SMED30020622

Overview
NameSMED30020622
Smed IDSMED30020622
Length (bp)311
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020622

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30020622SMESG000030693.1 dd_Smed_v4_15045_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020622SMESG000030693.1 dd_Smed_v4_15045_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30020622SMESG000030693.1 dd_Smed_v4_15045_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30020622 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.015698:10156..14142 -1327
v31.035293:2..1181 +1076
Homology
BLAST of SMED30020622 vs. Planmine SMEST
Match: SMESG000030693.1 (SMESG000030693.1)

HSP 1 Score: 110.538 bits (275), Expect = 1.101e-30
Identity = 54/60 (90.00%), Postives = 55/60 (91.67%), Query Frame = 3
Query:    3 ARMVGSETAGTTDNADRC-----HESGDAAMPPLNTARMMKGRTDGIRGDSDRLSFAAIT 167
            ARMVGSETAGTTDNADRC     HESGDAAMPPLNTARMM+GRTDGIRGDSDRLSFAAIT
Sbjct:  214 ARMVGSETAGTTDNADRCRMGHDHESGDAAMPPLNTARMMEGRTDGIRGDSDRLSFAAIT 273          
BLAST of SMED30020622 vs. Planmine SMEST
Match: SMESG000015578.1 (SMESG000015578.1)

HSP 1 Score: 45.8246 bits (107), Expect = 5.831e-7
Identity = 23/39 (58.97%), Postives = 25/39 (64.10%), Query Frame = 3
Query:    3 ARMVGSETAGTTDNADRC-----HESGDAAMPPLNTARM 104
            AR  GS TA TTDN DRC     HE G+ A+PPLN  RM
Sbjct:  163 ARKAGSGTAETTDNMDRCRMRHDHEFGETAVPPLNPTRM 201          
The following BLAST results are available for this feature:
BLAST of SMED30020622 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020622 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020622 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020622 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020622 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020622 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020622 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020622 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020622 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020622 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020622 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020622 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020622 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020622 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000030693.11.101e-3090.00SMESG000030693.1[more]
SMESG000015578.15.831e-758.97SMESG000015578.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020622 ID=SMED30020622|Name=SMED30020622|organism=Schmidtea mediterranea sexual|type=transcript|length=311bp
ATGCCCGAATGGTGGGATCTGAAACTGCTGGGACGACTGATAATGCTGAT
AGATGCCATGAATCCGGAGATGCTGCTATGCCCCCTCTGAATACTGCTAG
AATGATGAAAGGTAGAACAGATGGAATTAGAGGTGATAGTGATAGATTGT
CATTTGCGGCCATAACAATTACTTCTCTAAATAGAGGCATACCCAGATCT
GAAAACTCCAACTTACTAAAAACCAATATATGGATGGAGAATACCCTGAG
AATAATAATTCCCAGATCCCAAAGAGTTACTTTACCACACTTAGCAAATA
TGGAGATAAAA
back to top

protein sequence of SMED30020622-orf-1

>SMED30020622-orf-1 ID=SMED30020622-orf-1|Name=SMED30020622-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=103bp
ARMVGSETAGTTDNADRCHESGDAAMPPLNTARMMKGRTDGIRGDSDRLS
FAAITITSLNRGIPRSENSNLLKTNIWMENTLRIIIPRSQRVTLPHLANM
EIK
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 12..34