RRM domain-containing protein

Overview
NameRRM domain-containing protein
Smed IDSMED30020626
Length (bp)2287
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RRM domain-containing protein (SMED30020626) t-SNE clustered cells

Violin plots show distribution of expression levels for RRM domain-containing protein (SMED30020626) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RRM domain-containing protein (SMED30020626) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RRM domain-containing protein (SMED30020626) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020626

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 23

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30020626SMESG000018666.1 Contig3691newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30020626SMESG000018666.1 Contig3691uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30020626SMESG000070758.1 Contig3691newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30020626SMESG000070758.1 Contig3691uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30020626SMESG000018666.1 SmedASXL_015492SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30020626SMESG000018666.1 SmedASXL_015492SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30020626SMESG000018666.1 SmedASXL_015493SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30020626SMESG000018666.1 SmedASXL_015493SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30020626SMESG000018666.1 SMESG000018665.1 dd_Smed_v4_10611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
tail stripeSMED30020626SMESG000018666.1 CUFF.172807.1be_Smed_v2PMID:22543868
Onal et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30020626SMESG000018666.1 CUFF.172807.1be_Smed_v2PMID:22543868
Onal et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
reproductive organSMED30020626SMESG000018666.1 Contig32058newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30020626SMESG000018666.1 Contig32058uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30020626SMESG000018666.1 SMESG000018665.1 Contig38356newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30020626SMESG000018666.1 SMESG000018665.1 Contig38356uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
ovarySMED30020626SMESG000018666.1 KU519616smed_ncbi_20200123PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30020626SMESG000018666.1 KU519616smed_ncbi_20200123PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
testisSMED30020626SMESG000018666.1 KU519616smed_ncbi_20200123PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
spermatogonial stem cellSMED30020626SMESG000018666.1 KU519616smed_ncbi_20200123PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatogoniumSMED30020626SMESG000018666.1 KU519616smed_ncbi_20200123PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatocyteSMED30020626SMESG000018666.1 KU519616smed_ncbi_20200123PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatidSMED30020626SMESG000018666.1 KU519616smed_ncbi_20200123PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
testis primordiumSMED30020626SMESG000018666.1 Contig6439_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: BOLL (boule homolog, RNA binding protein [Source:HGNC Symbol;Acc:HGNC:14273])

HSP 1 Score: 132.494 bits (332), Expect = 1.131e-33
Identity = 83/174 (47.70%), Postives = 108/174 (62.07%), Query Frame = 2
Query:  251 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHL-FPRQEI---SGTVLYNGPV--PYALQNGLTLFQVPGQDYSV---LASQSPQYATMMLPQPTTAMYLPQPQYAYQTPTAVIP 745
            P+ GT+IPNRIFVGGI   T E +L+ FFS YG +K+VKI+NDR G+SKG YGFVTFE QE A+KI++ EAE L +K++KLNIG A+RKQ +  PR  I   +GT+        PY   NG+  F  P +  SV     S+S   + +M+ QP       QP Y YQ  T  +P
Sbjct:   25 PRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFVTFETQEDAQKILQ-EAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTP-EVTSVPPPWPSRSVCSSPVMVAQPIYQ----QPAYHYQATTQYLP 191          
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: BOLL (boule homolog, RNA binding protein [Source:HGNC Symbol;Acc:HGNC:14273])

HSP 1 Score: 132.494 bits (332), Expect = 1.131e-33
Identity = 83/174 (47.70%), Postives = 108/174 (62.07%), Query Frame = 2
Query:  251 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHL-FPRQEI---SGTVLYNGPV--PYALQNGLTLFQVPGQDYSV---LASQSPQYATMMLPQPTTAMYLPQPQYAYQTPTAVIP 745
            P+ GT+IPNRIFVGGI   T E +L+ FFS YG +K+VKI+NDR G+SKG YGFVTFE QE A+KI++ EAE L +K++KLNIG A+RKQ +  PR  I   +GT+        PY   NG+  F  P +  SV     S+S   + +M+ QP       QP Y YQ  T  +P
Sbjct:   25 PRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFVTFETQEDAQKILQ-EAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTP-EVTSVPPPWPSRSVCSSPVMVAQPIYQ----QPAYHYQATTQYLP 191          
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: BOLL (boule homolog, RNA binding protein [Source:HGNC Symbol;Acc:HGNC:14273])

HSP 1 Score: 132.494 bits (332), Expect = 1.277e-33
Identity = 83/174 (47.70%), Postives = 108/174 (62.07%), Query Frame = 2
Query:  251 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHL-FPRQEI---SGTVLYNGPV--PYALQNGLTLFQVPGQDYSV---LASQSPQYATMMLPQPTTAMYLPQPQYAYQTPTAVIP 745
            P+ GT+IPNRIFVGGI   T E +L+ FFS YG +K+VKI+NDR G+SKG YGFVTFE QE A+KI++ EAE L +K++KLNIG A+RKQ +  PR  I   +GT+        PY   NG+  F  P +  SV     S+S   + +M+ QP       QP Y YQ  T  +P
Sbjct:   37 PRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFVTFETQEDAQKILQ-EAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTP-EVTSVPPPWPSRSVCSSPVMVAQPIYQ----QPAYHYQATTQYLP 203          
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: BOLL (boule homolog, RNA binding protein [Source:HGNC Symbol;Acc:HGNC:14273])

HSP 1 Score: 130.183 bits (326), Expect = 2.186e-32
Identity = 81/167 (48.50%), Postives = 105/167 (62.87%), Query Frame = 2
Query:  251 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHL-FPRQEI---SGTVLYNGPV--PYALQNGLTLFQVPGQDYSV---LASQSPQYATMMLPQPTTAMYLPQPQYAYQ 724
            P+ GT+IPNRIFVGGI   T E +L+ FFS YG +K+VKI+NDR G+SKG YGFVTFE QE A+KI++ EAE L +K++KLNIG A+RKQ +  PR  I   +GT+        PY   NG+  F  P +  SV     S+S   + +M+ QP       QP Y YQ
Sbjct:   25 PRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFVTFETQEDAQKILQ-EAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTP-EVTSVPPPWPSRSVCSSPVMVAQPIYQ----QPAYHYQ 184          
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: DAZL (deleted in azoospermia like [Source:HGNC Symbol;Acc:HGNC:2685])

HSP 1 Score: 92.8189 bits (229), Expect = 7.054e-21
Identity = 49/114 (42.98%), Postives = 71/114 (62.28%), Query Frame = 2
Query:  260 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFPRQEISGTVLYNGPVPYALQNGLT 601
            G ++PN +FVGGI     E E++ FF+ YG +K+VKII DRTG+SKG YGFV+F N    +KI++++     F  +KL +G A+RKQ+L         +++N P P   QN  T
Sbjct:   73 GKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRTGVSKG-YGFVSFFNDVDVQKIVESQIN---FHGKKLKLGPAIRKQNLCAYHVQPRPLVFNHPPPPQFQNVWT 182          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: daz-1 (DAZ protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q20870])

HSP 1 Score: 93.2041 bits (230), Expect = 1.313e-19
Identity = 45/89 (50.56%), Postives = 60/89 (67.42%), Query Frame = 2
Query:  251 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRK 517
            P    LIPNRIFVGG  ++TTE EL+  F  +  +KDVK++    G SKG YGF+TFE ++ AE+I K   + L F+ RKLN+G A+RK
Sbjct:   58 PPTYELIPNRIFVGGFPTSTTETELREHFEKFFAVKDVKMVKSLDGQSKG-YGFITFETEDQAEEIRKLTPKQLEFRSRKLNLGPAIRK 145          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: sup-12 (SUPpressor [Source:UniProtKB/TrEMBL;Acc:O45189])

HSP 1 Score: 55.8398 bits (133), Expect = 2.904e-8
Identity = 33/112 (29.46%), Postives = 57/112 (50.89%), Query Frame = 2
Query:  278 RIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFPRQEISGTVLYNGPVPYALQNGL-TLFQ 610
            +IFVGG+  +T+++ L  +F  +G I++  +I DR       YGFVT +++ +AE+  K+    +  ++  +N+ +   K    PR  +    L  G V   L   L  LFQ
Sbjct:   36 KIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAK----PRTNVQLAALAAGQVQLPLTTQLQALFQ 143          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: sup-12 (SUPpressor [Source:UniProtKB/TrEMBL;Acc:O45189])

HSP 1 Score: 53.5286 bits (127), Expect = 3.407e-8
Identity = 33/112 (29.46%), Postives = 57/112 (50.89%), Query Frame = 2
Query:  278 RIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFPRQEISGTVLYNGPVPYALQNGL-TLFQ 610
            +IFVGG+  +T+++ L  +F  +G I++  +I DR       YGFVT +++ +AE+  K+    +  ++  +N+ +   K    PR  +    L  G V   L   L  LFQ
Sbjct:   36 KIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAK----PRTNVQLAALAAGQVQLPLTTQLQALFQ 143          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: msi-1 (MuSashI (Fly neural) family; Neural RNA-binding protein MSI-1 [Source:UniProtKB/TrEMBL;Acc:G5EFS2])

HSP 1 Score: 55.4546 bits (132), Expect = 6.244e-8
Identity = 19/59 (32.20%), Postives = 41/59 (69.49%), Query Frame = 2
Query:  278 RIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIK 454
            ++F+GG+++ +T E++K +F +YG ++D  ++ D+       +GFVTF++ E A+K+ +
Sbjct:  135 KVFIGGLSATSTLEDMKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVCE 193          

HSP 2 Score: 50.447 bits (119), Expect = 2.698e-6
Identity = 20/75 (26.67%), Postives = 41/75 (54.67%), Query Frame = 2
Query:  260 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKE 484
            G+  P ++F+GG++  TT E L+ +F  +G + +  ++ D        +GF+TF +  + +K++ N    L  K+
Sbjct:   40 GSQDPGKMFIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNNREHELDGKK 114          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: H28G03.1 (pep chromosome:WBcel235:X:5216363:5218418:1 gene:WBGene00019249.1 transcript:H28G03.1c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H28G03.1)

HSP 1 Score: 54.6842 bits (130), Expect = 1.389e-7
Identity = 33/114 (28.95%), Postives = 56/114 (49.12%), Query Frame = 2
Query:  278 RIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFPRQEISGTV----LYNGPVPYA--LQNGLT 601
            ++F+GG++ +TT+E+L  +FS +GP+ D  +I D        +GFVTF +  +AE  + +    L         G  V  +   PR+++S  +        P P    L NG+T
Sbjct:   70 KLFIGGLSHDTTDEQLGNYFSQWGPVVDAIVIRDPNTKHSRGFGFVTFASIFSAESAMNDRPHKL--------GGKTVDSKRAIPREQMSSMIPPPFFETDPAPGCKLLLNGIT 175          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: bol (gene:FBgn0011206 transcript:FBtr0076538)

HSP 1 Score: 108.612 bits (270), Expect = 2.130e-26
Identity = 73/174 (41.95%), Postives = 103/174 (59.20%), Query Frame = 2
Query:  251 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFPRQEISGTVLYNGPVPYALQNGLTLFQVPGQDYSVLASQSPQYATMMLPQPTTAMYLPQPQYAYQTPTAVIPS--PNNGQQ 766
            PK GTLIPNRIFVGGI+ +TTE +L   FS+YG +K  KII DR G+SKG YGFVTFE ++ A++ ++ + E ++ ++RKLNI  A++KQ   P Q I  T   NG V Y       +  +P   ++  A+  P  A +    P +AM   QP Y Y +    +P+  P N Q+
Sbjct:   25 PKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGVSKG-YGFVTFETEQEAQR-LQADGECVVLRDRKLNIAPAIKKQP-NPLQSIVAT---NGAVYYTTTPPAPISNIPMDQFA--AAVYPPAAGVPAIYPPSAMQY-QPFYQYYSVPMNVPTIWPQNYQE 189          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: bol (gene:FBgn0011206 transcript:FBtr0344979)

HSP 1 Score: 108.612 bits (270), Expect = 2.130e-26
Identity = 73/174 (41.95%), Postives = 103/174 (59.20%), Query Frame = 2
Query:  251 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFPRQEISGTVLYNGPVPYALQNGLTLFQVPGQDYSVLASQSPQYATMMLPQPTTAMYLPQPQYAYQTPTAVIPS--PNNGQQ 766
            PK GTLIPNRIFVGGI+ +TTE +L   FS+YG +K  KII DR G+SKG YGFVTFE ++ A++ ++ + E ++ ++RKLNI  A++KQ   P Q I  T   NG V Y       +  +P   ++  A+  P  A +    P +AM   QP Y Y +    +P+  P N Q+
Sbjct:   25 PKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGVSKG-YGFVTFETEQEAQR-LQADGECVVLRDRKLNIAPAIKKQP-NPLQSIVAT---NGAVYYTTTPPAPISNIPMDQFA--AAVYPPAAGVPAIYPPSAMQY-QPFYQYYSVPMNVPTIWPQNYQE 189          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: bol (gene:FBgn0011206 transcript:FBtr0076540)

HSP 1 Score: 108.612 bits (270), Expect = 2.130e-26
Identity = 73/174 (41.95%), Postives = 103/174 (59.20%), Query Frame = 2
Query:  251 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFPRQEISGTVLYNGPVPYALQNGLTLFQVPGQDYSVLASQSPQYATMMLPQPTTAMYLPQPQYAYQTPTAVIPS--PNNGQQ 766
            PK GTLIPNRIFVGGI+ +TTE +L   FS+YG +K  KII DR G+SKG YGFVTFE ++ A++ ++ + E ++ ++RKLNI  A++KQ   P Q I  T   NG V Y       +  +P   ++  A+  P  A +    P +AM   QP Y Y +    +P+  P N Q+
Sbjct:   25 PKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGVSKG-YGFVTFETEQEAQR-LQADGECVVLRDRKLNIAPAIKKQP-NPLQSIVAT---NGAVYYTTTPPAPISNIPMDQFA--AAVYPPAAGVPAIYPPSAMQY-QPFYQYYSVPMNVPTIWPQNYQE 189          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: bol (gene:FBgn0011206 transcript:FBtr0076539)

HSP 1 Score: 107.457 bits (267), Expect = 2.477e-26
Identity = 73/173 (42.20%), Postives = 102/173 (58.96%), Query Frame = 2
Query:  251 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFPRQEISGTVLYNGPVPYALQNGLTLFQVPGQDYSVLASQSPQYATMMLPQPTTAMYLPQPQYAYQTPTAVIPS--PNNGQ 763
            PK GTLIPNRIFVGGI+ +TTE +L   FS+YG +K  KII DR G+SKG YGFVTFE ++ A++ ++ + E ++ ++RKLNI  A++KQ   P Q I  T   NG V Y       +  +P   ++  A+  P  A +    P +AM   QP Y Y +    +P+  P N Q
Sbjct:   25 PKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGVSKG-YGFVTFETEQEAQR-LQADGECVVLRDRKLNIAPAIKKQP-NPLQSIVAT---NGAVYYTTTPPAPISNIPMDQFA--AAVYPPAAGVPAIYPPSAMQY-QPFYQYYSVPMNVPTIWPQNYQ 188          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: bol (gene:FBgn0011206 transcript:FBtr0076541)

HSP 1 Score: 107.457 bits (267), Expect = 2.477e-26
Identity = 73/173 (42.20%), Postives = 102/173 (58.96%), Query Frame = 2
Query:  251 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFPRQEISGTVLYNGPVPYALQNGLTLFQVPGQDYSVLASQSPQYATMMLPQPTTAMYLPQPQYAYQTPTAVIPS--PNNGQ 763
            PK GTLIPNRIFVGGI+ +TTE +L   FS+YG +K  KII DR G+SKG YGFVTFE ++ A++ ++ + E ++ ++RKLNI  A++KQ   P Q I  T   NG V Y       +  +P   ++  A+  P  A +    P +AM   QP Y Y +    +P+  P N Q
Sbjct:   25 PKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGVSKG-YGFVTFETEQEAQR-LQADGECVVLRDRKLNIAPAIKKQP-NPLQSIVAT---NGAVYYTTTPPAPISNIPMDQFA--AAVYPPAAGVPAIYPPSAMQY-QPFYQYYSVPMNVPTIWPQNYQ 188          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: dazl (deleted in azoospermia-like [Source:NCBI gene;Acc:58039])

HSP 1 Score: 72.7886 bits (177), Expect = 3.635e-14
Identity = 36/88 (40.91%), Postives = 52/88 (59.09%), Query Frame = 2
Query:  260 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQH 523
            G + PN +FVGGI     E E++ FF+ YG +K+VKII  R G+ KG YGFV F      + I+    + + FK +KL +G A+ K+ 
Sbjct:   25 GKMTPNTLFVGGIDMKVDENEIREFFAKYGSVKEVKIITYRGGICKG-YGFVYFSEDVDIQTIVD---QPISFKGKKLKLGPAIMKER 108          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: dazl (deleted in azoospermia-like [Source:NCBI gene;Acc:58039])

HSP 1 Score: 72.7886 bits (177), Expect = 3.880e-14
Identity = 36/88 (40.91%), Postives = 52/88 (59.09%), Query Frame = 2
Query:  260 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQH 523
            G + PN +FVGGI     E E++ FF+ YG +K+VKII  R G+ KG YGFV F      + I+    + + FK +KL +G A+ K+ 
Sbjct:   25 GKMTPNTLFVGGIDMKVDENEIREFFAKYGSVKEVKIITYRGGICKG-YGFVYFSEDVDIQTIV----DPISFKGKKLKLGPAIMKER 107          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: dazl (deleted in azoospermia-like [Source:NCBI gene;Acc:58039])

HSP 1 Score: 72.7886 bits (177), Expect = 4.643e-14
Identity = 36/88 (40.91%), Postives = 52/88 (59.09%), Query Frame = 2
Query:  260 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQH 523
            G + PN +FVGGI     E E++ FF+ YG +K+VKII  R G+ KG YGFV F      + I+    + + FK +KL +G A+ K+ 
Sbjct:   25 GKMTPNTLFVGGIDMKVDENEIREFFAKYGSVKEVKIITYRGGICKG-YGFVYFSEDVDIQTIVD---QPISFKGKKLKLGPAIMKER 108          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: dazl (deleted in azoospermia-like [Source:NCBI gene;Acc:58039])

HSP 1 Score: 73.1738 bits (178), Expect = 5.213e-14
Identity = 36/88 (40.91%), Postives = 52/88 (59.09%), Query Frame = 2
Query:  260 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQH 523
            G + PN +FVGGI     E E++ FF+ YG +K+VKII  R G+ KG YGFV F      + I+    + + FK +KL +G A+ K+ 
Sbjct:   42 GKMTPNTLFVGGIDMKVDENEIREFFAKYGSVKEVKIITYRGGICKG-YGFVYFSEDVDIQTIVD---QPISFKGKKLKLGPAIMKER 125          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: dazl (deleted in azoospermia-like [Source:NCBI gene;Acc:58039])

HSP 1 Score: 73.1738 bits (178), Expect = 5.213e-14
Identity = 36/88 (40.91%), Postives = 52/88 (59.09%), Query Frame = 2
Query:  260 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQH 523
            G + PN +FVGGI     E E++ FF+ YG +K+VKII  R G+ KG YGFV F      + I+    + + FK +KL +G A+ K+ 
Sbjct:   42 GKMTPNTLFVGGIDMKVDENEIREFFAKYGSVKEVKIITYRGGICKG-YGFVYFSEDVDIQTIVD---QPISFKGKKLKLGPAIMKER 125          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: dazl (deleted in azoospermia-like [Source:NCBI gene;Acc:394676])

HSP 1 Score: 81.2629 bits (199), Expect = 2.934e-16
Identity = 40/86 (46.51%), Postives = 57/86 (66.28%), Query Frame = 2
Query:  260 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRK 517
            G +IPN +FVGGI     E  +   F  YG +KD+KII DRTG+SKG YGFV+F ++   +KI+K++   + F  +KL +G A+RK
Sbjct:   25 GKVIPNTVFVGGIDITMDEMAIGNLFEKYGKVKDLKIITDRTGVSKG-YGFVSFYDEVDVQKIVKSQ---INFHGKKLKLGPAIRK 106          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: deup1 (deuterosome assembly protein 1 [Source:Xenbase;Acc:XB-GENE-5961526])

HSP 1 Score: 61.2326 bits (147), Expect = 3.255e-9
Identity = 26/69 (37.68%), Postives = 43/69 (62.32%), Query Frame = 2
Query:  266 LIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETL 472
            L   +IFVGGI  +T E  L+ +F SYG I+ ++++ DR    K  + FVTF++ +T +KI+  +  T+
Sbjct:  115 LTVKKIFVGGIKEDTEEYHLRDYFQSYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTI 183          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: msi1 (musashi RNA binding protein 1 [Source:NCBI gene;Acc:496961])

HSP 1 Score: 59.3066 bits (142), Expect = 1.058e-8
Identity = 43/165 (26.06%), Postives = 73/165 (44.24%), Query Frame = 2
Query:  275 NRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFPRQEISGTVLYNGPVPY---ALQNGLTLFQVPGQDYSVLASQS-----PQYATMMLPQPTTAMYLPQPQYAYQTPTAVIP 745
             +IFVGG++ NTT E++K +F  +G + D  ++ D+T      +GFVTFE ++  EK+       +    + +    A  K+ + P   + G    +  +PY   A   G+ +   PG   +  AS+S     P Y T   P    A+      +     +  IP
Sbjct:   88 KKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFEGEDIVEKVCDIHFHEI--NNKMVECKKAQPKEVMSPTGSVRGR---SRVMPYGMDAFMLGIGMLGYPGFQAATYASRSYTGIAPGY-TYQFPGKFVALMSICSMFCMHCESCTIP 246          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: psd3 (pleckstrin and Sec7 domain containing 3 [Source:Xenbase;Acc:XB-GENE-6467528])

HSP 1 Score: 58.9214 bits (141), Expect = 1.186e-8
Identity = 25/63 (39.68%), Postives = 40/63 (63.49%), Query Frame = 2
Query:  266 LIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIK 454
            L   +IFVGGI  +T E  L+ +F  YG I+ ++I+ DR    K  + FVTFE+ ++ +KI++
Sbjct:  102 LTVKKIFVGGIKEDTEEHHLREYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFEDHDSVDKIVR 164          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: msi1 (musashi RNA binding protein 1 [Source:NCBI gene;Acc:496961])

HSP 1 Score: 58.5362 bits (140), Expect = 1.663e-8
Identity = 35/128 (27.34%), Postives = 62/128 (48.44%), Query Frame = 2
Query:  275 NRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFPRQEISGTVLYNGPVPYALQN---GLTLFQVPGQDYSVLASQS 649
             +IFVGG++ NTT E++K +F  +G + D  ++ D+T      +GFVTFE ++  EK+       +    + +    A  K+ + P   + G       +PY +     G+ +   PG   +  AS+S
Sbjct:  109 KKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFEGEDIVEKVCDIHFHEI--NNKMVECKKAQPKEVMSPTGSVRGRSRV---MPYGMDAFMLGIGMLGYPGFQAATYASRS 231          

HSP 2 Score: 51.9878 bits (123), Expect = 2.232e-6
Identity = 24/83 (28.92%), Postives = 43/83 (51.81%), Query Frame = 2
Query:  272 PNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQ 520
            P ++F+GG++  TT+E L+ +FS +G +K+  ++ D        +GFVTF +Q   +K++      L  K     +    R Q
Sbjct:   19 PCKMFIGGLSWQTTQEGLREYFSHFGDVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQ 101          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Boll (boule homolog, RNA binding protein [Source:MGI Symbol;Acc:MGI:1922638])

HSP 1 Score: 130.568 bits (327), Expect = 2.942e-33
Identity = 79/173 (45.66%), Postives = 105/173 (60.69%), Query Frame = 2
Query:  251 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHL-FPRQEI---SGTVLYNGPV--PYALQNGLTLFQVPG--QDYSVLASQSPQYATMMLPQPTTAMYLPQPQYAYQTPTAVIP 745
            P+ GT+IPNRIFVGGI   T E +L+ FFS YG +K+VKI+NDR G+SKG YGF+TFE QE A+KI++ EAE L +K++KLNIG A+RKQ +  PR  +   +GT+        PY   NG+  F  P          S+S   + +M+ QP       QP Y YQ P   +P
Sbjct:   24 PRYGTVIPNRIFVGGIDFKTNENDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFITFETQEDAQKILQ-EAEKLNYKDKKLNIGPAIRKQQVGIPRSSLMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPSWPSRSISSSPVMVAQPVYQ----QPAYHYQAPAQCLP 190          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Boll (boule homolog, RNA binding protein [Source:MGI Symbol;Acc:MGI:1922638])

HSP 1 Score: 130.954 bits (328), Expect = 2.942e-33
Identity = 79/173 (45.66%), Postives = 105/173 (60.69%), Query Frame = 2
Query:  251 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHL-FPRQEI---SGTVLYNGPV--PYALQNGLTLFQVPG--QDYSVLASQSPQYATMMLPQPTTAMYLPQPQYAYQTPTAVIP 745
            P+ GT+IPNRIFVGGI   T E +L+ FFS YG +K+VKI+NDR G+SKG YGF+TFE QE A+KI++ EAE L +K++KLNIG A+RKQ +  PR  +   +GT+        PY   NG+  F  P          S+S   + +M+ QP       QP Y YQ P   +P
Sbjct:   37 PRYGTVIPNRIFVGGIDFKTNENDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFITFETQEDAQKILQ-EAEKLNYKDKKLNIGPAIRKQQVGIPRSSLMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPSWPSRSISSSPVMVAQPVYQ----QPAYHYQAPAQCLP 203          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Boll (boule homolog, RNA binding protein [Source:MGI Symbol;Acc:MGI:1922638])

HSP 1 Score: 120.168 bits (300), Expect = 2.119e-31
Identity = 59/96 (61.46%), Postives = 76/96 (79.17%), Query Frame = 2
Query:  251 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHL-FPR 535
            P+ GT+IPNRIFVGGI   T E +L+ FFS YG +K+VKI+NDR G+SKG YGF+TFE QE A+KI++ EAE L +K++KLNIG A+RKQ +  PR
Sbjct:   37 PRYGTVIPNRIFVGGIDFKTNENDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFITFETQEDAQKILQ-EAEKLNYKDKKLNIGPAIRKQQVGIPR 130          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Dazl (deleted in azoospermia-like [Source:MGI Symbol;Acc:MGI:1342328])

HSP 1 Score: 90.1225 bits (222), Expect = 2.676e-19
Identity = 43/89 (48.31%), Postives = 63/89 (70.79%), Query Frame = 2
Query:  260 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHL 526
            G ++PN +FVGGI     E E++ FF+ YG +K+VKII DRTG+SKG YGFV+F N    +KI++++   + F  +KL +G A+RKQ+L
Sbjct:   35 GKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRTGVSKG-YGFVSFYNDVDVQKIVESQ---INFHGKKLKLGPAIRKQNL 119          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Dazl (deleted in azoospermia-like [Source:MGI Symbol;Acc:MGI:1342328])

HSP 1 Score: 87.0409 bits (214), Expect = 1.871e-18
Identity = 42/86 (48.84%), Postives = 61/86 (70.93%), Query Frame = 2
Query:  269 IPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHL 526
            +PN +FVGGI     E E++ FF+ YG +K+VKII DRTG+SKG YGFV+F N    +KI++++   + F  +KL +G A+RKQ+L
Sbjct:    1 MPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRTGVSKG-YGFVSFYNDVDVQKIVESQ---INFHGKKLKLGPAIRKQNL 82          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8N9W6|BOLL_HUMAN (Protein boule-like OS=Homo sapiens OX=9606 GN=BOLL PE=1 SV=2)

HSP 1 Score: 132.494 bits (332), Expect = 5.433e-33
Identity = 83/174 (47.70%), Postives = 108/174 (62.07%), Query Frame = 2
Query:  251 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHL-FPRQEI---SGTVLYNGPV--PYALQNGLTLFQVPGQDYSV---LASQSPQYATMMLPQPTTAMYLPQPQYAYQTPTAVIP 745
            P+ GT+IPNRIFVGGI   T E +L+ FFS YG +K+VKI+NDR G+SKG YGFVTFE QE A+KI++ EAE L +K++KLNIG A+RKQ +  PR  I   +GT+        PY   NG+  F  P +  SV     S+S   + +M+ QP       QP Y YQ  T  +P
Sbjct:   25 PRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFVTFETQEDAQKILQ-EAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTP-EVTSVPPPWPSRSVCSSPVMVAQPIYQ----QPAYHYQATTQYLP 191          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8WP23|BOLL_MACFA (Protein boule-like OS=Macaca fascicularis OX=9541 GN=BOLL PE=2 SV=2)

HSP 1 Score: 130.568 bits (327), Expect = 2.411e-32
Identity = 82/174 (47.13%), Postives = 107/174 (61.49%), Query Frame = 2
Query:  251 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHL-FPRQEI---SGTVLYNGPV--PYALQNGLTLFQVPGQDYSV---LASQSPQYATMMLPQPTTAMYLPQPQYAYQTPTAVIP 745
            P+ GT+IPNRIFVGGI   T E +L+ FFS YG +K+VKI+NDR G+SKG YGFVTFE QE A+KI++ EAE L +K++KLNIG A+RKQ +  PR  I   +GT+        PY   NG+  F  P +  SV     S+S   + +M+ QP       QP Y YQ     +P
Sbjct:   25 PRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFVTFETQEDAQKILQ-EAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTP-EVTSVPPPWPSRSVCSSPVMVAQPIYQ----QPAYHYQATAQYLP 191          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q924M5|BOLL_MOUSE (Protein boule-like OS=Mus musculus OX=10090 GN=Boll PE=1 SV=2)

HSP 1 Score: 130.568 bits (327), Expect = 2.412e-32
Identity = 79/173 (45.66%), Postives = 105/173 (60.69%), Query Frame = 2
Query:  251 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHL-FPRQEI---SGTVLYNGPV--PYALQNGLTLFQVPG--QDYSVLASQSPQYATMMLPQPTTAMYLPQPQYAYQTPTAVIP 745
            P+ GT+IPNRIFVGGI   T E +L+ FFS YG +K+VKI+NDR G+SKG YGF+TFE QE A+KI++ EAE L +K++KLNIG A+RKQ +  PR  +   +GT+        PY   NG+  F  P          S+S   + +M+ QP       QP Y YQ P   +P
Sbjct:   25 PRYGTVIPNRIFVGGIDFKTNENDLRKFFSQYGSVKEVKIVNDRAGVSKG-YGFITFETQEDAQKILQ-EAEKLNYKDKKLNIGPAIRKQQVGIPRSSLMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPSWPSRSISSSPVMVAQPVYQ----QPAYHYQAPAQCLP 191          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q24207|BOULE_DROME (Protein boule OS=Drosophila melanogaster OX=7227 GN=bol PE=1 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 2.135e-25
Identity = 73/174 (41.95%), Postives = 103/174 (59.20%), Query Frame = 2
Query:  251 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFPRQEISGTVLYNGPVPYALQNGLTLFQVPGQDYSVLASQSPQYATMMLPQPTTAMYLPQPQYAYQTPTAVIPS--PNNGQQ 766
            PK GTLIPNRIFVGGI+ +TTE +L   FS+YG +K  KII DR G+SKG YGFVTFE ++ A++ ++ + E ++ ++RKLNI  A++KQ   P Q I  T   NG V Y       +  +P   ++  A+  P  A +    P +AM   QP Y Y +    +P+  P N Q+
Sbjct:   25 PKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGVSKG-YGFVTFETEQEAQR-LQADGECVVLRDRKLNIAPAIKKQP-NPLQSIVAT---NGAVYYTTTPPAPISNIPMDQFA--AAVYPPAAGVPAIYPPSAMQY-QPFYQYYSVPMNVPTIWPQNYQE 189          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q92904|DAZL_HUMAN (Deleted in azoospermia-like OS=Homo sapiens OX=9606 GN=DAZL PE=1 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 7.822e-20
Identity = 62/158 (39.24%), Postives = 86/158 (54.43%), Query Frame = 2
Query:  260 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFPRQEISGTVLYNGPVPYALQNGLTLFQVPGQDYSVLASQSPQYATMMLPQPTTAMYLPQPQYAYQTPT 733
            G ++PN +FVGGI     E E++ FF+ YG +K+VKII DRTG+SKG YGFV+F N    +KI++++   + F  +KL +G A+RKQ+L         +++N P P   QN  T               +P   T M  QPTT M  P  QY    PT
Sbjct:   35 GKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRTGVSKG-YGFVSFFNDVDVQKIVESQ---INFHGKKLKLGPAIRKQNLCAYHVQPRPLVFNHPPPPQFQNVWT---------------NPNTETYM--QPTTTMN-PITQYVQAYPT 170          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A172RVQ0 (Boule 1 RNA-binding protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 2.737e-66
Identity = 124/129 (96.12%), Postives = 125/129 (96.90%), Query Frame = 2
Query:  149 STDSQLTPKVDTLAQEFQVSLXXXXXXXXXXXXXPKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFPR 535
            STDSQLTPKVDTLAQEFQVSLAAVNQATMTAAANPKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQ    +
Sbjct:   12 STDSQLTPKVDTLAQEFQVSLAAVNQATMTAAANPKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQKFLEQ 140          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A4S2M8S9 (RRM domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001898 PE=4 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 2.515e-61
Identity = 110/177 (62.15%), Postives = 137/177 (77.40%), Query Frame = 2
Query:  251 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFPRQEISGTVLY-NGPVPYALQNGLTLFQVPGQDYSVLASQSPQYATMMLPQP--TTAMYLPQPQYAYQTPTAVIPSPNNGQQVT 772
            PK GTLIPNRIFVGGI SNTTE+ELK FFSS+G +KDVKII+DR G+SKGSYGFVTFE+QE AEKIIKNE+ETLIFK+RKLNIGHA+RKQ +FPR ++   + +  G +PY++QNG+ +F +PGQ+Y +L   +  YATMMLPQP   T +YLP    A  +P A +    + QQVT
Sbjct:   37 PKFGTLIPNRIFVGGIPSNTTEQELKSFFSSFGQVKDVKIISDRLGVSKGSYGFVTFESQEMAEKIIKNESETLIFKDRKLNIGHAIRKQQMFPRADLPAALFFAGGAMPYSIQNGMAVFSLPGQEYPMLTQATAPYATMMLPQPGGGTTLYLPSAASATASPYAQL----SQQQVT 209          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A419QF17 (Protein boule-like OS=Clonorchis sinensis OX=79923 GN=BOLL PE=4 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 8.505e-61
Identity = 110/177 (62.15%), Postives = 137/177 (77.40%), Query Frame = 2
Query:  251 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFPRQEISGTVLY-NGPVPYALQNGLTLFQVPGQDYSVLASQSPQYATMMLPQP--TTAMYLPQPQYAYQTPTAVIPSPNNGQQVT 772
            PK GTLIPNRIFVGGI SNTTE+ELK FFSS+G +KDVKII+DR G+SKGSYGFVTFE+QE AEKIIKNE+ETLIFK+RKLNIGHA+RKQ +FPR ++   + +  G +PY++QNG+ +F +PGQ+Y +L   +  YATMMLPQP   T +YLP    A  +P A +    + QQVT
Sbjct:   37 PKFGTLIPNRIFVGGIPSNTTEQELKSFFSSFGQVKDVKIISDRLGVSKGSYGFVTFESQEMAEKIIKNESETLIFKDRKLNIGHAIRKQQMFPRADLPAALFFAGGAMPYSIQNGMAVFSLPGQEYPMLTQATAPYATMMLPQPGGGTTLYLPSAASATASPYAQL----SQQQVT 209          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A075AGA8 (RRM domain-containing protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_13550 PE=4 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 9.672e-61
Identity = 110/177 (62.15%), Postives = 137/177 (77.40%), Query Frame = 2
Query:  251 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFPRQEISGTVLY-NGPVPYALQNGLTLFQVPGQDYSVLASQSPQYATMMLPQP--TTAMYLPQPQYAYQTPTAVIPSPNNGQQVT 772
            PK GTLIPNRIFVGGI SNTTE+ELK FFSS+G +KDVKII+DR G+SKGSYGFVTFE+QE AEKIIKNE+ETLIFK+RKLNIGHA+RKQ +FPR ++   + +  G +PY++QNG+ +F +PGQ+Y +L   +  YATMMLPQP   T +YLP    A  +P A +    + QQVT
Sbjct:    9 PKFGTLIPNRIFVGGIPSNTTEQELKSFFSSFGQVKDVKIISDRLGVSKGSYGFVTFESQEMAEKIIKNESETLIFKDRKLNIGHAIRKQQMFPRADLPAALFFAGGAMPYSIQNGMAVFSLPGQEYPMLTQATAPYATMMLPQPGGGTTLYLPSAASATASPYAQL----SQQQVT 181          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A4S2MEX8 (RRM domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001898 PE=4 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 1.319e-60
Identity = 110/177 (62.15%), Postives = 137/177 (77.40%), Query Frame = 2
Query:  251 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFPRQEISGTVLY-NGPVPYALQNGLTLFQVPGQDYSVLASQSPQYATMMLPQP--TTAMYLPQPQYAYQTPTAVIPSPNNGQQVT 772
            PK GTLIPNRIFVGGI SNTTE+ELK FFSS+G +KDVKII+DR G+SKGSYGFVTFE+QE AEKIIKNE+ETLIFK+RKLNIGHA+RKQ +FPR ++   + +  G +PY++QNG+ +F +PGQ+Y +L   +  YATMMLPQP   T +YLP    A  +P A +    + QQVT
Sbjct:   37 PKFGTLIPNRIFVGGIPSNTTEQELKSFFSSFGQVKDVKIISDRLGVSKGSYGFVTFESQEMAEKIIKNESETLIFKDRKLNIGHAIRKQQMFPRADLPAALFFAGGAMPYSIQNGMAVFSLPGQEYPMLTQATAPYATMMLPQPGGGTTLYLPSAASATASPYAQL----SQQQVT 209          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000005184.2 (pep primary_assembly:Astyanax_mexicanus-2.0:10:7750630:7761219:-1 gene:ENSAMXG00000005058.2 transcript:ENSAMXT00000005184.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.161 bits (287), Expect = 2.569e-28
Identity = 67/187 (35.83%), Postives = 103/187 (55.08%), Query Frame = 2
Query:  260 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQ---HLFPRQEISGTVL-YNGPV-----------PYALQNGLTLFQVPGQDYSVLASQSPQY----------ATMMLPQPTTAMYLPQPQYAYQTPTAVIP 745
            GT+IPNRIFVGGI     E +L+ FFS YG I++V I+ DR G+SKG YGFVTFE QE A+KI+ ++A+ L F+++++N+G A RKQ   H     +  G+ + Y  P            PY   NG+  F  P  +     + SP +          +++M+    +++ +PQP +  Q  +  +P
Sbjct:   32 GTVIPNRIFVGGIGGKAKENDLRCFFSEYGVIREVNIVTDRDGISKG-YGFVTFETQEDAQKIL-HDADRLSFRDKRINVGQAFRKQLKGHYSYTADTQGSSMAYQAPFGTTYLTTPTGYPYTYHNGVAYFHTPEPN-----TLSPSHWHAPPHTMSGSSVMVTHSASSICIPQPYHNSQASSQYVP 211          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: dazl (deleted in azoospermia like [Source:NCBI gene;Acc:103038434])

HSP 1 Score: 74.7146 bits (182), Expect = 9.738e-15
Identity = 37/88 (42.05%), Postives = 53/88 (60.23%), Query Frame = 2
Query:  260 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQH 523
            G L PN +FVGGI     E E++ FF+ YG +K+VKII  R G+ KG YGFV F      + I++ +   + FK +KL +G A+ K+ 
Sbjct:   26 GKLTPNTLFVGGIDMKVEENEIRDFFARYGAVKEVKIITYRGGICKG-YGFVYFSEDVDIQTIVEQQ---ISFKGKKLKLGPAIMKER 109          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: msi2b (RNA-binding protein Musashi homolog 2 [Source:NCBI gene;Acc:103023867])

HSP 1 Score: 60.4622 bits (145), Expect = 2.764e-9
Identity = 30/94 (31.91%), Postives = 54/94 (57.45%), Query Frame = 2
Query:  251 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFP 532
            PK+ T    +IFVGG+++NT  E++K +F  +G ++D  ++ D+T      +GFVTFEN++  EK+ +     +    + +    A  K+ +FP
Sbjct:  103 PKMVTRT-KKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEI--NNKMVECKKAQPKEVMFP 193          

HSP 2 Score: 51.2174 bits (121), Expect = 2.626e-6
Identity = 22/83 (26.51%), Postives = 43/83 (51.81%), Query Frame = 2
Query:  272 PNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQ 520
            P ++F+GG++  T+ + L+ +FS +G I++  ++ D T      +GFVTF +  + +K++      L  K     +    R Q
Sbjct:   20 PGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADAASVDKVLGQPHHELDSKTIDPKVAFPRRAQ 102          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: msi2a (RNA-binding protein Musashi homolog 2-like [Source:NCBI gene;Acc:103045937])

HSP 1 Score: 60.4622 bits (145), Expect = 2.799e-9
Identity = 30/94 (31.91%), Postives = 54/94 (57.45%), Query Frame = 2
Query:  251 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFP 532
            PK+ T    +IFVGG+++NT  E++K +F  +G ++D  ++ D+T      +GFVTFEN++  EK+ +     +    + +    A  K+ +FP
Sbjct:  103 PKMVTRT-KKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEI--NNKMVECKKAQPKEVMFP 193          

HSP 2 Score: 51.2174 bits (121), Expect = 2.455e-6
Identity = 22/83 (26.51%), Postives = 43/83 (51.81%), Query Frame = 2
Query:  272 PNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQ 520
            P ++F+GG++  T+ + L+ +FS +G I++  ++ D T      +GFVTF +  + +K++      L  K     +    R Q
Sbjct:   20 PGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADAASVDKVLAQPHHELDSKTIDPKVAFPRRAQ 102          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: msi1 (musashi RNA-binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-050320-86])

HSP 1 Score: 60.8474 bits (146), Expect = 2.868e-9
Identity = 27/68 (39.71%), Postives = 44/68 (64.71%), Query Frame = 2
Query:  251 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIK 454
            PK+ T    +IFVGG++ NTT E++K +F  +G + D  ++ D+T      +GFVTFEN++  EK+ +
Sbjct:  174 PKLVTRT-KKIFVGGLSVNTTIEDVKQYFDQFGKVDDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCE 240          
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Match: BOLL (boule homolog, RNA binding protein [Source:HGNC Symbol;Acc:HGNC:14273])

HSP 1 Score: 139.813 bits (351), Expect = 4.663e-37
Identity = 78/170 (45.88%), Postives = 107/170 (62.94%), Query Frame = 2
Query:  251 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHL----FPRQEISGTVLYNGPV--PYALQNGLTLFQVPGQDYSVLASQSPQ----YATMMLPQPTTAMYLPQPQYAYQTP 730
            P+ GT+IPNRIFVGGI     E ELK +F+ +G +KDVKIINDR G+SKG YGFVTFE+QE A+K I+ EAE +++K++KLNIG A+RKQ +    FP    SG+++       P+   NG+  FQ P    ++     PQ    +  M++P P  +    QP Y+YQ P
Sbjct:   34 PRYGTVIPNRIFVGGIDFKVNEAELKKYFTQFGVVKDVKIINDRAGVSKG-YGFVTFESQEDAQK-IQQEAEKIMYKDKKLNIGPAIRKQQVGFPQFPLTPASGSMVLTTSTGQPFLFHNGVAYFQQPD---AMPVQMPPQTYYSHQPMLIPSPQASPVFQQPAYSYQAP 198          
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Match: HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0 [Source:HGNC Symbol;Acc:HGNC:5030])

HSP 1 Score: 63.1586 bits (152), Expect = 7.686e-11
Identity = 30/87 (34.48%), Postives = 49/87 (56.32%), Query Frame = 2
Query:  266 LIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHL 526
            L   +IFVGGI  NT E+ L+ +FS YG ++ V ++ DR    K  +GFVTF + +  +K++  +  T+     K  +  A+ KQ +
Sbjct:  121 LKVKKIFVGGIKDNTDEDHLRDYFSEYGMVESVDVMEDRQSGKKRGFGFVTFSDHDAVDKVVVQKYHTI--NGHKAEVRKALSKQEM 205          
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Match: HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0 [Source:HGNC Symbol;Acc:HGNC:5030])

HSP 1 Score: 60.077 bits (144), Expect = 2.113e-10
Identity = 25/69 (36.23%), Postives = 43/69 (62.32%), Query Frame = 2
Query:  266 LIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETL 472
            L   +IFVGGI  +T E+ L+ +F  YG ++  +++ DR+   K  +GFVTF + +T +K+I  +  T+
Sbjct:   97 LKVKKIFVGGIRDDTDEQHLREYFQVYGDVEAAEVMEDRSTGKKRGFGFVTFSDHDTVDKVIVQKYHTI 165          
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Match: rbm24a (RNA binding motif protein 24a [Source:NCBI gene;Acc:405801])

HSP 1 Score: 59.6918 bits (143), Expect = 4.108e-10
Identity = 30/75 (40.00%), Postives = 47/75 (62.67%), Query Frame = 2
Query:  278 RIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDR-TGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNI 499
            +IFVGG+  +TT+  L+ FF ++G I +  +I DR +G S+G YGFVT  ++ +AE+  K+     I   RK N+
Sbjct:   13 KIFVGGLPYHTTDASLRAFFEAFGEIDEAVVITDRQSGKSRG-YGFVTMADRASAERACKD--PNPIIDGRKANV 84          
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Match: rbmx (RNA binding motif protein X-linked [Source:NCBI gene;Acc:321860])

HSP 1 Score: 60.8474 bits (146), Expect = 5.143e-10
Identity = 33/87 (37.93%), Postives = 52/87 (59.77%), Query Frame = 2
Query:  257 IGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDR-TGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVR 514
            +G   P ++FVGG+  +TTE+ L+  FS YG + DV ++ DR T LS+G + FVTF N E A K  + +A   + + R + +  A +
Sbjct:    1 MGEADPGKLFVGGLNIDTTEKALEATFSKYGRVADVLLMKDRETNLSRG-FAFVTFANPEDA-KEAERDANGKVLEGRAMRVDQATK 85          
BLAST of RRM domain-containing protein vs. Ensembl Yeast
Match: HRP1 (Subunit of cleavage factor I; cleavage factor I is a five-subunit complex required for the cleavage and polyadenylation of pre-mRNA 3' ends; RRM-containing heteronuclear RNA binding protein and hnRNPA/B family member that binds to poly (A) signal sequences; required for genome stability [Source:SGD;Acc:S000005483])

HSP 1 Score: 57.3806 bits (137), Expect = 5.111e-9
Identity = 29/78 (37.18%), Postives = 52/78 (66.67%), Query Frame = 2
Query:  278 RIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDR-TGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHA 508
            +IFVGGI  +   +E + FFS +G I D +++ D+ TG S+G +GFVT+++ +  +++ +N+   + FK+RK+ I  A
Sbjct:  244 KIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRG-FGFVTYDSADAVDRVCQNKF--IDFKDRKIEIKRA 318          

HSP 2 Score: 55.0694 bits (131), Expect = 2.438e-8
Identity = 23/60 (38.33%), Postives = 43/60 (71.67%), Query Frame = 2
Query:  278 RIFVGGITSNTTEEELKIFFSSYGPIKDVKIIND-RTGLSKGSYGFVTFENQETAEKIIK 454
            ++F+GG+  +TTE+ L+ +F  YG + D+KI+ D  TG S+G +GF++FE   + ++++K
Sbjct:  160 KMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRG-FGFLSFEKPSSVDEVVK 218          
BLAST of RRM domain-containing protein vs. Ensembl Yeast
Match: NAM8 (RNA binding protein, component of the U1 snRNP protein; mutants are defective in meiotic recombination and in formation of viable spores, involved in the formation of DSBs through meiosis-specific splicing of REC107 pre-mRNA; Nam8p regulon embraces the meiotic pre-mRNAs of REC107, HFM1, AMA1 SPO22 and PCH2; the putative RNA binding domains RRM2 and RRM3 are required for Nam8p meiotic function [Source:SGD;Acc:S000001128])

HSP 1 Score: 50.447 bits (119), Expect = 6.892e-7
Identity = 33/97 (34.02%), Postives = 53/97 (54.64%), Query Frame = 2
Query:  281 IFVGGITSNTTEEEL-KIFFSSYGPIKDVKIINDR-TGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFPRQEISGTVLYN 565
            IFVG +  N TE +L ++F + Y      KI++D+ TG+SKG YGFV F N +  +++  +E + +    R + +G    +Q     Q +SG   YN
Sbjct:  165 IFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKG-YGFVKFTNSD-EQQLALSEMQGVFLNGRAIKVGPTSGQQ-----QHVSGNNDYN 254          
BLAST of RRM domain-containing protein vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 47.7506 bits (112), Expect = 6.016e-6
Identity = 30/91 (32.97%), Postives = 48/91 (52.75%), Query Frame = 2
Query:  281 IFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIK--NEAETLIFKERKLNIGHAVRKQ---HLFPRQ 538
            ++V  I S TT+E+ +  F+ +GPI    +  D  G  KG +GFV +E  E A K ++  N++E       KL +G A +K    H+  +Q
Sbjct:  221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKG-FGFVNYEKHEDAVKAVEALNDSE---LNGEKLYVGRAQKKNERMHVLKKQ 307          
BLAST of RRM domain-containing protein vs. Ensembl Yeast
Match: RIE1 (Putative RNA binding protein; localizes to stress granules induced by glucose deprivation; interacts with Rbg1p in a two-hybrid assay; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003482])

HSP 1 Score: 47.3654 bits (111), Expect = 7.704e-6
Identity = 22/50 (44.00%), Postives = 30/50 (60.00%), Query Frame = 2
Query:  272 PNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTF 421
            P  IFVGGI  + +  EL   FS YGPI  +K+I D+T      YGF+++
Sbjct:  194 PGNIFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISY 243          
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Match: EDO40536 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6X1])

HSP 1 Score: 83.5741 bits (205), Expect = 1.088e-18
Identity = 42/87 (48.28%), Postives = 61/87 (70.11%), Query Frame = 2
Query:  263 TLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIIND-RTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQ 520
             + P R+FVGG+   TTE EL+ FFS++GP+ DV+I+ D RTGL+KG +GF+TF  +E A+K+I  E   + FK R L +  A+RK+
Sbjct:   13 VIYPTRVFVGGLARGTTELELETFFSNFGPVADVRIVCDRRTGLNKG-FGFITFSLEEPAKKLI--EQNNIDFKGRSLRLRQAIRKK 96          
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Match: EDO45185 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTC5])

HSP 1 Score: 82.0333 bits (201), Expect = 8.379e-18
Identity = 46/107 (42.99%), Postives = 61/107 (57.01%), Query Frame = 2
Query:  272 PNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFPRQEISGTVLYNGPVPYALQN 592
            PNRIFVGG+   TT  EL+  F SYG ++DVKI  D  G+S+G YGFVTF   + A+K+ K    T+ +K ++L IG A RK              Y+  VP AL+ 
Sbjct:    9 PNRIFVGGVAFQTTAIELRELFESYGAVRDVKIARDGEGVSRG-YGFVTFFRDDDAKKVFK--LGTVFYKGKRLVIGEAYRKLQF----------TYHSHVPRALRG 102          
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Match: EDO43157 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZJ6])

HSP 1 Score: 77.0258 bits (188), Expect = 2.975e-16
Identity = 39/88 (44.32%), Postives = 57/88 (64.77%), Query Frame = 2
Query:  257 IGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQ 520
            +G   PN+IFVGG+   TT EEL  FF+++G + + K+I D  G+SKG YGFV+F +QE    +      TL  + +KLN+G AV+K+
Sbjct:    7 LGKRYPNKIFVGGLPPLTTAEELANFFANFGHVVESKVIFDHDGISKG-YGFVSFRSQEDVSCV--KAMGTLFLRNKKLNLGPAVKKE 91          
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Match: EDO31802 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWW5])

HSP 1 Score: 67.781 bits (164), Expect = 2.380e-14
Identity = 31/58 (53.45%), Postives = 40/58 (68.97%), Query Frame = 2
Query:  269 IPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAE 442
            I  RIFV G    TTE EL+ FF  YG +K+ KI+ D+ G+SKG Y F+TFE+QE A+
Sbjct:    6 ISKRIFVKGFNRETTESELRAFFEEYGVVKESKIVRDKHGVSKG-YAFITFESQEVAD 62          
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Match: EDO49349 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG33])

HSP 1 Score: 57.3806 bits (137), Expect = 1.314e-9
Identity = 29/69 (42.03%), Postives = 46/69 (66.67%), Query Frame = 2
Query:  278 RIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKE 484
            +IF+GG+  NTTEE LK +FS +G I D  +I  R G S+G +GFVT+E+ ++  +++K +   L  +E
Sbjct:    1 KIFIGGLNWNTTEEGLKDYFSQWGTIVDC-VIMKRDGRSRG-FGFVTYESSDSVNEVLKKKDHVLDDRE 67          

HSP 2 Score: 46.9802 bits (110), Expect = 4.816e-6
Identity = 25/65 (38.46%), Postives = 37/65 (56.92%), Query Frame = 2
Query:  278 RIFVGGITSNTTEEELKIFFSS------YGPIKDVKIINDRTGLSK-GSYGFVTFENQETAEKII 451
            +IFVGG+ S T EE++K +F+S       G + DV +  DR    +   + FVTF+N E  EK+ 
Sbjct:   90 KIFVGGLASTTVEEDIKEYFNSLCRKNGMGEVIDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVC 154          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: boll (boule homolog, RNA binding protein [Source:NCBI gene;Acc:100302724])

HSP 1 Score: 93.2041 bits (230), Expect = 8.715e-20
Identity = 59/176 (33.52%), Postives = 91/176 (51.70%), Query Frame = 2
Query:  260 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRK-QHLFPRQEISGTVLYNGPV------------PYALQNGLTLFQVPGQDYSVLASQSP-------QYATMMLPQPTTA-MYLPQPQYAYQ 724
            GT+IPNRIFVGG+    TE  L   FS YG + +VKI+ +R+G+SKG YGFVTFE  E    I+ ++A  + ++++K +I  AV+K Q   P   +    +++ P             PY   NG+  F  P  + +      P       Q+  + +  P+TA +Y  Q ++ YQ
Sbjct:   35 GTIIPNRIFVGGVDYKVTENHLHHIFSHYGTVTEVKIVTNRSGMSKG-YGFVTFEAPEDVVNIL-SKANRICYRDKKFSISQAVQKSQAPGPGSIVHKPFIHHDPTCDTVYLTTPAGFPYTFHNGVAYFNCPAMNQAARQWSPPQSFPQHLQWNAVQVQAPSTAVLYSQQAEFLYQ 208          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: dazl (deleted in azoospermia like [Source:NCBI gene;Acc:100049418])

HSP 1 Score: 67.0106 bits (162), Expect = 4.005e-12
Identity = 40/87 (45.98%), Postives = 53/87 (60.92%), Query Frame = 2
Query:  260 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQ 520
            G L PN +FVGGI     E E+K FF+ YG +++VKII  R GL KG YGFV F N++    I     + +IF  RKL +G A+ K+
Sbjct:   27 GKLTPNSLFVGGIDMKVDENEIKEFFARYGSVREVKIIRYRGGLCKG-YGFVYF-NEDV--DIQSIIEQQIIFMGRKLKLGPAILKE 109          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: dazl (deleted in azoospermia like [Source:NCBI gene;Acc:100049418])

HSP 1 Score: 67.0106 bits (162), Expect = 4.005e-12
Identity = 40/87 (45.98%), Postives = 53/87 (60.92%), Query Frame = 2
Query:  260 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQ 520
            G L PN +FVGGI     E E+K FF+ YG +++VKII  R GL KG YGFV F N++    I     + +IF  RKL +G A+ K+
Sbjct:   27 GKLTPNSLFVGGIDMKVDENEIKEFFARYGSVREVKIIRYRGGLCKG-YGFVYF-NEDV--DIQSIIEQQIIFMGRKLKLGPAILKE 109          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: dazl (deleted in azoospermia like [Source:NCBI gene;Acc:100049418])

HSP 1 Score: 67.0106 bits (162), Expect = 4.131e-12
Identity = 40/87 (45.98%), Postives = 53/87 (60.92%), Query Frame = 2
Query:  260 GTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQ 520
            G L PN +FVGGI     E E+K FF+ YG +++VKII  R GL KG YGFV F N++    I     + +IF  RKL +G A+ K+
Sbjct:   27 GKLTPNSLFVGGIDMKVDENEIKEFFARYGSVREVKIIRYRGGLCKG-YGFVYF-NEDV--DIQSIIEQQIIFMGRKLKLGPAILKE 109          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: msi1 (musashi RNA binding protein 1 [Source:NCBI gene;Acc:101173434])

HSP 1 Score: 60.4622 bits (145), Expect = 2.934e-9
Identity = 27/68 (39.71%), Postives = 44/68 (64.71%), Query Frame = 2
Query:  251 PKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIK 454
            PK+ T    +IFVGG++ NTT E++K +F  +G + D  ++ D+T      +GFVTFEN++  EK+ +
Sbjct:  102 PKLVTRT-KKIFVGGLSVNTTIEDVKQYFDQFGKVDDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCE 168          

HSP 2 Score: 53.5286 bits (127), Expect = 4.903e-7
Identity = 25/83 (30.12%), Postives = 42/83 (50.60%), Query Frame = 2
Query:  272 PNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQ 520
            P ++F+GG++  TT+E LK +F  YG +K+  ++ D        +GFVTF +Q   +K++      L  K     +    R Q
Sbjct:   19 PCKMFIGGLSWQTTQEGLKEYFCKYGEVKECMVMRDPVTKRSRGFGFVTFVDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQ 101          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000018666.1 (SMESG000018666.1)

HSP 1 Score: 720.309 bits (1858), Expect = 0.000e+0
Identity = 430/430 (100.00%), Postives = 430/430 (100.00%), Query Frame = 2
Query:  146 MSTDSQLTPKVDTLAQEFQVSLXXXXXXXXXXXXXPKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFPRQEISGTVLYNGPVPYALQNGLTLFQVPGQDYSVLASQSPQYATMMLPQPTTAMYLPQPQYAYQTPTAVIPSPNNGQQVTFTQNXXXXXXXXXXXXWYTLAGLTAAPXXXXXXXXXXXXXXXAQTLRWAATTGSQSPPHNNVAPAATYLLSPMASASGHEVLYIPHTGACTPXXXXXXXXXXXXXXILDSNEHNENTLVRGSLQYATFNGSDRIIPIGHAAPGSAHRLFTGPNSGLQSGTQFNPXXXXXXXXXXXXXXXXXXCGQIARMIPACSVLTASNLSRPLSRGAPGDNMQMCNNHQ 1435
            MSTDSQLTPKVDTLAQEFQVSLAAVNQATMTAAANPKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFPRQEISGTVLYNGPVPYALQNGLTLFQVPGQDYSVLASQSPQYATMMLPQPTTAMYLPQPQYAYQTPTAVIPSPNNGQQVTFTQNGPGSAGSAAAAPWYTLAGLTAAPQSSSQISSNNSSNSIAQTLRWAATTGSQSPPHNNVAPAATYLLSPMASASGHEVLYIPHTGACTPNSNNDFSSDNVNANILDSNEHNENTLVRGSLQYATFNGSDRIIPIGHAAPGSAHRLFTGPNSGLQSGTQFNPQAFNNSQSQLSQAALAAQCGQIARMIPACSVLTASNLSRPLSRGAPGDNMQMCNNHQ
Sbjct:    1 MSTDSQLTPKVDTLAQEFQVSLAAVNQATMTAAANPKIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFPRQEISGTVLYNGPVPYALQNGLTLFQVPGQDYSVLASQSPQYATMMLPQPTTAMYLPQPQYAYQTPTAVIPSPNNGQQVTFTQNGPGSAGSAAAAPWYTLAGLTAAPQSSSQISSNNSSNSIAQTLRWAATTGSQSPPHNNVAPAATYLLSPMASASGHEVLYIPHTGACTPNSNNDFSSDNVNANILDSNEHNENTLVRGSLQYATFNGSDRIIPIGHAAPGSAHRLFTGPNSGLQSGTQFNPQAFNNSQSQLSQAALAAQCGQIARMIPACSVLTASNLSRPLSRGAPGDNMQMCNNHQ 430          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000061507.1 (SMESG000061507.1)

HSP 1 Score: 147.132 bits (370), Expect = 8.524e-39
Identity = 77/132 (58.33%), Postives = 95/132 (71.97%), Query Frame = 2
Query:  254 KIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFPRQEISGTVLYNG-PVPYALQNGLTLFQVPGQDYSVLASQ 646
            KI TLIPNRIFVGG   NTTEEELK FF  YG IKDVKII D+ G +KGSYGFVTF +QE AE+II  +AETL+F++RKLNIG AV+KQ L  + E+  T++ N  P+ Y      +++  P QDYS L +Q
Sbjct:   24 KISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQAETLVFRDRKLNIGRAVKKQPLTGKSELQNTLILNTLPLSYG-----SVY--PYQDYSYLFNQ 148          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000061507.1 (SMESG000061507.1)

HSP 1 Score: 100.523 bits (249), Expect = 3.362e-25
Identity = 49/69 (71.01%), Postives = 54/69 (78.26%), Query Frame = 2
Query:  254 KIGTLIPNRIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEKIIKNE 460
            KI TLIPNRIFVGG   NTTEEELK FF  YG IKDVKII D+ G +KGSYGFVTF +QE AE+II  +
Sbjct:   24 KISTLIPNRIFVGGFPQNTTEEELKSFFCKYGEIKDVKIIPDKAGQAKGSYGFVTFASQEVAERIITEQ 92          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000006741.1 (SMESG000006741.1)

HSP 1 Score: 67.781 bits (164), Expect = 5.646e-12
Identity = 34/95 (35.79%), Postives = 55/95 (57.89%), Query Frame = 2
Query:  278 RIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDR-TGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFPRQEISGTVL 559
            +IFVGG+  +TT+E L++FF  +GPI++  +I DR +G S+G YGFVT  N E A + I N    +  ++  +N+     K  + P   ++   L
Sbjct:   35 KIFVGGLPYHTTDESLRVFFECFGPIEEAVVITDRQSGKSRG-YGFVTMVNCEDAYRAISNPNPCIDGRKANVNLAILGAKPRILPGVNLNSMAL 128          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000006741.1 (SMESG000006741.1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.064e-11
Identity = 34/95 (35.79%), Postives = 55/95 (57.89%), Query Frame = 2
Query:  278 RIFVGGITSNTTEEELKIFFSSYGPIKDVKIINDR-TGLSKGSYGFVTFENQETAEKIIKNEAETLIFKERKLNIGHAVRKQHLFPRQEISGTVL 559
            +IFVGG+  +TT+E L++FF  +GPI++  +I DR +G S+G YGFVT  N E A + I N    +  ++  +N+     K  + P   ++   L
Sbjct:   35 KIFVGGLPYHTTDESLRVFFECFGPIEEAVVITDRQSGKSRG-YGFVTMVNCEDAYRAISNPNPCIDGRKANVNLAILGAKPRILPGVNLNSMAL 128          
The following BLAST results are available for this feature:
BLAST of RRM domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BOLL1.131e-3347.70boule homolog, RNA binding protein [Source:HGNC Sy... [more]
BOLL1.131e-3347.70boule homolog, RNA binding protein [Source:HGNC Sy... [more]
BOLL1.277e-3347.70boule homolog, RNA binding protein [Source:HGNC Sy... [more]
BOLL2.186e-3248.50boule homolog, RNA binding protein [Source:HGNC Sy... [more]
DAZL7.054e-2142.98deleted in azoospermia like [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
daz-11.313e-1950.56DAZ protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q2... [more]
sup-122.904e-829.46SUPpressor [Source:UniProtKB/TrEMBL;Acc:O45189][more]
sup-123.407e-829.46SUPpressor [Source:UniProtKB/TrEMBL;Acc:O45189][more]
msi-16.244e-832.20MuSashI (Fly neural) family; Neural RNA-binding pr... [more]
H28G03.11.389e-728.95pep chromosome:WBcel235:X:5216363:5218418:1 gene:W... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bol2.130e-2641.95gene:FBgn0011206 transcript:FBtr0076538[more]
bol2.130e-2641.95gene:FBgn0011206 transcript:FBtr0344979[more]
bol2.130e-2641.95gene:FBgn0011206 transcript:FBtr0076540[more]
bol2.477e-2642.20gene:FBgn0011206 transcript:FBtr0076539[more]
bol2.477e-2642.20gene:FBgn0011206 transcript:FBtr0076541[more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dazl3.635e-1440.91deleted in azoospermia-like [Source:NCBI gene;Acc:... [more]
dazl3.880e-1440.91deleted in azoospermia-like [Source:NCBI gene;Acc:... [more]
dazl4.643e-1440.91deleted in azoospermia-like [Source:NCBI gene;Acc:... [more]
dazl5.213e-1440.91deleted in azoospermia-like [Source:NCBI gene;Acc:... [more]
dazl5.213e-1440.91deleted in azoospermia-like [Source:NCBI gene;Acc:... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dazl2.934e-1646.51deleted in azoospermia-like [Source:NCBI gene;Acc:... [more]
deup13.255e-937.68deuterosome assembly protein 1 [Source:Xenbase;Acc... [more]
msi11.058e-826.06musashi RNA binding protein 1 [Source:NCBI gene;Ac... [more]
psd31.186e-839.68pleckstrin and Sec7 domain containing 3 [Source:Xe... [more]
msi11.663e-827.34musashi RNA binding protein 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Boll2.942e-3345.66boule homolog, RNA binding protein [Source:MGI Sym... [more]
Boll2.942e-3345.66boule homolog, RNA binding protein [Source:MGI Sym... [more]
Boll2.119e-3161.46boule homolog, RNA binding protein [Source:MGI Sym... [more]
Dazl2.676e-1948.31deleted in azoospermia-like [Source:MGI Symbol;Acc... [more]
Dazl1.871e-1848.84deleted in azoospermia-like [Source:MGI Symbol;Acc... [more]
back to top
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8N9W6|BOLL_HUMAN5.433e-3347.70Protein boule-like OS=Homo sapiens OX=9606 GN=BOLL... [more]
sp|Q8WP23|BOLL_MACFA2.411e-3247.13Protein boule-like OS=Macaca fascicularis OX=9541 ... [more]
sp|Q924M5|BOLL_MOUSE2.412e-3245.66Protein boule-like OS=Mus musculus OX=10090 GN=Bol... [more]
sp|Q24207|BOULE_DROME2.135e-2541.95Protein boule OS=Drosophila melanogaster OX=7227 G... [more]
sp|Q92904|DAZL_HUMAN7.822e-2039.24Deleted in azoospermia-like OS=Homo sapiens OX=960... [more]
back to top
BLAST of RRM domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A172RVQ02.737e-6696.12Boule 1 RNA-binding protein OS=Schmidtea mediterra... [more]
A0A4S2M8S92.515e-6162.15RRM domain-containing protein OS=Opisthorchis feli... [more]
A0A419QF178.505e-6162.15Protein boule-like OS=Clonorchis sinensis OX=79923... [more]
A0A075AGA89.672e-6162.15RRM domain-containing protein (Fragment) OS=Opisth... [more]
A0A4S2MEX81.319e-6062.15RRM domain-containing protein OS=Opisthorchis feli... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000005184.22.569e-2835.83pep primary_assembly:Astyanax_mexicanus-2.0:10:775... [more]
dazl9.738e-1542.05deleted in azoospermia like [Source:NCBI gene;Acc:... [more]
msi2b2.764e-931.91RNA-binding protein Musashi homolog 2 [Source:NCBI... [more]
msi2a2.799e-931.91RNA-binding protein Musashi homolog 2-like [Source... [more]
msi12.868e-939.71musashi RNA-binding protein 1 [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BOLL4.663e-3745.88boule homolog, RNA binding protein [Source:HGNC Sy... [more]
HNRNPA07.686e-1134.48heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
HNRNPA02.113e-1036.23heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
rbm24a4.108e-1040.00RNA binding motif protein 24a [Source:NCBI gene;Ac... [more]
rbmx5.143e-1037.93RNA binding motif protein X-linked [Source:NCBI ge... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
HRP15.111e-937.18Subunit of cleavage factor I; cleavage factor I is... [more]
NAM86.892e-734.02RNA binding protein, component of the U1 snRNP pro... [more]
PAB16.016e-632.97Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
RIE17.704e-644.00Putative RNA binding protein; localizes to stress ... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO405361.088e-1848.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451858.379e-1842.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431572.975e-1644.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318022.380e-1453.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493491.314e-942.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
boll8.715e-2033.52boule homolog, RNA binding protein [Source:NCBI ge... [more]
dazl4.005e-1245.98deleted in azoospermia like [Source:NCBI gene;Acc:... [more]
dazl4.005e-1245.98deleted in azoospermia like [Source:NCBI gene;Acc:... [more]
dazl4.131e-1245.98deleted in azoospermia like [Source:NCBI gene;Acc:... [more]
msi12.934e-939.71musashi RNA binding protein 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of RRM domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018666.10.000e+0100.00SMESG000018666.1[more]
SMESG000061507.18.524e-3958.33SMESG000061507.1[more]
SMESG000061507.13.362e-2571.01SMESG000061507.1[more]
SMESG000006741.15.646e-1235.79SMESG000006741.1[more]
SMESG000006741.11.064e-1135.79SMESG000006741.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020626 ID=SMED30020626|Name=RRM domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2287bp
ATCAAAATCAGTTTATAAATTTAAATTTTATTTGAATTTTAGAGTATTAC
TTTTATTAAAATATCTTAAGTTATATTAATTTAACAAAGAATTTATAGTA
ACCAATCAATGCTAAGGATTGAAAATTAGTGTGTATGCAAACAAAATGTC
AACTGATAGTCAACTTACGCCTAAAGTAGATACACTAGCTCAAGAATTTC
AAGTTTCACTTGCTGCTGTTAATCAAGCAACGATGACTGCTGCTGCAAAC
CCTAAAATCGGTACTCTGATACCAAATCGAATATTTGTTGGTGGAATCAC
GTCAAATACGACAGAAGAAGAATTGAAAATATTTTTTTCAAGTTACGGTC
CAATTAAGGATGTTAAAATAATAAATGATCGTACTGGATTATCCAAAGGG
AGTTATGGGTTTGTTACATTTGAAAATCAAGAAACTGCTGAAAAAATAAT
CAAAAATGAAGCAGAAACACTGATATTTAAGGAACGGAAATTAAACATAG
GACACGCTGTTAGAAAACAGCATTTATTTCCTCGCCAGGAAATTTCTGGA
ACAGTTTTATATAATGGACCCGTGCCTTATGCTTTACAAAATGGTTTAAC
ATTGTTCCAAGTTCCTGGACAAGACTATTCAGTTTTAGCGTCACAATCTC
CTCAATACGCAACTATGATGTTACCTCAACCGACTACGGCTATGTATTTA
CCGCAACCACAATATGCTTATCAAACGCCTACTGCTGTGATTCCTTCCCC
TAACAACGGACAACAAGTAACATTTACTCAAAACGGTCCTGGATCAGCAG
GATCAGCAGCTGCTGCACCATGGTACACTTTAGCTGGATTAACGGCAGCA
CCACAATCATCTTCACAAATTTCAAGCAACAATAGTTCAAATTCAATTGC
TCAAACTTTAAGATGGGCTGCTACAACTGGATCACAAAGTCCTCCACATA
ATAATGTAGCGCCTGCAGCAACTTATTTATTGAGTCCAATGGCTAGTGCT
TCTGGTCACGAAGTTTTGTATATTCCTCATACTGGTGCTTGTACACCAAA
TTCCAACAATGATTTTTCCTCTGACAATGTAAATGCAAACATTTTGGATT
CGAATGAACATAATGAAAATACTTTGGTGCGTGGAAGTTTACAATACGCA
ACTTTTAATGGTTCTGACCGTATAATTCCCATTGGACATGCAGCACCAGG
TTCTGCTCATCGACTTTTTACAGGTCCCAATTCTGGATTACAATCTGGAA
CTCAATTTAATCCTCAGGCATTTAACAATTCTCAAAGTCAATTAAGTCAA
GCCGCATTAGCAGCACAGTGTGGACAAATTGCAAGAATGATTCCTGCATG
TTCAGTGTTAACTGCATCTAATTTGTCACGACCTCTTAGCCGAGGTGCGC
CTGGCGATAATATGCAAATGTGTAATAATCATCAATAAGACAACTACCTC
CCTTTAAAAAAATACTTAAGTTGTATTTATATTATTGTTTTCTTTATTTT
TAGTATAGGCCTCAGTTTAAAATTATGATTATTTTTATCTGTAATACCGA
TAATTTGAATTTTTATGTGTAACTTATCTGAAATTTGATTTAAATGATCA
GTCATTCATTTCTTGTGTAACACATGAGTAACAAATGTTTTGTTTAAAGC
ATGACAATGTTATTTTGAAATTTGAGTATTTCATGTTGTAGTTTGTCCAT
CTAGTCTCCTAGAATAGTTTGTGAGTTCGTTGTTGAGATATTGTTGAAAT
CAATTAACATTTAACTTATTAATCTTAACTAAAATATAATTGTTATTAAA
TTTTAAATGTGACATTTTAAAATCGCAGTATAATTTACGTTATGAAGAAT
CTATATGTTTTACCTAGATAATGTGCACTTTTCGAGTTTTTAACATGCTT
TATGGCAACTGCTGGTGGTATTTACAGCATTCCTTTTTGTAATGGTACGC
ATGCTACTTTTTGGGACTGATGATGAATGACTGACAGTTTGTTGTAATAA
ATGGGTTTATTGTTAAATTTAGTTCGGACTTTGCTATTCTGATATAAACA
TGATGAGAAATGCTATTTGTTGTATCTCTTTCGATAATTAATGTGTTTCA
TTTTCAAATTAATTTTATATTTTACTAATTTATTTCATGTTACCTTTATA
ACACTGAATATTATATATCAAAAGTATATATTATATAGATTGGTTTTTAT
GATGGCTTAAGATAATGAAGTTTTTGTTAGTTTGTTAATTTAGATGTTAT
TCATATATAGATGTTTTGTTTCATTAAATATTATTAA
back to top

protein sequence of SMED30020626-orf-1

>SMED30020626-orf-1 ID=SMED30020626-orf-1|Name=SMED30020626-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=431bp
MSTDSQLTPKVDTLAQEFQVSLAAVNQATMTAAANPKIGTLIPNRIFVGG
ITSNTTEEELKIFFSSYGPIKDVKIINDRTGLSKGSYGFVTFENQETAEK
IIKNEAETLIFKERKLNIGHAVRKQHLFPRQEISGTVLYNGPVPYALQNG
LTLFQVPGQDYSVLASQSPQYATMMLPQPTTAMYLPQPQYAYQTPTAVIP
SPNNGQQVTFTQNGPGSAGSAAAAPWYTLAGLTAAPQSSSQISSNNSSNS
IAQTLRWAATTGSQSPPHNNVAPAATYLLSPMASASGHEVLYIPHTGACT
PNSNNDFSSDNVNANILDSNEHNENTLVRGSLQYATFNGSDRIIPIGHAA
PGSAHRLFTGPNSGLQSGTQFNPQAFNNSQSQLSQAALAAQCGQIARMIP
ACSVLTASNLSRPLSRGAPGDNMQMCNNHQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003729mRNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0000219spermatogonial stem cell
PLANA:0000220spermatogonium
PLANA:0000221spermatocyte
PLANA:0000222spermatid
PLANA:0000422tail stripe
PLANA:0000429neoblast
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR037366BOULE/DAZ
IPR034988DAZ_BOULE_RRM
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 45..119
e-value: 1.5E-19
score: 81.0
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 46..107
e-value: 1.0E-17
score: 63.7
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 44..123
score: 16.261
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 38..132
e-value: 4.7E-24
score: 86.4
IPR037366BOULE/DAZ familyPANTHERPTHR11176BOULE-RELATEDcoord: 28..324
NoneNo IPR availablePANTHERPTHR11176:SF14PROTEIN BOULEcoord: 28..324
IPR034988DAZ/BOULE, RNA recognition motifCDDcd12412RRM_DAZL_BOULEcoord: 42..124
e-value: 2.85079E-39
score: 133.938
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 43..137