO:0097431mitotic spindle pole
GO:1990023mitotic spindle midzone
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0005875microtubule associated complex
GO:0048471perinuclear region of cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 856..896
e-value: 0.35
score: 19.8
coord: 1110..1148
e-value: 12.0
score: 10.1
coord: 565..601
e-value: 110.0
score: 4.1
coord: 708..748
e-value: 0.69
score: 18.0
coord: 901..937
e-value: 200.0
score: 2.5
coord: 661..699
e-value: 10.0
score: 10.7
coord: 752..789
e-value: 16.0
score: 9.3
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 533..869
e-value: 1.0E-104
score: 353.2
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 521..1147
e-value: 1.0E-104
score: 353.2
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 142..336
e-value: 2.5E-6
score: 29.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 111..138
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 34..48
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 109..138
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 61..83
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 23..93
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 379..460
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 401..415
NoneNo IPR availablePANTHERPTHR13720WD-40 REPEAT PROTEINcoord: 486..1149
NoneNo IPR availablePANTHERPTHR13720:SF9ECHINODERM MICROTUBULE-ASSOCIATED PROTEIN-LIKE 2coord: 486..1149
IPR005108HELPPFAMPF03451HELPcoord: 494..561
e-value: 5.4E-15
score: 55.0
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 171..336
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 758..1149
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 527..843