Palmitoyltransferase

Overview
NamePalmitoyltransferase
Smed IDSMED30020616
Length (bp)1726
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Palmitoyltransferase (SMED30020616) t-SNE clustered cells

Violin plots show distribution of expression levels for Palmitoyltransferase (SMED30020616) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Palmitoyltransferase (SMED30020616) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Palmitoyltransferase (SMED30020616) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Palmitoyltransferase vs. Ensembl Human
Match: ZDHHC17 (zinc finger DHHC-type containing 17 [Source:HGNC Symbol;Acc:HGNC:18412])

HSP 1 Score: 138.272 bits (347), Expect = 5.714e-34
Identity = 131/550 (23.82%), Postives = 237/550 (43.09%), Query Frame = 3
Query:  276 EILYDVFPSTGD--TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIIN-CKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHP-ELSRMLVFYGLNCNQKDAFGQ-TPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLK-------YQINKRVNKLSSFSRLKYKI-IGAPNKNRFPMIFLI----------------LCAFLWGNPYY---------YYVIRPCSINYAQ-------------------FTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWF--WLFIMLMNAVNFLAGYLLY------IAYTFTNLFIY-TVIFTSLLIALGLVLGFTINF------FLCKQ---ALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFNAR 1700
            E  YDV     +  TL+HWA ++  +D+V Y            +S  +I++    +L+ TPLHWA    +LS++  L+K G D +  D +  + + ++ Q+G+ S   YLI  G ++ + D  G   L WA Y+ H  + +R+L+ + ++ N  D + + T LH+A L+GN + I+ L+E     ++  +   ++ L LA  RK   +  +L+       Y     + KL +    + K+ +G P    F +I+L+                +   +W    +          +   P  I  A                    F +L F+     +++ F  +   DPG +   E+  +  + E+    +             +  C +C   + +R+KHC +C+RC+ + DHHCP+VGNC+G  N  +F  +LF +L      + G + Y        YT    + Y T I T       + L    +F       +C+    + L +T  E    ++Y + +       +P+NHG + N+I +F  R
Sbjct:   78 EAGYDVRQPDKENVTLLHWAAINNRIDLVKYY-----------ISKGAIVDQLGGDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCIHLAAQFGHTSIVAYLIAKGQDVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVNLGDKYHKNTALHWAVLAGNTTVISLLLEA-GANVDAQNIKGESALDLAKQRKNVWMINHLQEARQAKGYDNPSFLRKLKADKEFRQKVMLGTP----FLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPLGIYLATKFWMYVTWFFWFWNDLNFLFIHLPFLANSVALFYNFGKSWKSDPGIIKATEEQKKKTIVELAETGSL----------DLSIFCSTCLIRKPVRSKHCGVCNRCIAKFDHHCPWVGNCVGAGNHRYFMGYLFFLLFMICWMIYGCISYWGLHCETTYTKDGFWTYITQIATCSPWMFWMFLNSVFHFMWVAVLLMCQMYQISCLGITTNERMNARRYKHFKVTTTSIESPFNHGCVRNIIDFFEFR 601          
BLAST of Palmitoyltransferase vs. Ensembl Human
Match: ZDHHC13 (zinc finger DHHC-type containing 13 [Source:HGNC Symbol;Acc:HGNC:18413])

HSP 1 Score: 114.775 bits (286), Expect = 3.461e-26
Identity = 122/515 (23.69%), Postives = 207/515 (40.19%), Query Frame = 3
Query:  129 NLELEDNKIFIPPSEKCIKSESNTLGDLLEIIKSGKKELLFEKLKNSGSEILYDVFPSTGD--TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKG-HPELSRMLVFYGLNCNQKDAFGQ-TPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVNKLSSFSRLKYK------------------------------------------------IIGAPNKNRFPMIFLILCAF-------------LWGNPYYYYVIRPCSINYAQFTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYET---VLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIMLMNAVNFLAGYLLYIAYTF 1469
            N EL + +  +P     I+  SN   D+++  + G    +FE+ K    E  YDV     +  +L+HWA ++  LD+V +   I K      +          +L+ TPLHWA    +L ++  L++ G D    D +  + + ++  + ++    YLI  G ++ +TDV G   L  + +K   PE +  L+ +  + N  D   Q TPLH+A  +GN++ +  L+E  +  L++ +   +TPL +A   K ++I   LK +   R N+     R   K                                                ++G  N    P  FL+   F             L G P+Y+  I         F+ + F+ F       F  T   DPGF    E+  +     L E   LD             F   C SC   + +R+ HC +C+ CV   D HC + G CIG  N  ++  F+  ++ V    G+++Y ++ +
Sbjct:   32 NKELANAREALP----LIEDSSNC--DIVKATQYG----IFERCKEL-VEAGYDVRQPDKENVSLLHWAAINNRLDLVKF--YISKGAVVDQLG--------GDLNSTPLHWAIRQGHLPMVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDVNGQTPLMLSAHKVIGPEPTGFLLKFNPSLNVVDKIHQNTPLHWAVAAGNVNAVDKLLEAGS-SLDIQNVKGETPLDMALQNKNQLIIHMLKTEAKMRANQKFRLWRWLQKCELFLLLMLSVITMWAIGYILDFNSDSWLLKGCLLVTLFFLTSLFPRFLVGYKNLVYLPTAFLLSSVFWIFMTWFILFFPDLAGAPFYFSFI---------FSIVAFLYF-------FYKTWATDPGFTKASEEEKKVNIITLAETGSLD-------------FRTFCTSCLIRKPLRSLHCHVCNCCVARYDQHCLWTGRCIGFGNHHYYIFFLFFLSMV---CGWIIYGSFIY 492          
BLAST of Palmitoyltransferase vs. Ensembl Human
Match: ANKRD44 (ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:HGNC:25259])

HSP 1 Score: 94.3597 bits (233), Expect = 2.627e-20
Identity = 63/202 (31.19%), Postives = 101/202 (50.00%), Query Frame = 3
Query:  288 DVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAA--GRKYRVIT 887
            +V    G T +H A L+G++++V+ L     N           IN  ++  +  LHWA  + +L V+  L+  G ++  KD K  TPL  +   G I+   +L+  G  I   +V G+ ALH A Y G   +   L+ YG N NQ +  G TPLHFA+ S + +   +L+  +  ++N+   + K+PL + A  GR  R  T
Sbjct:  134 NVSDRGGRTALHHAALNGHVEMVNLLLAKGAN-----------INAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQINVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQT 324          

HSP 2 Score: 73.9442 bits (180), Expect = 1.695e-13
Identity = 61/232 (26.29%), Postives = 104/232 (44.83%), Query Frame = 3
Query:  210 LLEIIKSGKKE---LLFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYL 896
            L++ I SG  E   +L  K ++       +   S   T +H A   G+ +I+  L           +   + +N K+ +  TPLH A    +   +Q L+K   D+NA+D    TPL ++     +  A  +I   +++ ++D  G  ALH A   GH E+  +L+  G N N  D   +  LH+A+  G++  +A L+     E+   D    TPL  AA      + ++L
Sbjct:   12 LVQAIFSGDPEEIRMLIHKTED------VNTLDSEKRTPLHVAAFLGDAEIIELL-----------ILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINH-GAEVTCKDKKGYTPLHAAASNGQINVVKHL 225          

HSP 3 Score: 59.3066 bits (142), Expect = 8.837e-9
Identity = 48/158 (30.38%), Postives = 74/158 (46.84%), Query Frame = 3
Query:  246 LFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSV-IQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNC 716
            + + L N G EI  D     G+T +H AC +G   +V+ L      D  +NV+ P      N    TPLH+A    + ++ ++ LV  G D+N +     +PL M+  +G  + +  LI NG  I   D +G+  LH A   GH  L   L+  G + 
Sbjct:  221 VVKHLLNLGVEI--DEINVYGNTALHIACYNGQDAVVNELI-----DYGANVNQP------NNNGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARYGHELLINTLITSGADT 365          

HSP 4 Score: 52.7582 bits (125), Expect = 8.985e-7
Identity = 41/141 (29.08%), Postives = 68/141 (48.23%), Query Frame = 3
Query:  441 QTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAA 863
            Q PL  A    +   I+ L+ +  D+N  D++  TPL ++   G+      LIL+GA +   D      LH A+     E  ++L+ +  + N +D   QTPLH A+ +  + C A+++      +NV D   +T L  AA
Sbjct:    9 QPPLVQAIFSGDPEEIRMLIHKTEDVNTLDSEKRTPLHVAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKC-AEVIIPLLSSVNVSDRGGRTALHHAA 148          
BLAST of Palmitoyltransferase vs. Ensembl Human
Match: ANKRD44 (ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:HGNC:25259])

HSP 1 Score: 95.1301 bits (235), Expect = 5.480e-20
Identity = 63/202 (31.19%), Postives = 101/202 (50.00%), Query Frame = 3
Query:  288 DVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAA--GRKYRVIT 887
            +V    G T +H A L+G++++V+ L     N           IN  ++  +  LHWA  + +L V+  L+  G ++  KD K  TPL  +   G I+   +L+  G  I   +V G+ ALH A Y G   +   L+ YG N NQ +  G TPLHFA+ S + +   +L+  +  ++N+   + K+PL + A  GR  R  T
Sbjct:  134 NVSDRGGRTALHHAALNGHVEMVNLLLAKGAN-----------INAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQINVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQT 324          

HSP 2 Score: 76.6406 bits (187), Expect = 4.752e-14
Identity = 74/285 (25.96%), Postives = 114/285 (40.00%), Query Frame = 3
Query:  246 LFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSV-IQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGH---------------------------------PELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVNKLSSFSRLKYKIIGAPNKNRFPMIF 998
            + + L N G EI  D     G+T +H AC +G   +V+ L      D  +NV+ P      N    TPLH+A    + ++ ++ LV  G D+N +     +PL M+  +G  + +  LI NG  I   D +G+  LH A   GH                                  +  R L+  G   +  D FG+T LH A+  GN+ CI  L++    + +  D   +TPL  AA   +    E L       VN+   + R       A + +R   I 
Sbjct:  221 VVKHLLNLGVEI--DEINVYGNTALHIACYNGQDAVVNELI-----DYGANVNQP------NNNGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARYGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTPDKFGRTCLHAAAAGGNVECI-KLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIETL-VTTGANVNETDDWGRTALHYAAASDMDRNKTIL 490          

HSP 3 Score: 74.7146 bits (182), Expect = 2.048e-13
Identity = 61/232 (26.29%), Postives = 104/232 (44.83%), Query Frame = 3
Query:  210 LLEIIKSGKKE---LLFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYL 896
            L++ I SG  E   +L  K ++       +   S   T +H A   G+ +I+  L           +   + +N K+ +  TPLH A    +   +Q L+K   D+NA+D    TPL ++     +  A  +I   +++ ++D  G  ALH A   GH E+  +L+  G N N  D   +  LH+A+  G++  +A L+     E+   D    TPL  AA      + ++L
Sbjct:   12 LVQAIFSGDPEEIRMLIHKTED------VNTLDSEKRTPLHVAAFLGDAEIIELL-----------ILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINH-GAEVTCKDKKGYTPLHAAASNGQINVVKHL 225          

HSP 4 Score: 53.5286 bits (127), Expect = 8.433e-7
Identity = 41/141 (29.08%), Postives = 68/141 (48.23%), Query Frame = 3
Query:  441 QTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAA 863
            Q PL  A    +   I+ L+ +  D+N  D++  TPL ++   G+      LIL+GA +   D      LH A+     E  ++L+ +  + N +D   QTPLH A+ +  + C A+++      +NV D   +T L  AA
Sbjct:    9 QPPLVQAIFSGDPEEIRMLIHKTEDVNTLDSEKRTPLHVAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKC-AEVIIPLLSSVNVSDRGGRTALHHAA 148          
BLAST of Palmitoyltransferase vs. Ensembl Human
Match: ANKRD44 (ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:HGNC:25259])

HSP 1 Score: 94.7449 bits (234), Expect = 1.545e-19
Identity = 63/202 (31.19%), Postives = 101/202 (50.00%), Query Frame = 3
Query:  288 DVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAA--GRKYRVIT 887
            +V    G T +H A L+G++++V+ L     N           IN  ++  +  LHWA  + +L V+  L+  G ++  KD K  TPL  +   G I+   +L+  G  I   +V G+ ALH A Y G   +   L+ YG N NQ +  G TPLHFA+ S + +   +L+  +  ++N+   + K+PL + A  GR  R  T
Sbjct:  134 NVSDRGGRTALHHAALNGHVEMVNLLLAKGAN-----------INAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQINVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQT 324          

HSP 2 Score: 76.2554 bits (186), Expect = 8.756e-14
Identity = 74/285 (25.96%), Postives = 114/285 (40.00%), Query Frame = 3
Query:  246 LFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSV-IQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGH---------------------------------PELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVNKLSSFSRLKYKIIGAPNKNRFPMIF 998
            + + L N G EI  D     G+T +H AC +G   +V+ L      D  +NV+ P      N    TPLH+A    + ++ ++ LV  G D+N +     +PL M+  +G  + +  LI NG  I   D +G+  LH A   GH                                  +  R L+  G   +  D FG+T LH A+  GN+ CI  L++    + +  D   +TPL  AA   +    E L       VN+   + R       A + +R   I 
Sbjct:  221 VVKHLLNLGVEI--DEINVYGNTALHIACYNGQDAVVNELI-----DYGANVNQP------NNNGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARYGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTPDKFGRTCLHAAAAGGNVECI-KLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIETL-VTTGANVNETDDWGRTALHYAAASDMDRNKTIL 490          

HSP 3 Score: 73.9442 bits (180), Expect = 5.427e-13
Identity = 61/232 (26.29%), Postives = 104/232 (44.83%), Query Frame = 3
Query:  210 LLEIIKSGKKE---LLFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYL 896
            L++ I SG  E   +L  K ++       +   S   T +H A   G+ +I+  L           +   + +N K+ +  TPLH A    +   +Q L+K   D+NA+D    TPL ++     +  A  +I   +++ ++D  G  ALH A   GH E+  +L+  G N N  D   +  LH+A+  G++  +A L+     E+   D    TPL  AA      + ++L
Sbjct:   12 LVQAIFSGDPEEIRMLIHKTED------VNTLDSEKRTPLHVAAFLGDAEIIELL-----------ILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINH-GAEVTCKDKKGYTPLHAAASNGQINVVKHL 225          

HSP 4 Score: 71.2478 bits (173), Expect = 3.000e-12
Identity = 60/209 (28.71%), Postives = 102/209 (48.80%), Query Frame = 3
Query:  306 GDTLMHWACLSGNLDIVSYL---KVIYK--------------NDTNSNVSW------PSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLT--DVEGDNALHWALYKGHPELSRMLVFYGLN----CNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKT 845
            G T +HWAC +GN + +  L   K   K              ND  +  S        SI++C+++  +TPLH A   +++  +Q L++    +NA D    T L+M+ + G  +GA+ +++N A   LT  D + +  LH A  KGH E   +L+   +      N+K+   QTPLH A+ +G    + +L+ K    L V +N +++
Sbjct:  772 GYTPLHWACYNGNENCIEVLLEQKCFRKFIGNPFTPLHCAIINDHGNCASLLLGAIDSSIVSCRDDKGRTPLHAAAFADHVECLQLLLRHSAPVNAVDNSGKTALMMAAENGQ-AGAVDILVNSAQADLTVKDKDLNTPLHLACSKGH-EKCALLILDKIQDESLINEKNNALQTPLHVAARNGLKVVVEELLAKGACVLAVDENASRS 978          

HSP 5 Score: 70.0922 bits (170), Expect = 8.305e-12
Identity = 58/194 (29.90%), Postives = 92/194 (47.42%), Query Frame = 3
Query:  288 DVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCD----INAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNV--HDNNNKTPL 851
            D+    G T +  A   G+ + V  L        N   S   I    N   +TPLH A  I   ++   L+ E  D    ++ KD K  TPL+++  YG+I     L+   AN+   D+ G  ALH  +  GH E  +ML+   ++   KD+ G+TPLH+A+  G+ + +++L++    E +    DN   TPL
Sbjct:  594 DIRDEKGRTALDLAAFKGHTECVEAL-------INQGAS---IFVKDNVTKRTPLH-ASVINGHTLCLRLLLEIADNPEAVDVKDAKGQTPLMLAVAYGHIDAVSLLLEKEANVDTVDILGCTALHRGIMTGHEECVQMLLEQEVSILCKDSRGRTPLHYAAARGHATWLSELLQMALSEEDCCFKDNQGYTPL 776          

HSP 6 Score: 57.3806 bits (137), Expect = 6.075e-8
Identity = 52/197 (26.40%), Postives = 87/197 (44.16%), Query Frame = 3
Query:  300 STGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINC--KNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSC--QYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYR 878
            S G T +H+A   G+   +S L  +  ++ +          C  K+    TPLHWAC   N + I+ L+++ C          TPL  +    +GN +  L   ++ + +   D +G   LH A +  H E  ++L+ +    N  D  G+T L  A+ +G    +  LV     +L V D +  TPL LA  + + 
Sbjct:  734 SRGRTPLHYAAARGHATWLSELLQMALSEED----------CCFKDNQGYTPLHWACYNGNENCIEVLLEQKC-FRKFIGNPFTPLHCAIINDHGNCASLLLGAIDSSIVSCRDDKGRTPLHAAAFADHVECLQLLLRHSAPVNAVDNSGKTALMMAAENGQAGAVDILVNSAQADLTVKDKDLNTPLHLACSKGHE 919          

HSP 7 Score: 53.1434 bits (126), Expect = 1.479e-6
Identity = 41/141 (29.08%), Postives = 68/141 (48.23%), Query Frame = 3
Query:  441 QTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAA 863
            Q PL  A    +   I+ L+ +  D+N  D++  TPL ++   G+      LIL+GA +   D      LH A+     E  ++L+ +  + N +D   QTPLH A+ +  + C A+++      +NV D   +T L  AA
Sbjct:    9 QPPLVQAIFSGDPEEIRMLIHKTEDVNTLDSEKRTPLHVAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKC-AEVIIPLLSSVNVSDRGGRTALHHAA 148          
BLAST of Palmitoyltransferase vs. Ensembl Celegans
Match: dhhc-14 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:Q7Z127])

HSP 1 Score: 102.834 bits (255), Expect = 7.558e-23
Identity = 119/534 (22.28%), Postives = 221/534 (41.39%), Query Frame = 3
Query:  189 ESNTLGDLLEIIKSGKKELLFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELS----RMLVFYGLNCNQKDAF-GQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKR-VNKLSSFSR-------------------------LKY-KIIGAPNKNRFPMIFL-ILCAFLWGNPYYYYVIRPCSINYAQ------------------FTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIM---LMNAVNFLAG---YLLYI------AYTFTNLFIYTVIFTSLLIALGLVLGFTINFFLCKQALLNLTLVEAQR 1601
            +S  L  ++   + G  E +   LK   S    D     G +L+HWA ++  L+ V+ L + Y  D N              L  +P+HWA     +++   LVK G   N +D +  TP+ ++ Q  ++    Y +L     +  D+  ++ +  A+       +    R++V  G + + K+ F G T LH A+   N S + +L+E  N  +N+ +  ++TPL +A   K   I + ++    ++ V++ S F R                          KY  +I A        IFL +L  F + +P Y  +  P  +  A+                  +  +LF++    + F        DPG +   +  ++  +NE +         I+  +    + C +C   ++   KHC +C  CV+  DHHCP++ +C+ +RN   F +F++   + +A+  +A     LL I       +  T+ F+   I  S + AL L + F +      Q +     ++A+R
Sbjct:   20 DSFNLHAVISATQHGHVESVEAALKQGLSPNTTD---DDGCSLLHWAAINNRLE-VARLLISYNADANL---------IGGVLASSPIHWAARNGLVAMCAVLVKGGAVCNVRDIQGYTPIHLAIQGNHVPLVAYFLLKFE--YAKDISDNSGMTPAMMCAKRSFTMFPLRLIVRAGADLSLKEHFSGNTALHLAAQDRNSSAVMELLE-GNANVNIRNKQSETPLDMARTIKSPQILDLMEDAARRQGVSRTSCFRRSFVPPISTYFFFLVPMFGFFMTYLLFKYLPLIIATFSTLISCIFLMVLIRFDYHDPTYKLL--PYGVTIAEAILMVLSWSAYAHWYVPWWAQMLFVLSVLALAFTLFRIGTLDPGVVRAAKNCHQLFVNEAE-------AGIQHQQ----KYCFTCFIRKMDHTKHCAVCGFCVNNFDHHCPWLNSCVTRRNMREFIMFVISVSVSSAIYCMATSHYALLQIEDHGLEEFLETDAFLMITIILSAMHALMLAVLFCVQMNQISQGVTTNDRIKARR 524          
BLAST of Palmitoyltransferase vs. Ensembl Celegans
Match: dhhc-13 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:Q9TYQ6])

HSP 1 Score: 80.8777 bits (198), Expect = 8.436e-16
Identity = 115/515 (22.33%), Postives = 205/515 (39.81%), Query Frame = 3
Query:  294 FPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLT-DVEGDNALHWALYKGHPELSRMLVFYGLNCN---QKDAFGQTPLHFASLSGNISCIADLV-------EKDNVELNVHD-NNNKTPLMLAAGRKYRVITEYLKYQINKRVNK--LSSF--SRLKYKIIGAPNKNRFPMIFLILCAFLWGNPYYYYVIR-----------PCS----INYAQFTNLLF----------IVFQCLMWFA----FLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNR---VWFWLFIMLMNAVNFLAGYLLYIAYTFTN-------LFIYTVIFTSLLIALGLVLGFT----INFFLCKQALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNH 1661
            F   G  L+HWA ++  LDI+  L + ++ D N              +  TPLHWAC       +  LVK G D   K+    TPL ++   GN     YL++   NI  T D  G +AL  A  K    L  + +F  ++       D  G T LH  +   N+  + +L+       + DN  ++  D  +NK   ++      R I E L     K  ++  L  F  + +   +IGA     F   F ++   L       +++            P +    +  A+F  L+F          ++F C +W      + +  L +PG +      ++  + +++             +   ++ C +C   +   + HC  CD+CVD  DHHCP++  C+ ++N    V+F L I + +   F    LLY+     N       L  + ++  SL++A+  V G        F    + +  + ++  QR ++ +  +       NP+ +
Sbjct:   64 FDHEGCGLLHWAAINNKLDIIQLL-LSHRADINL---------IGGNMKSTPLHWACYNSQFGAVMALVKNGADPTIKNINGETPLHLAACTGNFIIIAYLLVKFDNIKDTRDNLGRSALMMAADKSFG-LFPIRIFTKVDAYLDFTDDEKGNTALHILAARQNLKGVVELICSGADDTKTDNNGVSARDLMDNKFRNLVDKQVTARNICE-LGTICEKVTSRWFLGQFFTATISGVMIGAATGLYFLTNFWVVLGGLALTALLLFILVQRRQMDQFGCLPVTYIFWMGIAEFALLIFNSNGLVHWSVLIFVCSIWVISASFYWILILTNPGVLPRSTTPFKDFIKDLE-------------EKQIDRYCFTCWIPKTSSSHHCSQCDKCVDGFDHHCPWIHKCVYRKNLRAFVFFCLTIFMFHV--FYVLLLLYMIGASMNASGFEQTLNDHGLMVISLILAIPHVFGAGAITCTQFSQISRHVSTIEIIRKQRLQRNSSEKTITSPEHNPWEY 551          

HSP 2 Score: 54.299 bits (129), Expect = 1.686e-7
Identity = 66/235 (28.09%), Postives = 95/235 (40.43%), Query Frame = 3
Query:  264 NSGSEILYDVFPSTGDTLMHWA---CLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTP---LHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEK-DNVELNVHDNNNKTPLMLAAGRKY-----RVITE---YLKYQINKRVN 923
            NSG+E+         D+ MH A   C  G +  V +L        N +VS        NE        LHWA     L +IQ L+    DIN                          L G N+  T       LHWA Y         LV  G +   K+  G+TPLH A+ +GN   IA L+ K DN++ +  DN  ++ LM+AA + +     R+ T+   YL +  +++ N
Sbjct:   27 NSGAEM---------DSKMHQAVRACQIGEIQTVRFL-------LNGHVS-------ANEFDHEGCGLLHWAAINNKLDIIQLLLSHRADIN--------------------------LIGGNMKST------PLHWACYNSQFGAVMALVKNGADPTIKNINGETPLHLAACTGNFIIIAYLLVKFDNIK-DTRDNLGRSALMMAADKSFGLFPIRIFTKVDAYLDFTDDEKGN 205          
BLAST of Palmitoyltransferase vs. Ensembl Celegans
Match: dhhc-7 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:Q9U3P7])

HSP 1 Score: 75.8702 bits (185), Expect = 3.055e-15
Identity = 45/140 (32.14%), Postives = 69/140 (49.29%), Query Frame = 3
Query: 1263 LCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIMLMNAVNFLAGYLL------YIAYTFT--------NLFIYTVIFTSLLIALGLVLGFTINFFLCKQ---ALLNLTLVEAQRWKKYNYLQNE 1631
            +C  C  +R  RA HCR+C RCV +MDHHCP+V NC+G+ N+ WF  FI  + A +  +  +L      + AY  T        NL+   VI + +L     + G  +    C Q      + T +E+ + +  NYL + 
Sbjct:   52 MCTRCDSLRPPRAHHCRVCKRCVRKMDHHCPWVNNCVGEYNQKWFLQFIFYVGASSAYSLLVLCLCWVWHDAYGMTGIKGPLGENLYHAKVIHSIMLAMESALFGLFVLAVSCDQLGAIFTDETAIESVQRRGRNYLASS 191          
BLAST of Palmitoyltransferase vs. Ensembl Celegans
Match: dhhc-7 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:Q9U3P7])

HSP 1 Score: 75.8702 bits (185), Expect = 8.332e-15
Identity = 56/207 (27.05%), Postives = 87/207 (42.03%), Query Frame = 3
Query: 1098 VFQCLMW---FAFLMTALKDPGFMVCDEKTYETVLNEI---------KLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIMLMNAVNFLA------GYLLYIAYTFT--------NLFIYTVIFTSLLIALGLVLGFTINFFLCKQ---ALLNLTLVEAQRWKKYNYLQNE 1631
            VF CL+     A     L DPG +       +   N +              FR+  +         +C  C  +R  RA HCR+C RCV +MDHHCP+V NC+G+ N+ WF  FI  + A +  +       ++ + AY  T        NL+   VI + +L     + G  +    C Q      + T +E+ + +  NYL + 
Sbjct:   47 VFNCLLATTIVAHTRAMLSDPGTVPISSSKGQNTPNPVFSSDEEDESDEEAVFRHDHLNRSSATEWTMCTRCDSLRPPRAHHCRVCKRCVRKMDHHCPWVNNCVGEYNQKWFLQFIFYVGASSAYSLLVLCLCWVWHDAYGMTGIKGPLGENLYHAKVIHSIMLAMESALFGLFVLAVSCDQLGAIFTDETAIESVQRRGRNYLASS 253          
BLAST of Palmitoyltransferase vs. Ensembl Celegans
Match: dhhc-3 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:Q95X59])

HSP 1 Score: 74.7146 bits (182), Expect = 1.047e-14
Identity = 41/123 (33.33%), Postives = 66/123 (53.66%), Query Frame = 3
Query: 1077 FTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIMLMNAVNFLAGY 1445
            F  ++F  F  L   + L T   DPG +   + T ET+   ++L++  + +    YK      C  C  ++  RA HC +C+RC+  MDHHCP+V NC+G+ N+ +F LF M +  ++  A Y
Sbjct:   34 FNFIVFESFSVLAVISHLKTMTTDPGAVAKGDCTDETI-ERMQLINGQQTI----YK------CQKCASIKPDRAHHCSVCERCIRRMDHHCPWVNNCVGEGNQKFFVLFTMYIALLSMHALY 145          
BLAST of Palmitoyltransferase vs. Ensembl Fly
Match: Patsas (gene:FBgn0029137 transcript:FBtr0080362)

HSP 1 Score: 315.849 bits (808), Expect = 4.782e-100
Identity = 174/503 (34.59%), Postives = 273/503 (54.27%), Query Frame = 3
Query:  198 TLGDLLEIIKSGKKELLFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVNKLSSFSRLKYKIIGAPNKNRFPMIFLILCAFLWGNPYYYYVIRPCSINYAQFTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIMLMNAVN-----FLAGYLLYIAYTFTNLFIYTVIFTSLLIALGLVLGFTINFFLCKQALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYF 1691
            +L D+ +IIK+G+   +   +   G E L       G T  HW  L+GN+ ++ YL            + P  + C       P+HWAC   + SV+Q L++ G  +NA D K +TPL ++C YG  + A YL+  GA   LTD+ GD ALHWA YKGH +L R+L++ G+   + D FG TPLH A LSGN++C+  L EK  ++L   D N KTP+MLA   +++ +   L  ++ K+   + S S     + G    ++ P+   +    LWG P Y     P + N  + ++  FI +  +MW ++ +   +DPG++      Y   + +I   D  +   +        +LCHSC+C+R +RAKHCR+C+RCV   DHHCP++ NC+G RNR+WF+LF++ + AVN     + A Y + I   FT L++  +I   +   LG +L  T     C    +NLT  E   +K+Y YL+++ G++ NP++ G I NL+ +F
Sbjct:   86 SLDDIFDIIKNGEVSEVENLVDKFGMECL-SARDRHGYTPAHWIALNGNVQLMRYL---------IERTAPIDLPCLGTQGPRPIHWACRKGHASVVQVLLQAGVAVNAADFKGLTPLHLACMYGRTATAAYLLGMGALNNLTDINGDTALHWAAYKGHADLMRLLMYSGVELQKTDNFGSTPLHLACLSGNMTCVRLLCEKSQLDLEPRDKNGKTPIMLAQAHQHQDVVRLLYGEVKKKSRWIPSVSESWGWLFGGAGDSKGPLFLFLFSVLLWGYPMYMIRAIPITWNILRRSHYCFIYWNAVMWISWAIANRRDPGYIPLSSDAYYRAIKQIPYFDKLKKRNVM-----LTRLCHSCRCLRPLRAKHCRVCNRCVSYFDHHCPFIYNCVGLRNRMWFFLFVLSV-AVNCSFTIYFACYCVMIE-GFTMLYVLGLIEAVVFCGLGWILTCTSILHAC----MNLTTNEMFNYKRYPYLRDKRGRYQNPFSRGPILNLLEFF 567          
BLAST of Palmitoyltransferase vs. Ensembl Fly
Match: Patsas (gene:FBgn0029137 transcript:FBtr0474167)

HSP 1 Score: 315.079 bits (806), Expect = 8.240e-100
Identity = 174/503 (34.59%), Postives = 273/503 (54.27%), Query Frame = 3
Query:  198 TLGDLLEIIKSGKKELLFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVNKLSSFSRLKYKIIGAPNKNRFPMIFLILCAFLWGNPYYYYVIRPCSINYAQFTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIMLMNAVN-----FLAGYLLYIAYTFTNLFIYTVIFTSLLIALGLVLGFTINFFLCKQALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYF 1691
            +L D+ +IIK+G+   +   +   G E L       G T  HW  L+GN+ ++ YL            + P  + C       P+HWAC   + SV+Q L++ G  +NA D K +TPL ++C YG  + A YL+  GA   LTD+ GD ALHWA YKGH +L R+L++ G+   + D FG TPLH A LSGN++C+  L EK  ++L   D N KTP+MLA   +++ +   L  ++ K+   + S S     + G    ++ P+   +    LWG P Y     P + N  + ++  FI +  +MW ++ +   +DPG++      Y   + +I   D  +   +        +LCHSC+C+R +RAKHCR+C+RCV   DHHCP++ NC+G RNR+WF+LF++ + AVN     + A Y + I   FT L++  +I   +   LG +L  T     C    +NLT  E   +K+Y YL+++ G++ NP++ G I NL+ +F
Sbjct:   86 SLDDIFDIIKNGEVSEVENLVDKFGMECL-SARDRHGYTPAHWIALNGNVQLMRYL---------IERTAPIDLPCLGTQGPRPIHWACRKGHASVVQVLLQAGVAVNAADFKGLTPLHLACMYGRTATAAYLLGMGALNNLTDINGDTALHWAAYKGHADLMRLLMYSGVELQKTDNFGSTPLHLACLSGNMTCVRLLCEKSQLDLEPRDKNGKTPIMLAQAHQHQDVVRLLYGEVKKKSRWIPSVSESWGWLFGGAGDSKGPLFLFLFSVLLWGYPMYMIRAIPITWNILRRSHYCFIYWNAVMWISWAIANRRDPGYIPLSSDAYYRAIKQIPYFDKLKKRNVM-----LTRLCHSCRCLRPLRAKHCRVCNRCVSYFDHHCPFIYNCVGLRNRMWFFLFVLSV-AVNCSFTIYFACYCVMIE-GFTMLYVLGLIEAVVFCGLGWILTCTSILHAC----MNLTTNEMFNYKRYPYLRDKRGRYQNPFSRGPILNLLEFF 567          
BLAST of Palmitoyltransferase vs. Ensembl Fly
Match: Patsas (gene:FBgn0029137 transcript:FBtr0474166)

HSP 1 Score: 315.079 bits (806), Expect = 1.862e-99
Identity = 174/503 (34.59%), Postives = 273/503 (54.27%), Query Frame = 3
Query:  198 TLGDLLEIIKSGKKELLFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVNKLSSFSRLKYKIIGAPNKNRFPMIFLILCAFLWGNPYYYYVIRPCSINYAQFTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIMLMNAVN-----FLAGYLLYIAYTFTNLFIYTVIFTSLLIALGLVLGFTINFFLCKQALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYF 1691
            +L D+ +IIK+G+   +   +   G E L       G T  HW  L+GN+ ++ YL            + P  + C       P+HWAC   + SV+Q L++ G  +NA D K +TPL ++C YG  + A YL+  GA   LTD+ GD ALHWA YKGH +L R+L++ G+   + D FG TPLH A LSGN++C+  L EK  ++L   D N KTP+MLA   +++ +   L  ++ K+   + S S     + G    ++ P+   +    LWG P Y     P + N  + ++  FI +  +MW ++ +   +DPG++      Y   + +I   D  +   +        +LCHSC+C+R +RAKHCR+C+RCV   DHHCP++ NC+G RNR+WF+LF++ + AVN     + A Y + I   FT L++  +I   +   LG +L  T     C    +NLT  E   +K+Y YL+++ G++ NP++ G I NL+ +F
Sbjct:  114 SLDDIFDIIKNGEVSEVENLVDKFGMECL-SARDRHGYTPAHWIALNGNVQLMRYL---------IERTAPIDLPCLGTQGPRPIHWACRKGHASVVQVLLQAGVAVNAADFKGLTPLHLACMYGRTATAAYLLGMGALNNLTDINGDTALHWAAYKGHADLMRLLMYSGVELQKTDNFGSTPLHLACLSGNMTCVRLLCEKSQLDLEPRDKNGKTPIMLAQAHQHQDVVRLLYGEVKKKSRWIPSVSESWGWLFGGAGDSKGPLFLFLFSVLLWGYPMYMIRAIPITWNILRRSHYCFIYWNAVMWISWAIANRRDPGYIPLSSDAYYRAIKQIPYFDKLKKRNVM-----LTRLCHSCRCLRPLRAKHCRVCNRCVSYFDHHCPFIYNCVGLRNRMWFFLFVLSV-AVNCSFTIYFACYCVMIE-GFTMLYVLGLIEAVVFCGLGWILTCTSILHAC----MNLTTNEMFNYKRYPYLRDKRGRYQNPFSRGPILNLLEFF 595          
BLAST of Palmitoyltransferase vs. Ensembl Fly
Match: Hip14 (gene:FBgn0259824 transcript:FBtr0075518)

HSP 1 Score: 139.813 bits (351), Expect = 7.711e-35
Identity = 135/529 (25.52%), Postives = 207/529 (39.13%), Query Frame = 3
Query:  312 TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHP-ELSRMLVFYGLNCNQKD-AFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLML----------AAGRKYRVITEYLKYQINKR-VNKLSSFSRLK--------------------------------------YKIIGAPNKNRFPMIFLILCAFLWGNPYYYYVIRPCSINYAQFT-NLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLF---IMLMNAVNFLAGYLLYI---AYTFTNLFIYTVIFTSLLIALGLVLG-------FTINFFLCKQ---ALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFN 1694
            TL+HWA ++   DI+ Y   + K  T   V          EL+ TPLHWA    +L  +  L+  G D   +D +  + + ++ Q+ + +   Y I  G +  L D  G  AL WA +K    +  R+L+  G N    D   G T LH+A L+ N + I+ LV K    L+V +   +TPL +           A    RV    L  Q  +  ++KL    RL+                                      +  IG    +   M  L L  +L    ++Y        +   FT  + F++   L+W  FL +   DPG +     T E     I  L     +            C  C   R IR+KHC +CDRCV   DHHCP+VGNCIG +N  +F  F   +++M A     G   Y+      F +         +    +G V+G       + I   +C+      L +T  E     +Y + Q + G   +P+  G I NL+ +  
Sbjct:   80 TLLHWAAINNRRDIIRYF--LEKGATVDAVG--------GELNATPLHWATRQGHLGAVVLLMAAGADPRIRDAEGCSCIHIAAQFAHTALVAYFIAKGVDPDLQDRGGMTALMWAAWKVCALDPVRLLLTLGANPAMVDYTHGNTALHWAILARNATAISTLVLKSKASLDVPNLRGETPLSMLESQTGAIWIGAKVMDRVKEAALTSQQRRSLLSKLRHDKRLRWWSMVACPFTAFYLAGIVFTVNTLYIIKFFLLGCLYSIFHTIGKALFDEHLMALLPLSVYLATKAWFYVTWLMYIDDAVSFTATVCFLISSLLLWVCFLKSWKGDPGII---RPTREQRFKTIIELSERGGIGFEP-----ASFCSGCLVRRPIRSKHCSVCDRCVARFDHHCPWVGNCIGLKNHSYFMGFLWMLLIMCAWMLYGGSKYYVNQCNVRFDDFLGAMRAIGNCDAWVGWVMGNALLHMSWVILLTICQTYQVICLGMTTNERMNRGRYRHFQAKGGH--SPFTRGPIQNLVDFLE 588          
BLAST of Palmitoyltransferase vs. Ensembl Fly
Match: Hip14 (gene:FBgn0259824 transcript:FBtr0333577)

HSP 1 Score: 139.813 bits (351), Expect = 7.711e-35
Identity = 135/529 (25.52%), Postives = 207/529 (39.13%), Query Frame = 3
Query:  312 TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHP-ELSRMLVFYGLNCNQKD-AFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLML----------AAGRKYRVITEYLKYQINKR-VNKLSSFSRLK--------------------------------------YKIIGAPNKNRFPMIFLILCAFLWGNPYYYYVIRPCSINYAQFT-NLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLF---IMLMNAVNFLAGYLLYI---AYTFTNLFIYTVIFTSLLIALGLVLG-------FTINFFLCKQ---ALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFN 1694
            TL+HWA ++   DI+ Y   + K  T   V          EL+ TPLHWA    +L  +  L+  G D   +D +  + + ++ Q+ + +   Y I  G +  L D  G  AL WA +K    +  R+L+  G N    D   G T LH+A L+ N + I+ LV K    L+V +   +TPL +           A    RV    L  Q  +  ++KL    RL+                                      +  IG    +   M  L L  +L    ++Y        +   FT  + F++   L+W  FL +   DPG +     T E     I  L     +            C  C   R IR+KHC +CDRCV   DHHCP+VGNCIG +N  +F  F   +++M A     G   Y+      F +         +    +G V+G       + I   +C+      L +T  E     +Y + Q + G   +P+  G I NL+ +  
Sbjct:   80 TLLHWAAINNRRDIIRYF--LEKGATVDAVG--------GELNATPLHWATRQGHLGAVVLLMAAGADPRIRDAEGCSCIHIAAQFAHTALVAYFIAKGVDPDLQDRGGMTALMWAAWKVCALDPVRLLLTLGANPAMVDYTHGNTALHWAILARNATAISTLVLKSKASLDVPNLRGETPLSMLESQTGAIWIGAKVMDRVKEAALTSQQRRSLLSKLRHDKRLRWWSMVACPFTAFYLAGIVFTVNTLYIIKFFLLGCLYSIFHTIGKALFDEHLMALLPLSVYLATKAWFYVTWLMYIDDAVSFTATVCFLISSLLLWVCFLKSWKGDPGII---RPTREQRFKTIIELSERGGIGFEP-----ASFCSGCLVRRPIRSKHCSVCDRCVARFDHHCPWVGNCIGLKNHSYFMGFLWMLLIMCAWMLYGGSKYYVNQCNVRFDDFLGAMRAIGNCDAWVGWVMGNALLHMSWVILLTICQTYQVICLGMTTNERMNRGRYRHFQAKGGH--SPFTRGPIQNLVDFLE 588          
BLAST of Palmitoyltransferase vs. Ensembl Zebrafish
Match: zdhhc17 (zinc finger DHHC-type containing 17 [Source:ZFIN;Acc:ZDB-GENE-070424-194])

HSP 1 Score: 147.517 bits (371), Expect = 2.458e-37
Identity = 145/571 (25.39%), Postives = 255/571 (44.66%), Query Frame = 3
Query:  216 EIIKSGKKELLFEKLKNSGSEILYDVFPSTGD--TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIIN-CKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHP-ELSRMLVFYGLNCNQKDAFGQ-TPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLK-YQINKRVNKLSSFSRLKYK-------IIGAPNKNRFPMIFL----------------ILCAFLW------GNPYYYYVIR---PCSINYAQFTNLLFIVFQCLMW---------FAFLMTAL-----------KDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWF--WLFIMLMNAVNFLAGYLLY------IAYTFTNLFIY-TVIFTSLLIALGLVLGFTINFF---------LCKQALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFNAR 1700
            +I+K+ +  + FE+ +    E  YDV     +  TL+HWA ++  +D+V Y            +S  +I++    +L+ TPLHWA    +LS++  L+K G D +  D +  + + ++ Q+G+ S   YLI  G ++ + D  G   L WA Y+ H  + +R+L+ + ++ N  D + + T LH+A L+GN + I+ L+E  N  ++  +   +TPL LA  RK   +  +L+  +  K  +  S   RLK         ++G P    F +I+L                ++ A +W         ++ + +    P  I Y      ++I +    W           FL+ +L            DPG +   E+  +  + E+    +             +  C +C   + IR+KHC +C+RC+ + DHHCP+VGNC+G  N  +F  +LF +L      + G + Y       +YT    +IY T I T       + L    +F          L + A+L +T  E    ++Y + +       +P+NHG + NLI +F  R
Sbjct:   48 DIVKATQYGI-FERCREL-VEAGYDVRQPDKENVTLLHWAAINNRVDLVKYY-----------ISKGAIVDQLGGDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCVHLAAQFGHTSIVAYLIAKGQDVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVNLGDKYHKNTALHWAVLAGNTTVISLLLEA-NANVDAQNIKGETPLDLAKQRKNVWMINHLQEARQAKGYDSPSYLKRLKMDKEFRQKVMLGTP----FLVIWLVGFIADLDIDSWLIKGVMYAVMWLVVQFLSKSFFDHSMHSALPLGI-YLATKFWMYITWFYWFWNDLPFVTIHLPFLLNSLALFYNFGKSWKSDPGIIKASEEQKKKTIVELAETGSL----------DLSIFCSTCLIRKPIRSKHCAVCNRCIAKFDHHCPWVGNCVGSGNHRYFMGYLFFLLCMICWMMYGCICYWRIHCATSYTKDGFWIYITQIATCSPWMFWMFLNSVFHFMWVAVLIMCQLYQIAVLGITTNERMNARRYKHFKVTATSIESPFNHGCMRNLIDFFELR 589          
BLAST of Palmitoyltransferase vs. Ensembl Zebrafish
Match: zdhhc13 (zinc finger DHHC-type containing 13 [Source:ZFIN;Acc:ZDB-GENE-041212-79])

HSP 1 Score: 113.62 bits (283), Expect = 5.549e-26
Identity = 143/586 (24.40%), Postives = 237/586 (40.44%), Query Frame = 3
Query:  165 PSEKCIKSESNTLGDLLEIIKSGKKELLFEKLKNSGSEILYDVFPSTGD--TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYK-GHPELSRMLVFYGLNCNQKDAFGQ-TPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVNKLSSFSRL--KYK----------IIGA-------PNKNRFPMIFLILCAF----LWGNPYYYYVIRPCSINYAQFTNLLFIVFQCLMWFA----------------------FLMTALKDPGFMVCDEKTYE---TVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIMLMNAVNFLAGYLLYIAYTFTNL-----FIYTVIFTSLLIALG----LVLGFTINFF------------LCKQALLNLTLVE-AQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFNAR 1700
            P+++  KS         +IIK+ +   L E+ K    E  YDV     +  TL+HWA ++   DIV Y   I K           I     +L+ TPLHWA    +LS++  L++ G D +  D +    L ++  + N+  A YL+  G  + L D+ G   L  A  K   PE +  L+    + N  D   + +PLH A L+GN+  +  L+E     +++ ++N  T + LA      ++   L     +R+   S+  +L  +YK          ++GA         ++      L+ C      L         +R    +     ++ ++V   ++WF                       ++ +   DPG +   E+  +    VL E   LD                 C SC   + +RA HC  C+ CV + DHH  ++  CIG RN  +F LF++   A+NFL  ++ Y + T+ +      +    I+ +L   +G    L+  F   FF            L + A L LT  E A    +   L        NP+NHG + NL+ +F  R
Sbjct:   58 PTQQPRKSSHPEDSSSWDIIKATQFGAL-ERCKEL-VEAGYDVRQPDKENVTLLHWAAINNRADIVKYY--ISKGAV--------IDQLGGDLNSTPLHWAIRQGHLSMVIQLMRYGADPSLADGEGYRGLHLAVLFQNMPIAAYLMAKGQEVDLPDLNGQTPLMLAAQKIIGPEPTNFLIKCNASVNAVDKVNRNSPLHCAVLAGNVDSVHILLEA-GASVDMQNDNGHTAIDLAQQVHSPLLIHMLSVVKTERIKANSACLKLLNRYKVCLQSVFSVVVVGAFGAILDMRTESWLLKGILLACIMAVINLASRQLATVAVRSLIPSTGLIASVFWMVVTWVLWFLPDEPSAAVQMLFTVNITAVLYYYIRSCRTDPGHVKATEEEKKKNIVVLAEAGCLDP-------------RIFCTSCMMRKPMRANHCFSCNACVAKQDHHSIWINGCIGARNHPFFVLFLV---ALNFLCIWMFYGSITYWSRHCPLHYSEEGIWGALTALMGCSPWLLYVFCFVFFHTTWASILLVLQLYQIAFLGLTTSERANLMHRQRKLPQAVSLRQNPFNHGVVKNLVNFFQWR 614          
BLAST of Palmitoyltransferase vs. Ensembl Zebrafish
Match: ankrd52a (ankyrin repeat domain 52a [Source:NCBI gene;Acc:553206])

HSP 1 Score: 99.3673 bits (246), Expect = 3.077e-21
Identity = 62/194 (31.96%), Postives = 100/194 (51.55%), Query Frame = 3
Query:  303 TGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAA--GRKYR 878
            TG   +H A  SG  ++V   K++     N        ++  ++  + P+HWA  + +L V++ LV +G D + KD +  TPL  +   G++    YL+ NGA I   +  G+ ALH A Y G   ++  LV  G N NQ +  G TPLH A++S N +   +L+  +  ++N+     K+PL +AA  GR  R
Sbjct:  139 TGRAPLHHAAQSGYQEMV---KLLLNKGAN--------LSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYTGQEAVANELVNRGANVNQPNHRGYTPLHLAAVSTNGALCLELLVNNGADVNMQSKEGKSPLHMAAIHGRFTR 321          

HSP 2 Score: 75.0998 bits (183), Expect = 1.436e-13
Identity = 50/160 (31.25%), Postives = 87/160 (54.37%), Query Frame = 3
Query:  411 SIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILN--GANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLN----CNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRK 872
            S++N ++   +TPLH A   E+++ +Q ++++G DI+A D    + L+++  YG  SGA+ L+L+   A++ L DV  + ALH A  K H E+  ML+   ++     N  ++  Q PLH A+ +G  + +  L+ +    L V D    TP +  A  K
Sbjct:  844 SLVNIRDAKGRTPLHAAAVAEDVAGLQLVLRQGADIDAVDHSGRSALMVAADYGQ-SGAVALLLHRAKADLSLLDVNKNTALHLACSKAH-EMCAMLILKEIHNPILINATNSMLQMPLHIAARNGLATVVQALLNRGATVLAV-DEEGHTPALACASNK 1000          

HSP 3 Score: 71.2478 bits (173), Expect = 2.177e-12
Identity = 58/193 (30.05%), Postives = 91/193 (47.15%), Query Frame = 3
Query:  228 SGKKELLFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSV-IQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEK 803
            SG  +++   L+N G+EI  D   + G+T +H AC +G   + + L      +  +NV+ P      N    TPLH A    N ++ ++ LV  G D+N +  +  +PL M+  +G  + +  LI NG  I   D  G+  LH A   GH  L   L+  G +  ++   G  PLH A L G+  C   L+  
Sbjct:  216 SGHVDVVKYLLRN-GAEI--DEPNAFGNTALHVACYTGQEAVANELV-----NRGANVNQP------NHRGYTPLHLAAVSTNGALCLELLVNNGADVNMQSKEGKSPLHMAAIHGRFTRSQILIQNGGEIDCVDRYGNTPLHVAAKYGHELLISTLMTNGADTARQGIHGMFPLHLAVLYGSSDCCRKLLSS 394          

HSP 4 Score: 70.4774 bits (171), Expect = 4.049e-12
Identity = 66/252 (26.19%), Postives = 108/252 (42.86%), Query Frame = 3
Query:  243 LLFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNI--------SGALYLIL----------NGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKY--RVITEYLKYQINKRVNKLSSF 938
            L  E L N+G+++  ++    G + +H A + G     +  +++ +N           I+C +    TPLH A    +  +I  L+  G D   +    + PL ++  YG+         SG LY I+           G +I   D  G   LH A   G+ E   +L+  G + N+KD FG+TPLH+A+ +G   C+  LV     E+N  D +  TPL  +A      R    +     N+   +  SF
Sbjct:  287 LCLELLVNNGADV--NMQSKEGKSPLHMAAIHGRF---TRSQILIQNGGE--------IDCVDRYGNTPLHVAAKYGHELLISTLMTNGADTARQGIHGMFPLHLAVLYGSSDCCRKLLSSGQLYSIVLSMSKEHVLSAGFDINTPDNFGRTCLHAAASGGNIECLNLLLSSGADMNKKDKFGRTPLHYAAANGRYQCVVVLVGA-GAEVNERDRSGCTPLHYSAASTAFCRTDRPHASTHQNQEDGEKESF 524          

HSP 5 Score: 68.5514 bits (166), Expect = 1.540e-11
Identity = 38/123 (30.89%), Postives = 61/123 (49.59%), Query Frame = 3
Query:  417 INCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCI 785
            +  +++  QTPLH A        ++ L+     +N  D     PL  + Q G       L+  GAN+  +D +    +HWA Y GH E+ ++LV  G + + KD  G TPLH A+ SG++  +
Sbjct:  100 VTARDKYWQTPLHIAAANRATRCVETLLPHVSSLNMADRTGRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVV 222          

HSP 6 Score: 65.4698 bits (158), Expect = 1.348e-10
Identity = 41/151 (27.15%), Postives = 74/151 (49.01%), Query Frame = 3
Query:  411 SIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAA 863
            S +N  +   + PLH A       +++ L+ +G +++A D K+  P+  +   G++     L+  G++    D  G   LH A   GH ++ + L+  G   ++ +AFG T LH A  +G  +   +LV +    +N  ++   TPL LAA
Sbjct:  131 SSLNMADRTGRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYTGQEAVANELVNR-GANVNQPNHRGYTPLHLAA 280          

HSP 7 Score: 58.9214 bits (141), Expect = 1.522e-8
Identity = 44/193 (22.80%), Postives = 82/193 (42.49%), Query Frame = 3
Query:  417 INCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIF---------------------------------LTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYL 896
            +N  ++  +TPLH A  + ++ ++  L+  G ++NAKD   +TPL  +    N      L+  GA++                                  + D  G   LH A   G+ E+ ++L+  G N +  D   + P+H+A+  G++  +  LV + + + +  D    TPL  AA   +  + +YL
Sbjct:   34 VNALDQERRTPLHAAAWLGDVHIMDLLISAGANVNAKDHVWLTPLHRAAASRNERAVGLLLRKGADVTARDKYWQTPLHIAAANRATRCVETLLPHVSSLNMADRTGRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGS-DKSCKDKRGYTPLHAAAASGHVDVVKYL 225          

HSP 8 Score: 56.6102 bits (135), Expect = 6.949e-8
Identity = 47/173 (27.17%), Postives = 77/173 (44.51%), Query Frame = 3
Query:  441 QTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVNKLSSFSRLKYKI 959
            Q PL  A    N   ++  + +  ++NA D +  TPL  +   G++     LI  GAN+   D      LH A    +     +L+  G +   +D + QTPLH A+ +    C+  L+   +  LN+ D   + PL  AA   Y+   E +K  +NK  N  +S  + +  I
Sbjct:    9 QPPLVQAIFNRNADEVKLFLHKKDEVNALDQERRTPLHAAAWLGDVHIMDLLISAGANVNAKDHVWLTPLHRAAASRNERAVGLLLRKGADVTARDKYWQTPLHIAAANRATRCVETLLPHVS-SLNMADRTGRAPLHHAAQSGYQ---EMVKLLLNKGANLSASDKKDRQPI 177          
BLAST of Palmitoyltransferase vs. Ensembl Zebrafish
Match: ankrd52a (ankyrin repeat domain 52a [Source:NCBI gene;Acc:553206])

HSP 1 Score: 99.3673 bits (246), Expect = 3.455e-21
Identity = 62/194 (31.96%), Postives = 100/194 (51.55%), Query Frame = 3
Query:  303 TGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAA--GRKYR 878
            TG   +H A  SG  ++V   K++     N        ++  ++  + P+HWA  + +L V++ LV +G D + KD +  TPL  +   G++    YL+ NGA I   +  G+ ALH A Y G   ++  LV  G N NQ +  G TPLH A++S N +   +L+  +  ++N+     K+PL +AA  GR  R
Sbjct:  139 TGRAPLHHAAQSGYQEMV---KLLLNKGAN--------LSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYTGQEAVANELVNRGANVNQPNHRGYTPLHLAAVSTNGALCLELLVNNGADVNMQSKEGKSPLHMAAIHGRFTR 321          

HSP 2 Score: 75.0998 bits (183), Expect = 1.491e-13
Identity = 50/160 (31.25%), Postives = 87/160 (54.37%), Query Frame = 3
Query:  411 SIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILN--GANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLN----CNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRK 872
            S++N ++   +TPLH A   E+++ +Q ++++G DI+A D    + L+++  YG  SGA+ L+L+   A++ L DV  + ALH A  K H E+  ML+   ++     N  ++  Q PLH A+ +G  + +  L+ +    L V D    TP +  A  K
Sbjct:  830 SLVNIRDAKGRTPLHAAAVAEDVAGLQLVLRQGADIDAVDHSGRSALMVAADYGQ-SGAVALLLHRAKADLSLLDVNKNTALHLACSKAH-EMCAMLILKEIHNPILINATNSMLQMPLHIAARNGLATVVQALLNRGATVLAV-DEEGHTPALACASNK 986          

HSP 3 Score: 68.5514 bits (166), Expect = 1.520e-11
Identity = 38/123 (30.89%), Postives = 61/123 (49.59%), Query Frame = 3
Query:  417 INCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCI 785
            +  +++  QTPLH A        ++ L+     +N  D     PL  + Q G       L+  GAN+  +D +    +HWA Y GH E+ ++LV  G + + KD  G TPLH A+ SG++  +
Sbjct:  100 VTARDKYWQTPLHIAAANRATRCVETLLPHVSSLNMADRTGRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVV 222          

HSP 4 Score: 65.4698 bits (158), Expect = 1.297e-10
Identity = 71/290 (24.48%), Postives = 120/290 (41.38%), Query Frame = 3
Query:  189 ESNTLGD-LLEIIKSGKKELLFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGN---------------------------ISGALYLIL----------NGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKY--RVITEYLKYQINKRVNKLSSF 938
            E N  G+  L +     +E +  +L N G+ +  +     G T +H A +S N  +   L+++  N  +        +N +++  ++PLH A      +  Q L++ G +I+  D    TPL ++ +YG+                            +G LY I+           G +I   D  G   LH A   G+ E   +L+  G + N+KD FG+TPLH+A+ +G   C+  LV     E+N  D +  TPL  +A      R    +     N+   +  SF
Sbjct:  234 EPNAFGNTALHVACYTGQEAVANELVNRGANV--NQPNHRGYTPLHLAAVSTNGALC--LELLVNNGAD--------VNMQSKEGKSPLHMAAIHGRFTRSQILIQNGGEIDCVDRYGNTPLHVAAKYGHELLISTLMTNGADTASFETSDKQIVCVFAGQLYSIVLSMSKEHVLSAGFDINTPDNFGRTCLHAAASGGNIECLNLLLSSGADMNKKDKFGRTPLHYAAANGRYQCVVVLVGA-GAEVNERDRSGCTPLHYSAASTAFCRTDRPHASTHQNQEDGEKESF 510          

HSP 5 Score: 65.4698 bits (158), Expect = 1.426e-10
Identity = 41/151 (27.15%), Postives = 74/151 (49.01%), Query Frame = 3
Query:  411 SIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAA 863
            S +N  +   + PLH A       +++ L+ +G +++A D K+  P+  +   G++     L+  G++    D  G   LH A   GH ++ + L+  G   ++ +AFG T LH A  +G  +   +LV +    +N  ++   TPL LAA
Sbjct:  131 SSLNMADRTGRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYTGQEAVANELVNR-GANVNQPNHRGYTPLHLAA 280          

HSP 6 Score: 58.9214 bits (141), Expect = 1.638e-8
Identity = 44/193 (22.80%), Postives = 82/193 (42.49%), Query Frame = 3
Query:  417 INCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIF---------------------------------LTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYL 896
            +N  ++  +TPLH A  + ++ ++  L+  G ++NAKD   +TPL  +    N      L+  GA++                                  + D  G   LH A   G+ E+ ++L+  G N +  D   + P+H+A+  G++  +  LV + + + +  D    TPL  AA   +  + +YL
Sbjct:   34 VNALDQERRTPLHAAAWLGDVHIMDLLISAGANVNAKDHVWLTPLHRAAASRNERAVGLLLRKGADVTARDKYWQTPLHIAAANRATRCVETLLPHVSSLNMADRTGRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGS-DKSCKDKRGYTPLHAAAASGHVDVVKYL 225          

HSP 7 Score: 56.6102 bits (135), Expect = 7.677e-8
Identity = 47/173 (27.17%), Postives = 77/173 (44.51%), Query Frame = 3
Query:  441 QTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVNKLSSFSRLKYKI 959
            Q PL  A    N   ++  + +  ++NA D +  TPL  +   G++     LI  GAN+   D      LH A    +     +L+  G +   +D + QTPLH A+ +    C+  L+   +  LN+ D   + PL  AA   Y+   E +K  +NK  N  +S  + +  I
Sbjct:    9 QPPLVQAIFNRNADEVKLFLHKKDEVNALDQERRTPLHAAAWLGDVHIMDLLISAGANVNAKDHVWLTPLHRAAASRNERAVGLLLRKGADVTARDKYWQTPLHIAAANRATRCVETLLPHVS-SLNMADRTGRAPLHHAAQSGYQ---EMVKLLLNKGANLSASDKKDRQPI 177          
BLAST of Palmitoyltransferase vs. Ensembl Zebrafish
Match: invs (inversin [Source:NCBI gene;Acc:245946])

HSP 1 Score: 94.7449 bits (234), Expect = 8.775e-20
Identity = 57/182 (31.32%), Postives = 98/182 (53.85%), Query Frame = 3
Query:  306 GDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPL 851
            G T   WA   G+ D++  + +  K D +        IN  ++   T LH A    ++S ++ L+++G  ++  D    TPL  +C+ G+    L LI  GA + L D++G +ALHWA   G+ E+  +L+  G++ N +D  G+TPL  A+ +G I+C+A L++ D  + N+ D   +T L
Sbjct:  315 GRTAFMWAAGKGSNDVIKIM-LDLKKDID--------INMTDKYGGTALHAAALSGHVSTVRLLLEQGGMVDPLDVMKHTPLFRACEMGHRDVILTLIKGGARVDLVDIDGHSALHWAALGGNAEVCEVLMENGISPNLQDQAGRTPLQCAAYAGYINCMALLIQHD-ADPNIQDKEGRTAL 486          

HSP 2 Score: 59.6918 bits (143), Expect = 7.370e-9
Identity = 50/192 (26.04%), Postives = 79/192 (41.15%), Query Frame = 3
Query:  411 SIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYG----------------------NISGALY-------------LILNGANIFLTDVEGDNALHWALYKGHPELSRML--VFYGLNC----NQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAA 863
            + IN  +   +T LH A    N+  ++ L+    D   KD + +TPL ++ ++                       N   AL+             LI + +NI + D EG   LHWA +  HP  +R +  +          N +D  G+TPLHFA   GN + +  L   +   +  +DN  +TPL  AA
Sbjct:   65 AAINKTDHSQRTALHLAAQKGNVRFMKLLLSRHADWRLKDLEEMTPLHLASRHSSSKPLSLLLKHMAPGEVDTQDRNKQTALHWSAFYNHPEHVKLLIKHDSNIGIPDSEGKIPLHWAAHNKHPNATRTVRCILEAAPTESLLNWQDYEGRTPLHFAVADGNEAVVEVLTSYEGCSVTAYDNLFRTPLHWAA 256          

HSP 3 Score: 59.3066 bits (142), Expect = 9.619e-9
Identity = 51/197 (25.89%), Postives = 94/197 (47.72%), Query Frame = 3
Query:  306 GDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEG-CDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIF-LTDVEGDNALHWALYKGHPELSRML--VFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVI 884
            G T +H+A   GN  +V  L   Y+  +         +   + L +TPLHWA  + +  ++  L++     +   D++  TPL    Q  N +  + + L   ++    D+EG  A  WA  KG  ++ +++  +   ++ N  D +G T LH A+LSG++S +  L+E+  + ++  D    TPL  A    +R +
Sbjct:  214 GRTPLHFAVADGNEAVVEVL-TSYEGCS---------VTAYDNLFRTPLHWAALLGHAKIVHLLLERNKSGMIPSDSQGATPLHYGAQ-SNYADTVAVFLKHHSVRDEPDLEGRTAFMWAAGKGSNDVIKIMLDLKKDIDINMTDKYGGTALHAAALSGHVSTVRLLLEQGGM-VDPLDVMKHTPLFRACEMGHRDV 398          

HSP 4 Score: 57.7658 bits (138), Expect = 3.341e-8
Identity = 50/236 (21.19%), Postives = 94/236 (39.83%), Query Frame = 3
Query:  312 TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVE-----------------------------------GDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFAS------LSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYL 896
            + +H A ++G+ + +  L           ++  ++ + +++  +TPL +    + L   + L+K G  IN  D    T L ++ Q GN+     L+   A+  L D+E                                      ALHW+ +  HPE  ++L+ +  N    D+ G+ PLH+A+       +  + CI +    +++ LN  D   +TPL  A       + E L
Sbjct:   10 SQVHAAAVNGDKNTLQKL-----------ITESALRDSEDQFGRTPLMYCVLADRLDCAEVLLKAGAAINKTDHSQRTALHLAAQKGNVRFMKLLLSRHADWRLKDLEEMTPLHLASRHSSSKPLSLLLKHMAPGEVDTQDRNKQTALHWSAFYNHPEHVKLLIKHDSNIGIPDSEGKIPLHWAAHNKHPNATRTVRCILEAAPTESL-LNWQDYEGRTPLHFAVADGNEAVVEVL 233          

HSP 5 Score: 56.9954 bits (136), Expect = 5.132e-8
Identity = 44/173 (25.43%), Postives = 80/173 (46.24%), Query Frame = 3
Query:  408 PSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSC--QYGNISGALYLILNGANIFL----TDVEGDNALHWALYKGHPELSRMLVFY-GLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYR-VITEYLKY 902
            P  ++ ++   QT LHW+    +   ++ L+K   +I   D++   PL  +   ++ N +  +  IL  A         D EG   LH+A+  G+  +  +L  Y G +    D   +TPLH+A+L G+   +  L+E++   +   D+   TPL   A   Y   +  +LK+
Sbjct:  132 PGEVDTQDRNKQTALHWSAFYNHPEHVKLLIKHDSNIGIPDSEGKIPLHWAAHNKHPNATRTVRCILEAAPTESLLNWQDYEGRTPLHFAVADGNEAVVEVLTSYEGCSVTAYDNLFRTPLHWAALLGHAKIVHLLLERNKSGMIPSDSQGATPLHYGAQSNYADTVAVFLKH 304          
BLAST of Palmitoyltransferase vs. Ensembl Xenopus
Match: ENSXETT00000038057.1 (probable protein S-acyltransferase 23 [Source:NCBI gene;Acc:100498452])

HSP 1 Score: 317.775 bits (813), Expect = 3.347e-101
Identity = 178/504 (35.32%), Postives = 275/504 (54.56%), Query Frame = 3
Query:  204 GDLLEIIKSGKKELLFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVNKLSSFSRLKYKIIGAPNKNRFPMIFLILCAFLWGNPYYYYVIRPCSINYAQFTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIMLMNAVNFLAGYLLYIAYTFTNLFIYTVIFTSLLIALGLV-------LGFTINFFLCKQALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFN 1694
            G + + +K G  +     L+   + +L   +   G T +HWA L+G++ ++         D+   V  PS+     EL Q P+HWA    +++V+  L+K G  ++ KD K  TPLI + QYG  +   YLI  GA I L D EGD ALHWA +KGH ELS +L++ G N  Q D FGQTPLH A LSGN+  +  L E+DN++L   DNN  TPL LA GRK   I  +L+  I +     + F+   + + G P K + P++F     FLWG P Y++ I P S       +++F++   LMW  FL  +  DPGF+  D + Y+  + +    +++     +D KNP N+LCH+C  V+ +R+KHCRI +RCV   DH+CPY+ N +GKRNR +F  F++ M    F+  YL +          + ++  S+LI +G +       +   ++      A++N+T  E    KKY YL+++ G F NP++ G+  NL+ + +
Sbjct:   39 GQIFQAVKEGNIKKCQHILEAESAAVL-GCYDEKGHTPVHWAALTGSIQLMELFV-----DSKGPVDTPSLA----ELGQHPIHWAAVSGSIAVVDILLKAGVSVDVKDQKGCTPLITAAQYGQTALCCYLIGKGAKINLYDSEGDTALHWAAFKGHCELSHLLIYSGCNPRQTDNFGQTPLHLAVLSGNLPTVQLLCEQDNIDLEGEDNNRNTPLKLANGRKSWDIASFLQSTIIQSKKHHAKFNWSTW-LFGRPGKTKGPILFFFGNLFLWGYPTYFFKIVPVSYYALWELHMMFLLCNTLMWAFFLKASHMDPGFLPQDTEEYKYAVKQAINCNDW-----KDGKNPLNRLCHTCHLVKPLRSKHCRITNRCVSHFDHYCPYIYNDVGKRNRAFFVGFLVSMCMCCFIGVYLCWDC--------FYIVGNSILIGIGFIFLSVIGTISALMSVMCLYMAIVNITTNERMNVKKYTYLKDDRGHFRNPFDRGFYLNLLEFID 518          
BLAST of Palmitoyltransferase vs. Ensembl Xenopus
Match: ZDHHC17 (zinc finger DHHC-type containing 17 [Source:NCBI gene;Acc:100486328])

HSP 1 Score: 142.51 bits (358), Expect = 8.859e-36
Identity = 125/493 (25.35%), Postives = 232/493 (47.06%), Query Frame = 3
Query:  312 TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIIN-CKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQ-TPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLK-YQINKRVNKLSSFSRLKYKIIGAPNKNRFPMIFLILCAFLWGNPYYYYVIRPCSIN----YAQF-TNLLFIVFQC--LMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRN-VKIRDYKN-PFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWF--WLFIMLMNAVNFLAGYLLY------IAYTFTNLFIYTVIFTS-------LLIALGLVLGFTINFFLCKQ---ALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFNAR 1700
            TL+HWA ++  +D+V +            +S  +I++    +L+ TPLHWA    +LS++  L+K G D +  D +  + + ++ Q+G+ S   YLI  G ++ + D  G   L WA Y+   + +R+L+ + ++ N  D + + T LH+A L+GN + I+ L++     ++  +   ++PL LA  RK   +  +L+  +  K  +  S F +LK       +K R P + + L  F+       ++I+           QF +N+     +C  L+   F  T+     F +C +  Y + L    +   F+  V++ +  +   +  C +C   + +R+KHC IC+RC+ + DHHCP+VGNC+G  N  +F  +LF +L      + G + Y        YT    + Y     +       + +     L +     +C+    + L +T  E    ++Y + +       +P+NHG I N+I +F  R
Sbjct:   30 TLLHWAAINNRMDLVKFY-----------ISKGAIVDQLGGDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCIHLAAQFGHTSIVAYLIAKGQDVDMMDQNGMTPLMWAAYRT-VDPTRLLLTFNVSVNLGDKYHKNTALHWAVLAGNTTVISLLLDA-GANVDAQNIKGESPLDLAKQRKNVWMINHLQEARQAKGYDNPSFFKKLK------ADKVRTPFLVIWLVGFIADLDIDSWLIKGLMYGGVWAMVQFLSNMALFPMKCFDLLLRTFSYTSFLIICFPLCFKMWYSSNLIYFFVFYGFQTIVELAETGSLDLSIFCSTCLIRKPVRSKHCGICNRCIAKFDHHCPWVGNCVGSGNHRYFMGYLFFLLCMICWMIYGCISYWGIHCDTTYTKDGFWTYITQIATCSPWMFWMFLNSVFHLMWVAVLLMCQMYQISCLGITTNERMNARRYKHFKVTTTSIESPFNHGCIRNIIDFFEFR 503          
BLAST of Palmitoyltransferase vs. Ensembl Xenopus
Match: ZDHHC17 (zinc finger DHHC-type containing 17 [Source:NCBI gene;Acc:100486328])

HSP 1 Score: 138.658 bits (348), Expect = 3.289e-34
Identity = 125/530 (23.58%), Postives = 233/530 (43.96%), Query Frame = 3
Query:  312 TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIIN-CKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHP-ELSRMLVFYGLNCNQKDAFGQ-TPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLK-YQINKRVNKLSSFSRLKYK-------IIGAPNKNRFPMIFLI------------LCAFLWGN-------------PYYYYVIRPCSINYAQ-------------FTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWF--WLFIMLMNAVNFLAGYLLY------IAYTFTNLFIYTVIFTS-------LLIALGLVLGFTINFFLCKQ---ALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFNAR 1700
            TL+HWA ++  +D+V +            +S  +I++    +L+ TPLHWA    +LS++  L+K G D +  D +  + + ++ Q+G+ S   YLI  G ++ + D  G   L WA Y+ H  + +R+L+ + ++ N  D + + T LH+A L+GN + I+ L++     ++  +   ++PL LA  RK   +  +L+  +  K  +  S F +LK         ++G P    F +I+L+            +   ++G               +  +   P  I  A              F +L F+     +++ F  +   DPG +   E+  +  + E+    +             +  C +C   + +R+KHC IC+RC+ + DHHCP+VGNC+G  N  +F  +LF +L      + G + Y        YT    + Y     +       + +     L +     +C+    + L +T  E    ++Y + +       +P+NHG I N+I +F  R
Sbjct:   93 TLLHWAAINNRMDLVKFY-----------ISKGAIVDQLGGDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCIHLAAQFGHTSIVAYLIAKGQDVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVNLGDKYHKNTALHWAVLAGNTTVISLLLDA-GANVDAQNIKGESPLDLAKQRKNVWMINHLQEARQAKGYDNPSFFKKLKADKEFRQKVMLGTP----FLVIWLVGFIADLDIDSWLIKGLMYGGVWAMVQFLSKSFFDHSMHSALPLGIYLATKFWMYVTWFFCFLFIHLPFLANSFALFYNFGKSWKSDPGIIKATEEQKKKTIVELAETGSL----------DLSIFCSTCLIRKPVRSKHCGICNRCIAKFDHHCPWVGNCVGSGNHRYFMGYLFFLLCMICWMIYGCISYWGIHCDTTYTKDGFWTYITQIATCSPWMFWMFLNSVFHLMWVAVLLMCQMYQISCLGITTNERMNARRYKHFKVTTTSIESPFNHGCIRNIIDFFEFR 596          

HSP 2 Score: 62.003 bits (149), Expect = 2.055e-9
Identity = 46/146 (31.51%), Postives = 69/146 (47.26%), Query Frame = 3
Query:  495 LVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGD---NALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVN 923
            LV  G D+   D +NVT L  +     +    + I  GA   +  + GD     LHWA  +GH  +   L+ YG + +  D  G + +H A+  G+ S +A L+ K   ++++ D N  TPLM AA R + V    L    N  VN
Sbjct:   77 LVDAGYDVRQPDKENVTLLHWAAINNRMDLVKFYISKGA--IVDQLGGDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCIHLAAQFGHTSIVAYLIAKGQ-DVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVN 219          
BLAST of Palmitoyltransferase vs. Ensembl Xenopus
Match: ZDHHC17 (zinc finger DHHC-type containing 17 [Source:NCBI gene;Acc:100486328])

HSP 1 Score: 138.272 bits (347), Expect = 4.685e-34
Identity = 125/530 (23.58%), Postives = 233/530 (43.96%), Query Frame = 3
Query:  312 TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIIN-CKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHP-ELSRMLVFYGLNCNQKDAFGQ-TPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLK-YQINKRVNKLSSFSRLKYK-------IIGAPNKNRFPMIFLI------------LCAFLWGN-------------PYYYYVIRPCSINYAQ-------------FTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWF--WLFIMLMNAVNFLAGYLLY------IAYTFTNLFIYTVIFTS-------LLIALGLVLGFTINFFLCKQ---ALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFNAR 1700
            TL+HWA ++  +D+V +            +S  +I++    +L+ TPLHWA    +LS++  L+K G D +  D +  + + ++ Q+G+ S   YLI  G ++ + D  G   L WA Y+ H  + +R+L+ + ++ N  D + + T LH+A L+GN + I+ L++     ++  +   ++PL LA  RK   +  +L+  +  K  +  S F +LK         ++G P    F +I+L+            +   ++G               +  +   P  I  A              F +L F+     +++ F  +   DPG +   E+  +  + E+    +             +  C +C   + +R+KHC IC+RC+ + DHHCP+VGNC+G  N  +F  +LF +L      + G + Y        YT    + Y     +       + +     L +     +C+    + L +T  E    ++Y + +       +P+NHG I N+I +F  R
Sbjct:   68 TLLHWAAINNRMDLVKFY-----------ISKGAIVDQLGGDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCIHLAAQFGHTSIVAYLIAKGQDVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVNLGDKYHKNTALHWAVLAGNTTVISLLLDA-GANVDAQNIKGESPLDLAKQRKNVWMINHLQEARQAKGYDNPSFFKKLKADKEFRQKVMLGTP----FLVIWLVGFIADLDIDSWLIKGLMYGGVWAMVQFLSKSFFDHSMHSALPLGIYLATKFWMYVTWFFCFLFIHLPFLANSFALFYNFGKSWKSDPGIIKATEEQKKKTIVELAETGSL----------DLSIFCSTCLIRKPVRSKHCGICNRCIAKFDHHCPWVGNCVGSGNHRYFMGYLFFLLCMICWMIYGCISYWGIHCDTTYTKDGFWTYITQIATCSPWMFWMFLNSVFHLMWVAVLLMCQMYQISCLGITTNERMNARRYKHFKVTTTSIESPFNHGCIRNIIDFFEFR 571          

HSP 2 Score: 62.003 bits (149), Expect = 1.918e-9
Identity = 46/146 (31.51%), Postives = 69/146 (47.26%), Query Frame = 3
Query:  495 LVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGD---NALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVN 923
            LV  G D+   D +NVT L  +     +    + I  GA   +  + GD     LHWA  +GH  +   L+ YG + +  D  G + +H A+  G+ S +A L+ K   ++++ D N  TPLM AA R + V    L    N  VN
Sbjct:   52 LVDAGYDVRQPDKENVTLLHWAAINNRMDLVKFYISKGA--IVDQLGGDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCIHLAAQFGHTSIVAYLIAKGQ-DVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVN 194          
BLAST of Palmitoyltransferase vs. Ensembl Xenopus
Match: ZDHHC17 (zinc finger DHHC-type containing 17 [Source:NCBI gene;Acc:100486328])

HSP 1 Score: 137.887 bits (346), Expect = 5.748e-34
Identity = 125/530 (23.58%), Postives = 233/530 (43.96%), Query Frame = 3
Query:  312 TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIIN-CKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHP-ELSRMLVFYGLNCNQKDAFGQ-TPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLK-YQINKRVNKLSSFSRLKYK-------IIGAPNKNRFPMIFLI------------LCAFLWGN-------------PYYYYVIRPCSINYAQ-------------FTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWF--WLFIMLMNAVNFLAGYLLY------IAYTFTNLFIYTVIFTS-------LLIALGLVLGFTINFFLCKQ---ALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFNAR 1700
            TL+HWA ++  +D+V +            +S  +I++    +L+ TPLHWA    +LS++  L+K G D +  D +  + + ++ Q+G+ S   YLI  G ++ + D  G   L WA Y+ H  + +R+L+ + ++ N  D + + T LH+A L+GN + I+ L++     ++  +   ++PL LA  RK   +  +L+  +  K  +  S F +LK         ++G P    F +I+L+            +   ++G               +  +   P  I  A              F +L F+     +++ F  +   DPG +   E+  +  + E+    +             +  C +C   + +R+KHC IC+RC+ + DHHCP+VGNC+G  N  +F  +LF +L      + G + Y        YT    + Y     +       + +     L +     +C+    + L +T  E    ++Y + +       +P+NHG I N+I +F  R
Sbjct:   83 TLLHWAAINNRMDLVKFY-----------ISKGAIVDQLGGDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCIHLAAQFGHTSIVAYLIAKGQDVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVNLGDKYHKNTALHWAVLAGNTTVISLLLDA-GANVDAQNIKGESPLDLAKQRKNVWMINHLQEARQAKGYDNPSFFKKLKADKEFRQKVMLGTP----FLVIWLVGFIADLDIDSWLIKGLMYGGVWAMVQFLSKSFFDHSMHSALPLGIYLATKFWMYVTWFFCFLFIHLPFLANSFALFYNFGKSWKSDPGIIKATEEQKKKTIVELAETGSL----------DLSIFCSTCLIRKPVRSKHCGICNRCIAKFDHHCPWVGNCVGSGNHRYFMGYLFFLLCMICWMIYGCISYWGIHCDTTYTKDGFWTYITQIATCSPWMFWMFLNSVFHLMWVAVLLMCQMYQISCLGITTNERMNARRYKHFKVTTTSIESPFNHGCIRNIIDFFEFR 586          

HSP 2 Score: 62.003 bits (149), Expect = 1.982e-9
Identity = 46/146 (31.51%), Postives = 69/146 (47.26%), Query Frame = 3
Query:  495 LVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGD---NALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVN 923
            LV  G D+   D +NVT L  +     +    + I  GA   +  + GD     LHWA  +GH  +   L+ YG + +  D  G + +H A+  G+ S +A L+ K   ++++ D N  TPLM AA R + V    L    N  VN
Sbjct:   67 LVDAGYDVRQPDKENVTLLHWAAINNRMDLVKFYISKGA--IVDQLGGDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCIHLAAQFGHTSIVAYLIAKGQ-DVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVN 209          
BLAST of Palmitoyltransferase vs. Ensembl Mouse
Match: Zdhhc17 (zinc finger, DHHC domain containing 17 [Source:MGI Symbol;Acc:MGI:2445110])

HSP 1 Score: 137.117 bits (344), Expect = 9.432e-34
Identity = 131/550 (23.82%), Postives = 235/550 (42.73%), Query Frame = 3
Query:  276 EILYDVFPSTGD--TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIIN-CKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHP-ELSRMLVFYGLNCNQKDAFGQ-TPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLK-------YQINKRVNKLSSFSRLKYKI-IGAPNKNRFPMIFLI----------------LCAFLWGNPYY---------YYVIRPCSINYAQ-------------------FTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWF--WLFIMLMNAVNFLAGYLLY------IAYTFTNLFIY-TVIFTSLLIALGLVLGFTINFF---------LCKQALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFNAR 1700
            E  YDV     +  TL+HWA ++  +D+V Y            +S  +I++    +L+ TPLHWA    +LS++  L+K G D +  D +  + + ++ Q+G+ S   YLI  G ++ + D  G   L WA Y+ H  + +R+L+ + ++ N  D + + T LH+A L+GN + I+ L+E     ++  +   ++ L LA  RK   +  +L+       Y     + KL +    + K+ +G P    F +I+L+                +   +W    +          +   P  I  A                    F +L F+     +++ F  +   DPG +   E+  +  + E+    +             +  C +C   + +R+KHC +C+RC+ + DHHCP+VGNC+G  N  +F  +LF +L      + G + Y        YT    + Y T I T       + L    +F          L +   L +T  E    ++Y + +       +P+NHG + N+I +F  R
Sbjct:   78 EAGYDVRQPDKENVTLLHWAAINNRIDLVKYY-----------ISKGAIVDQLGGDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCIHLAAQFGHTSIVAYLIAKGQDVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVNLGDKYHKNTALHWAVLAGNTTVISLLLEAGG-NVDAQNVKGESALDLAKQRKNVWMINHLQEARQAKGYDNPSFLRKLKADKEFRQKVMLGTP----FLVIWLVGFIADLDIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPLGIYLATKFWMYVTWFFWFWNDLNFLFIHLPFLANSVALFYNFGKSWKSDPGIIKATEEQKKKTIVELAETGSL----------DLSIFCSTCLIRKPVRSKHCGVCNRCIAKFDHHCPWVGNCVGAGNHRYFMGYLFFLLFMICWMIYGCVSYWGLHCETTYTKDGFWTYITQIATCSPWMFWMFLNSVFHFLWVAVLLMCQLYQITCLGITTNERMNARRYKHFKVTTTSIESPFNHGCVRNIIDFFEFR 601          
BLAST of Palmitoyltransferase vs. Ensembl Mouse
Match: Zdhhc13 (zinc finger, DHHC domain containing 13 [Source:MGI Symbol;Acc:MGI:1919227])

HSP 1 Score: 119.398 bits (298), Expect = 7.549e-28
Identity = 117/489 (23.93%), Postives = 203/489 (41.51%), Query Frame = 3
Query:  129 NLELEDNKIFIPPSEKCIKSESNTLGDLLEIIKSGKKELLFEKLKNSGSEILYDVFPSTGD--TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIIN-CKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKG-HPELSRMLVFYGLNCNQKDAFGQ-TPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVNKLSSFSRLKYK------------------------------------------------IIGAPNKNRFPMIFLILCAFLWGNPYYYYVIRPCSINYAQFTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYE---TVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIMLMNAV 1427
            N EL   K  +P     I+  SN   D+++  + G    +FE+ K    E  YDV     +  +L+HWA ++  L++V +            +S  ++I+    +L+ TPLHWA    +L ++  L++ G D    D +  + + ++  + ++    YLI  G ++ +TDV G   L  + YK   PE +  L+ +  + +  D   Q TPLH+A  +GN+S +  L+E  +  L++ +   +TPL +A   K ++I+  L+ +   R NK     R  +K                                                ++G  N    P +FL L +  W    ++ +  P +     +   +F +   L  + F  T   DPGF    E+  +     L E   LD             F   C SC   + +R+ HC +C+ CV   D HC + G CIG  N   +  F++ ++ V
Sbjct:   32 NKELAKAKEILP----LIEDSSNC--DIVKATQYG----IFERCKEL-VEAGYDVRQPDRENVSLLHWAAINNRLELVKFY-----------ISKGAVIDQLGGDLNSTPLHWAIRQGHLPMVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDVNGQTPLMLSAYKVIGPEPTGFLLKFNPSLSVVDKTHQNTPLHWAVAAGNVSAVDKLLEAGS-SLDIRNAKGETPLDMALQSKNQLISHMLRTEAKMRANKQFRLWRWLHKCELFLLLILSMITLWAVGYILDFNSDSWLLKGCLLVALFFLTSLFPRFLVGYKNLVYLPTVFL-LSSIFWIFMTWFILFFPDTAGSPLYFAFIFSIMAFL--YFFYKTWATDPGFTKASEEERKVNIVTLAETGSLD-------------FRTFCTSCLIRKPLRSLHCHVCNSCVARFDQHCFWTGRCIGFGNHHHYIFFLLSLSMV 481          
BLAST of Palmitoyltransferase vs. Ensembl Mouse
Match: Ankrd23 (ankyrin repeat domain 23 [Source:MGI Symbol;Acc:MGI:1925571])

HSP 1 Score: 91.2781 bits (225), Expect = 1.061e-20
Identity = 55/175 (31.43%), Postives = 92/175 (52.57%), Query Frame = 3
Query:  237 KELLFEK-LKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFA 758
            +E L +K L + G    +D    T    +HWACL G+  +V+ L           ++  + I  ++ L +TP+ WAC   +L +++ L+ +G  +NA+D    TPL ++ + G+     +LI  GA+I   D EGD ALH A+  GH + +++L+ YG     K+   QTP+  A
Sbjct:   10 QEALIDKYLADGGDPNAHDKLHRTA---LHWACLKGHRQLVNKL-----------LAAGAAIEVRDLLDRTPVFWACRGGHLDILKRLLNQGAQVNAQDKIWSTPLHVAVRMGHSDCLEHLIECGAHINAQDKEGDTALHEAVRYGHHKATKLLLLYGAKLGVKNVASQTPVQLA 170          

HSP 2 Score: 53.9138 bits (128), Expect = 6.687e-8
Identity = 39/139 (28.06%), Postives = 61/139 (43.88%), Query Frame = 3
Query:  480 SVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYL 896
            ++I   + +G D NA D  + T L  +C  G+      L+  GA I + D+     + WA   GH ++ + L+  G   N +D    TPLH A   G+  C+  L+E     +N  D    T L  A    +   T+ L
Sbjct:   12 ALIDKYLADGGDPNAHDKLHRTALHWACLKGHRQLVNKLLAAGAAIEVRDLLDRTPVFWACRGGHLDILKRLLNQGAQVNAQDKIWSTPLHVAVRMGHSDCLEHLIEC-GAHINAQDKEGDTALHEAVRYGHHKATKLL 149          
BLAST of Palmitoyltransferase vs. Ensembl Mouse
Match: Ankrd44 (ankyrin repeat domain 44 [Source:MGI Symbol;Acc:MGI:3045243])

HSP 1 Score: 97.4413 bits (241), Expect = 1.467e-20
Identity = 64/202 (31.68%), Postives = 101/202 (50.00%), Query Frame = 3
Query:  288 DVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAA--GRKYRVIT 887
            +V    G T +H A L+G++++V+ L     N           IN  ++  +  LHWA  + +L V+  L+  G ++  KD K  TPL  +   G IS   +L+  G  I   +V G+ ALH A Y G   +   L+ YG N NQ +  G TPLHFA+ S + +   +L+  +  ++N+   + K+PL + A  GR  R  T
Sbjct:  134 NVSDRGGRTALHHAALNGHMEMVNLLLAKGAN-----------INAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQISVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNSGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQT 324          

HSP 2 Score: 76.2554 bits (186), Expect = 6.057e-14
Identity = 79/289 (27.34%), Postives = 122/289 (42.21%), Query Frame = 3
Query:  210 LLEIIKSGKKE---LLFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKD------------------TKNVTPLIMSCQYGNISG--ALY-------------LILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADL----VEKDNVELNVHDNNNKTPLMLAA-GRKYRVITEYLKYQINKRVNKLSSFSRLKY 953
            L++ I SG  E   +L  K ++       +   S   T +H A   G+ +I+  L           +   + +N K+ +  TPLH A    +   +Q L+K   D+NA+D                   + + PL+ S    +  G  AL+             L+  GANI   D +   ALHWA Y GH ++  +L+ +G     KD  G TPLH A+ +G IS +  L    VE D  E+NV+ N   T L +A    +  V+ E + Y  N      S F+ L +
Sbjct:   12 LVQAIFSGDPEEIRMLIHKTED------VNALDSEKRTPLHVAAFLGDAEIIELL-----------ILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHMEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQISVVKHLLNLGVEID--EINVYGN---TALHIACYNGQDAVVNELIDYGANVNQPNNSGFTPLHF 278          

HSP 3 Score: 73.559 bits (179), Expect = 4.422e-13
Identity = 78/304 (25.66%), Postives = 118/304 (38.82%), Query Frame = 3
Query:  246 LFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSV-IQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYG-----------------------------LNCNQK----------------------DAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGR-KYRVITEYLKYQINKRVNKLSSFSRLKYKIIGAPNKNRFPMIF 998
            + + L N G EI  D     G+T +H AC +G   +V+ L      D  +NV+ P      N    TPLH+A    + ++ ++ LV  G D+N +     +PL M+  +G  + +  LI NG  I   D +G+  LH A   GH  L   L+  G                             L+  QK                      D FG+T LH A+  GN+ CI  L++    + +  D   +TPL  AA    +  I   +    N  VN+   + R       A + +R  MI 
Sbjct:  221 VVKHLLNLGVEI--DEINVYGNTALHIACYNGQDAVVNELI-----DYGANVNQP------NNSGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARHGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGQKYSIVSLFSNEHVLSAGFEIDTPDTFGRTCLHAAAAGGNVECI-KLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIKALVTTGAN--VNETDDWGRTALHYAAASDMDRNKMIL 508          

HSP 4 Score: 70.4774 bits (171), Expect = 3.634e-12
Identity = 58/194 (29.90%), Postives = 92/194 (47.42%), Query Frame = 3
Query:  288 DVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCD----INAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELN--VHDNNNKTPL 851
            D+    G T ++ A   G+ + V  L        N   S   I    N   +TPLH A  I   ++   L+ E  D    ++ KD K  TPL+++  YG+I     L+   AN+   D+ G  ALH  +  GH E  +ML+    +   KD+ G+TPLH+A+  G+ + + +L++    E +  + DN   TPL
Sbjct:  612 DIRDEKGRTALYLAAFKGHTECVEAL-------VNQGAS---IFVKDNVTKRTPLH-ASVINGHTLCLRLLLETADNPEVVDVKDAKGQTPLMLAVAYGHIDAVSLLLEKEANVDAVDIVGCTALHRGIMTGHEECVQMLLEQEASILCKDSRGRTPLHYAAARGHATWLNELLQIALSEEDCCLKDNQGYTPL 794          

HSP 5 Score: 70.4774 bits (171), Expect = 3.996e-12
Identity = 60/209 (28.71%), Postives = 101/209 (48.33%), Query Frame = 3
Query:  306 GDTLMHWACLSGNLDIVSYL---KVIYK--------------NDTNSNVSW------PSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLT--DVEGDNALHWALYKGHPELSRMLVFYGLN----CNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKT 845
            G T +HWAC +GN + +  L   K   K              N   S  S       PSI++C+++  +T LH A   ++   +Q L++    +NA D    T L+M+ + G  +GA+ +++N A   LT  D + +  LH A+ KGH E   +L+   +      N K++  QTPLH A+ +G    + +L+ K    L V +N +++
Sbjct:  790 GYTPLHWACYNGNENCIEVLLEQKCFRKFIGNPFTPLHCAIINGHESCASLLLGAIDPSIVSCRDDKGRTTLHAAAFGDHAECLQLLLRHDAQVNAVDNSGKTALMMAAENGQ-AGAVDILVNSAQADLTVKDKDLNTPLHLAISKGH-EKCALLILDKIQDESLINAKNSALQTPLHIAARNGLKVVVEELLAKGACVLAVDENASRS 996          

HSP 6 Score: 56.9954 bits (136), Expect = 6.780e-8
Identity = 58/221 (26.24%), Postives = 99/221 (44.80%), Query Frame = 3
Query:  222 IKSGKKELLFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLI--LNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYR 878
            I +G +E +   L+   S +  D   S G T +H+A   G+   ++ L  I  ++ +  +        K+    TPLHWAC   N + I+ L+++ C          TPL  +   G+ S A  L+  ++ + +   D +G   LH A +  H E  ++L+ +    N  D  G+T L  A+ +G    +  LV     +L V D +  TPL LA  + + 
Sbjct:  729 IMTGHEECVQMLLEQEASILCKD---SRGRTPLHYAAARGHATWLNELLQIALSEEDCCL--------KDNQGYTPLHWACYNGNENCIEVLLEQKC-FRKFIGNPFTPLHCAIINGHESCASLLLGAIDPSIVSCRDDKGRTTLHAAAFGDHAECLQLLLRHDAQVNAVDNSGKTALMMAAENGQAGAVDILVNSAQADLTVKDKDLNTPLHLAISKGHE 937          

HSP 7 Score: 54.6842 bits (130), Expect = 2.866e-7
Identity = 42/141 (29.79%), Postives = 69/141 (48.94%), Query Frame = 3
Query:  441 QTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAA 863
            Q PL  A    +   I+ L+ +  D+NA D++  TPL ++   G+      LIL+GA +   D      LH A+     E  ++L+ +  + N +D   QTPLH A+ +  + C A+++      +NV D   +T L  AA
Sbjct:    9 QPPLVQAIFSGDPEEIRMLIHKTEDVNALDSEKRTPLHVAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKC-AEVIIPLLSSVNVSDRGGRTALHHAA 148          
BLAST of Palmitoyltransferase vs. Ensembl Mouse
Match: Ankrd44 (ankyrin repeat domain 44 [Source:MGI Symbol;Acc:MGI:3045243])

HSP 1 Score: 97.4413 bits (241), Expect = 1.517e-20
Identity = 64/202 (31.68%), Postives = 101/202 (50.00%), Query Frame = 3
Query:  288 DVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAA--GRKYRVIT 887
            +V    G T +H A L+G++++V+ L     N           IN  ++  +  LHWA  + +L V+  L+  G ++  KD K  TPL  +   G IS   +L+  G  I   +V G+ ALH A Y G   +   L+ YG N NQ +  G TPLHFA+ S + +   +L+  +  ++N+   + K+PL + A  GR  R  T
Sbjct:  134 NVSDRGGRTALHHAALNGHMEMVNLLLAKGAN-----------INAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQISVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNSGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQT 324          

HSP 2 Score: 80.1073 bits (196), Expect = 3.895e-15
Identity = 75/286 (26.22%), Postives = 116/286 (40.56%), Query Frame = 3
Query:  246 LFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSV-IQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGH---------------------------------PELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGR-KYRVITEYLKYQINKRVNKLSSFSRLKYKIIGAPNKNRFPMIF 998
            + + L N G EI  D     G+T +H AC +G   +V+ L      D  +NV+ P      N    TPLH+A    + ++ ++ LV  G D+N +     +PL M+  +G  + +  LI NG  I   D +G+  LH A   GH                                  +  R L+  G   +  D FG+T LH A+  GN+ CI  L++    + +  D   +TPL  AA    +  I   +    N  VN+   + R       A + +R  MI 
Sbjct:  221 VVKHLLNLGVEI--DEINVYGNTALHIACYNGQDAVVNELI-----DYGANVNQP------NNSGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARHGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTPDTFGRTCLHAAAAGGNVECI-KLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIKALVTTGAN--VNETDDWGRTALHYAAASDMDRNKMIL 490          

HSP 3 Score: 76.2554 bits (186), Expect = 6.063e-14
Identity = 79/289 (27.34%), Postives = 122/289 (42.21%), Query Frame = 3
Query:  210 LLEIIKSGKKE---LLFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKD------------------TKNVTPLIMSCQYGNISG--ALY-------------LILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADL----VEKDNVELNVHDNNNKTPLMLAA-GRKYRVITEYLKYQINKRVNKLSSFSRLKY 953
            L++ I SG  E   +L  K ++       +   S   T +H A   G+ +I+  L           +   + +N K+ +  TPLH A    +   +Q L+K   D+NA+D                   + + PL+ S    +  G  AL+             L+  GANI   D +   ALHWA Y GH ++  +L+ +G     KD  G TPLH A+ +G IS +  L    VE D  E+NV+ N   T L +A    +  V+ E + Y  N      S F+ L +
Sbjct:   12 LVQAIFSGDPEEIRMLIHKTED------VNALDSEKRTPLHVAAFLGDAEIIELL-----------ILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHMEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQISVVKHLLNLGVEID--EINVYGN---TALHIACYNGQDAVVNELIDYGANVNQPNNSGFTPLHF 278          

HSP 4 Score: 70.4774 bits (171), Expect = 3.517e-12
Identity = 58/194 (29.90%), Postives = 92/194 (47.42%), Query Frame = 3
Query:  288 DVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCD----INAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELN--VHDNNNKTPL 851
            D+    G T ++ A   G+ + V  L        N   S   I    N   +TPLH A  I   ++   L+ E  D    ++ KD K  TPL+++  YG+I     L+   AN+   D+ G  ALH  +  GH E  +ML+    +   KD+ G+TPLH+A+  G+ + + +L++    E +  + DN   TPL
Sbjct:  594 DIRDEKGRTALYLAAFKGHTECVEAL-------VNQGAS---IFVKDNVTKRTPLH-ASVINGHTLCLRLLLETADNPEVVDVKDAKGQTPLMLAVAYGHIDAVSLLLEKEANVDAVDIVGCTALHRGIMTGHEECVQMLLEQEASILCKDSRGRTPLHYAAARGHATWLNELLQIALSEEDCCLKDNQGYTPL 776          

HSP 5 Score: 70.4774 bits (171), Expect = 4.073e-12
Identity = 60/209 (28.71%), Postives = 101/209 (48.33%), Query Frame = 3
Query:  306 GDTLMHWACLSGNLDIVSYL---KVIYK--------------NDTNSNVSW------PSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLT--DVEGDNALHWALYKGHPELSRMLVFYGLN----CNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKT 845
            G T +HWAC +GN + +  L   K   K              N   S  S       PSI++C+++  +T LH A   ++   +Q L++    +NA D    T L+M+ + G  +GA+ +++N A   LT  D + +  LH A+ KGH E   +L+   +      N K++  QTPLH A+ +G    + +L+ K    L V +N +++
Sbjct:  772 GYTPLHWACYNGNENCIEVLLEQKCFRKFIGNPFTPLHCAIINGHESCASLLLGAIDPSIVSCRDDKGRTTLHAAAFGDHAECLQLLLRHDAQVNAVDNSGKTALMMAAENGQ-AGAVDILVNSAQADLTVKDKDLNTPLHLAISKGH-EKCALLILDKIQDESLINAKNSALQTPLHIAARNGLKVVVEELLAKGACVLAVDENASRS 978          

HSP 6 Score: 56.9954 bits (136), Expect = 6.746e-8
Identity = 58/221 (26.24%), Postives = 99/221 (44.80%), Query Frame = 3
Query:  222 IKSGKKELLFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLI--LNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYR 878
            I +G +E +   L+   S +  D   S G T +H+A   G+   ++ L  I  ++ +  +        K+    TPLHWAC   N + I+ L+++ C          TPL  +   G+ S A  L+  ++ + +   D +G   LH A +  H E  ++L+ +    N  D  G+T L  A+ +G    +  LV     +L V D +  TPL LA  + + 
Sbjct:  711 IMTGHEECVQMLLEQEASILCKD---SRGRTPLHYAAARGHATWLNELLQIALSEEDCCL--------KDNQGYTPLHWACYNGNENCIEVLLEQKC-FRKFIGNPFTPLHCAIINGHESCASLLLGAIDPSIVSCRDDKGRTTLHAAAFGDHAECLQLLLRHDAQVNAVDNSGKTALMMAAENGQAGAVDILVNSAQADLTVKDKDLNTPLHLAISKGHE 919          

HSP 7 Score: 54.6842 bits (130), Expect = 2.952e-7
Identity = 42/141 (29.79%), Postives = 69/141 (48.94%), Query Frame = 3
Query:  441 QTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAA 863
            Q PL  A    +   I+ L+ +  D+NA D++  TPL ++   G+      LIL+GA +   D      LH A+     E  ++L+ +  + N +D   QTPLH A+ +  + C A+++      +NV D   +T L  AA
Sbjct:    9 QPPLVQAIFSGDPEEIRMLIHKTEDVNALDSEKRTPLHVAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKC-AEVIIPLLSSVNVSDRGGRTALHHAA 148          
BLAST of Palmitoyltransferase vs. UniProt/SwissProt
Match: sp|Q3EC11|ZDHC2_ARATH (Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana OX=3702 GN=PAT23 PE=2 SV=2)

HSP 1 Score: 204.142 bits (518), Expect = 3.231e-57
Identity = 143/528 (27.08%), Postives = 251/528 (47.54%), Query Frame = 3
Query:  186 SESNTLGDLLEIIKSGKKELLFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILN-GANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDN-VELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVNKLSSFSRLKYKIIGAPNKNRF-PMIFLILCAFLWGNPYYYYVIRPCSINYAQFTNLLFIVFQCLMWFAFLMT------------ALKDPGFM-VCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIMLMNAVNFLAG-------------------YLLYIAYTFTNLFIYTVIFTSLLIALGLVLGFTINFFLCKQALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHG 1664
            +ES T+ D+      G    L   ++++GS +   +    G   + WA L+ +L +  Y+ + +  D NS           + + QTPLHWA    ++ V   L++ G  I A D      + ++ QYG  +   ++I++  A+    D+EG + LHWA Y G  E  R+L+F     N++D  G TPLH+A +  N+     LV      EL + DN   TPL LA+ + +R +  +L   +  R N     S +     G   +  + PM+F ++   +        V+   SI  A  +NL  I     +W  F ++            + KDPG++    E   +   N+  +  NF+N     +K  ++QLC +CK +R +R+KHC  C RCV++ DHHCP++ NC+GK+N+ +F +F+++    +F+ G                   ++ +I     +  ++ + F  L+    + L  + ++ + +    N+T  E    K+++YL+  DG+F+NPYNHG
Sbjct:   20 TESPTITDVFSASAYGDLHQLKHFVEHNGSSV--SLPDDNGFYALQWAALNNSLHVAQYI-IQHGGDVNS----------ADNIQQTPLHWAAVKGSIDVADLLLQHGARIEAVDVNGFRAVHVASQYGQTAFVNHIIVDYAADYNALDIEGRSPLHWAAYNGFTETVRLLLFRDACQNRQDNTGCTPLHWAVIKENVEACTLLVHAGTKEELILKDNTGSTPLKLASDKGHRQLALFLSKAMRTRKN-----SFVDKIFCGKLGETSYAPMLFSLIVILM--------VLFITSIVSA--SNLPKITAMVGLWACFGLSCGVYALITFYRVSRKDPGYVKRTGEANSQHTANDPLIDINFKNPS---WKGNWSQLCPTCKIIRPVRSKHCPTCKRCVEQFDHHCPWISNCVGKKNKRYFLVFVIMGALTSFVGGTTAVQRLWRGIPQVHHGESWIKHIVIEHPDAAVF-LFFDLLIFIATMTLTISQSYMIAR----NITTNELWNAKRFSYLRGPDGRFYNPYNHG 511          
BLAST of Palmitoyltransferase vs. UniProt/SwissProt
Match: sp|Q52T38|ZDH22_ARATH (Protein S-acyltransferase 24 OS=Arabidopsis thaliana OX=3702 GN=PAT24 PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 6.485e-44
Identity = 140/544 (25.74%), Postives = 235/544 (43.20%), Query Frame = 3
Query:  168 SEKCIKSESNTLGDLLEIIKSGKKELLFEKLKNSGSEILYDVFPSTGDTL----MHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILN-GANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVE-LNVHDNNNKTPLMLAAGRKYRVITEYL---KYQINKRVNKLSSFSRLKYKIIGAPNKNRFPMIFLILCAFLWGNPYYYYVIRPCSINYAQFTNLLFIVFQCLMWFAFLMT----------ALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNP------FNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVW-------FWLFIMLM-------------NAVNFLAGYLLYIAYTFTNLFIYTVIFTSLLIALGLVLGFTINFFLCKQALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHG 1664
            S K I+ ES    D+      G  E L   ++  GS +      S  D L    + W+ L+  + +  YL + +  D          +N  +   QT LHW+     + V + L++EG  ++A D        ++ QYG  +   +++    A+  + D +G + LHWA YKG  +  R+L+F      ++D  G TPLH+A++ GN+     LV+    E L + D    TP  LAA + +R ++ +L   +  + KR +  S   RL                 L L   LW       ++   S+  A     L      L W  F++           + KDPG++  +    +T+ ++  LL      KI +  NP      + QLC +CK +R +RAKHC  CDRCV++ DHHCP+V NC+GK+N+ W         +  ML+             +A +    ++ ++A        + ++   L  ++ +     +      Q   N+T  E     +Y+YL+   G+F NPY+ G
Sbjct:   22 SSKGIEEES-LKNDVYTAAAYGDLEKLHRLVECEGSSV------SEPDALGYYALQWSALNNRVAVAQYL-IEHGGD----------VNATDHTGQTALHWSAVRGAIQVAELLLQEGARVDATDMYGYQATHVAAQYGQTAFLCHVVSKWNADPDVPDNDGRSPLHWAAYKGFADSIRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKEDLMITDKTGLTPAQLAAEKNHRQVSFFLGNARSLLEKRCDGSSPLGRLSK---------------LGLAPVLWIMILLLLLVYTNSVVLASNLPKLTTGIGALAWLGFILATAGLFLFYRCSRKDPGYIRMNIHDPQTMKDDEPLL------KI-ELNNPALLAGNWTQLCATCKIIRPLRAKHCSTCDRCVEQFDHHCPWVSNCVGKKNK-WEFFLFLLLEVLAMLITGGVTLARVLSDPSAPSSFGAWMSHVASNHVGALSFLLVEFCLFFSVAV-----LTVIQASQISRNITTNEMANALRYSYLRGPGGRFRNPYDLG 519          
BLAST of Palmitoyltransferase vs. UniProt/SwissProt
Match: sp|Q8T2Q0|ZDHC6_DICDI (Putative ZDHHC-type palmitoyltransferase 6 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0275149 PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 9.427e-36
Identity = 115/442 (26.02%), Postives = 192/442 (43.44%), Query Frame = 3
Query:  213 LEIIKSGKKELLFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLI-LNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVNKLSSFSRLKYKIIGAPNKNRFPMIFLILCAFLWGNPYYYYVIRPCSINYA--------------------------------------------QFTNLL------FIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRN 1385
            LE I+     L   ++ NSG +         G+T +HWAC     DIV YL  +  +        P+I N  +EL QTP  WAC   +L ++++++  G D + +D +    LI + QY  IS   YL+   G N+   D     +LHWA Y+GH +L   LV  G + N  D+ G++PLH+A+  GN   I  L +  +  +   D+NN++P  + + + +  +  ++K           +F+   ++ +G    N F +IF IL    +G  +Y++ + P  I +                                              F N++        V+    + AF +    DPG +     + ++         +F N   ++ + P  ++C +C   + IRAKHCR C RCV   DHHC ++ NC+G  N
Sbjct:   36 LEKIRLQNPSLDLGEIINSGDDC--------GNTALHWACYKKWYDIVKYLLSMGAD--------PNIANT-DEL-QTPFQWACIGGDLHIVKYVLNNGGDPHLQDKRGYNSLIHATQYNEISVVRYLLDKGGVNVDSPDFLQKTSLHWAAYQGHTQLLLFLVNKGADINALDSLGRSPLHWAAFKGNSDPIKALCDFGSKTME-KDSNNQSPSDICSSQNHNYLAHFIK-----------TFNYHPFRKVGPLLYNIFWIIFAILLQLYFGFIFYHFTLIPALILFGASLTCCKLFIEPITLSNSPNPLLPTWMITSFTVSFVYYVRYVVPAFPNIILTHTITLFVYSSYYYCAFKL-FFSDPGTVSSSTTSQDS--------KDFINAVEKELEIP--EVCSTCLINKPIRAKHCRTCKRCVARFDHHCAWINNCVGVNN 436          
BLAST of Palmitoyltransferase vs. UniProt/SwissProt
Match: sp|Q9VUW9|HIP14_DROME (Palmitoyltransferase Hip14 OS=Drosophila melanogaster OX=7227 GN=Hip14 PE=1 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 7.729e-34
Identity = 135/529 (25.52%), Postives = 207/529 (39.13%), Query Frame = 3
Query:  312 TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHP-ELSRMLVFYGLNCNQKD-AFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLML----------AAGRKYRVITEYLKYQINKR-VNKLSSFSRLK--------------------------------------YKIIGAPNKNRFPMIFLILCAFLWGNPYYYYVIRPCSINYAQFT-NLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLF---IMLMNAVNFLAGYLLYI---AYTFTNLFIYTVIFTSLLIALGLVLG-------FTINFFLCKQ---ALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFN 1694
            TL+HWA ++   DI+ Y   + K  T   V          EL+ TPLHWA    +L  +  L+  G D   +D +  + + ++ Q+ + +   Y I  G +  L D  G  AL WA +K    +  R+L+  G N    D   G T LH+A L+ N + I+ LV K    L+V +   +TPL +           A    RV    L  Q  +  ++KL    RL+                                      +  IG    +   M  L L  +L    ++Y        +   FT  + F++   L+W  FL +   DPG +     T E     I  L     +            C  C   R IR+KHC +CDRCV   DHHCP+VGNCIG +N  +F  F   +++M A     G   Y+      F +         +    +G V+G       + I   +C+      L +T  E     +Y + Q + G   +P+  G I NL+ +  
Sbjct:   80 TLLHWAAINNRRDIIRYF--LEKGATVDAVG--------GELNATPLHWATRQGHLGAVVLLMAAGADPRIRDAEGCSCIHIAAQFAHTALVAYFIAKGVDPDLQDRGGMTALMWAAWKVCALDPVRLLLTLGANPAMVDYTHGNTALHWAILARNATAISTLVLKSKASLDVPNLRGETPLSMLESQTGAIWIGAKVMDRVKEAALTSQQRRSLLSKLRHDKRLRWWSMVACPFTAFYLAGIVFTVNTLYIIKFFLLGCLYSIFHTIGKALFDEHLMALLPLSVYLATKAWFYVTWLMYIDDAVSFTATVCFLISSLLLWVCFLKSWKGDPGII---RPTREQRFKTIIELSERGGIGFEP-----ASFCSGCLVRRPIRSKHCSVCDRCVARFDHHCPWVGNCIGLKNHSYFMGFLWMLLIMCAWMLYGGSKYYVNQCNVRFDDFLGAMRAIGNCDAWVGWVMGNALLHMSWVILLTICQTYQVICLGMTTNERMNRGRYRHFQAKGGH--SPFTRGPIQNLVDFLE 588          
BLAST of Palmitoyltransferase vs. UniProt/SwissProt
Match: sp|Q8IUH5|ZDH17_HUMAN (Palmitoyltransferase ZDHHC17 OS=Homo sapiens OX=9606 GN=ZDHHC17 PE=1 SV=2)

HSP 1 Score: 138.272 bits (347), Expect = 2.744e-33
Identity = 131/550 (23.82%), Postives = 237/550 (43.09%), Query Frame = 3
Query:  276 EILYDVFPSTGD--TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIIN-CKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHP-ELSRMLVFYGLNCNQKDAFGQ-TPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLK-------YQINKRVNKLSSFSRLKYKI-IGAPNKNRFPMIFLI----------------LCAFLWGNPYY---------YYVIRPCSINYAQ-------------------FTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWF--WLFIMLMNAVNFLAGYLLY------IAYTFTNLFIY-TVIFTSLLIALGLVLGFTINF------FLCKQ---ALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFNAR 1700
            E  YDV     +  TL+HWA ++  +D+V Y            +S  +I++    +L+ TPLHWA    +LS++  L+K G D +  D +  + + ++ Q+G+ S   YLI  G ++ + D  G   L WA Y+ H  + +R+L+ + ++ N  D + + T LH+A L+GN + I+ L+E     ++  +   ++ L LA  RK   +  +L+       Y     + KL +    + K+ +G P    F +I+L+                +   +W    +          +   P  I  A                    F +L F+     +++ F  +   DPG +   E+  +  + E+    +             +  C +C   + +R+KHC +C+RC+ + DHHCP+VGNC+G  N  +F  +LF +L      + G + Y        YT    + Y T I T       + L    +F       +C+    + L +T  E    ++Y + +       +P+NHG + N+I +F  R
Sbjct:   78 EAGYDVRQPDKENVTLLHWAAINNRIDLVKYY-----------ISKGAIVDQLGGDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCIHLAAQFGHTSIVAYLIAKGQDVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVNLGDKYHKNTALHWAVLAGNTTVISLLLEA-GANVDAQNIKGESALDLAKQRKNVWMINHLQEARQAKGYDNPSFLRKLKADKEFRQKVMLGTP----FLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPLGIYLATKFWMYVTWFFWFWNDLNFLFIHLPFLANSVALFYNFGKSWKSDPGIIKATEEQKKKTIVELAETGSL----------DLSIFCSTCLIRKPVRSKHCGVCNRCIAKFDHHCPWVGNCVGAGNHRYFMGYLFFLLFMICWMIYGCISYWGLHCETTYTKDGFWTYITQIATCSPWMFWMFLNSVFHFMWVAVLLMCQMYQISCLGITTNERMNARRYKHFKVTTTSIESPFNHGCVRNIIDFFEFR 601          
BLAST of Palmitoyltransferase vs. TrEMBL
Match: A0A267H9N4 (Palmitoyltransferase (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017494g3 PE=3 SV=1)

HSP 1 Score: 380.948 bits (977), Expect = 1.696e-121
Identity = 188/478 (39.33%), Postives = 283/478 (59.21%), Query Frame = 3
Query:  291 VFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIIN-----CKNELHQTPLHWACTIENLSVIQFLVKE-GCDINAKDTKNVTPLIMSCQYGNISGALYLILNGAN-IFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVNKLSSFSRLKYKIIGAPNKNRFPMIFLILCAFLWGNPYYYYVIRPCSINYAQFTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIMLMNAVNFLAGYLLYIAYTFTNLFIYTVIFTSLLIALGLVLGFTINFFLCKQALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFNARN 1703
            V  S+G T+ HWACL G+LD+V+YL  +  N          +IN       +EL Q P+HWAC   ++ V++FL+     DI+ +D K  TPLI++CQYG    A YL+  GAN     D EGD  LHWA +KG P+L R+LV+ G N +Q+DAFGQTPLH AS++GNI+ + DL   D VELNV D N KTPLMLAAGR++  +  +LK +I  R + L +  R  + I G P  ++ PM+FL+ C  +WG P Y     P + +   + +  F++   LMWFAF      DPGF+  +   Y+  + +  +  N  ++ +    NP  +LCH+C+CV+ +RAKHCR+CDRCV EMDHHCPY+ NCIGK NR  F +  + +  +  +   +L  A  +     + V+  +++   GL +G  ++  +   A +N+T  E+   K+Y YL++ +G F NP++ G ++NL+ + + R+
Sbjct:  122 VRDSSGHTVAHWACLHGHLDVVAYLAEVSSNSKG-------VINLCHRASSHELAQYPIHWACVNGHVPVVEFLLDRCSVDIDVRDAKGATPLIIACQYGQTVTAGYLLSRGANRTSAGDNEGDTPLHWAAFKGQPDLMRLLVYSGFNPHQRDAFGQTPLHLASIAGNINAVRDLCRVDKVELNVADKNGKTPLMLAAGRRHDQVERFLKAEIRSRASMLGARFRWSHLIFGPPGNSKAPMLFLLFCILVWGYPTYVSKAVPLTFHLFPWLHWAFLLLNALMWFAFYHANTSDPGFLPRNVPEYDRAIQQAGV--NSADIGLGRMGNPLERLCHTCRCVKPVRAKHCRVCDRCVLEMDHHCPYIYNCIGKNNRFAFAVLSVTLMTLGGMT-MVLAAATLWLGGMDWIVLLGTVIATFGLTVGSVVSSCVWYHAAINMTTNESMNKKRYTYLKDSNGNFRNPFDRGIVNNLLEFCHMRS 589          
BLAST of Palmitoyltransferase vs. TrEMBL
Match: A0A267DE56 (Palmitoyltransferase (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010271g1 PE=3 SV=1)

HSP 1 Score: 380.948 bits (977), Expect = 1.696e-121
Identity = 188/478 (39.33%), Postives = 283/478 (59.21%), Query Frame = 3
Query:  291 VFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIIN-----CKNELHQTPLHWACTIENLSVIQFLVKE-GCDINAKDTKNVTPLIMSCQYGNISGALYLILNGAN-IFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVNKLSSFSRLKYKIIGAPNKNRFPMIFLILCAFLWGNPYYYYVIRPCSINYAQFTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIMLMNAVNFLAGYLLYIAYTFTNLFIYTVIFTSLLIALGLVLGFTINFFLCKQALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFNARN 1703
            V  S+G T+ HWACL G+LD+V+YL  +  N          +IN       +EL Q P+HWAC   ++ V++FL+     DI+ +D K  TPLI++CQYG    A YL+  GAN     D EGD  LHWA +KG P+L R+LV+ G N +Q+DAFGQTPLH AS++GNI+ + DL   D VELNV D N KTPLMLAAGR++  +  +LK +I  R + L +  R  + I G P  ++ PM+FL+ C  +WG P Y     P + +   + +  F++   LMWFAF      DPGF+  +   Y+  + +  +  N  ++ +    NP  +LCH+C+CV+ +RAKHCR+CDRCV EMDHHCPY+ NCIGK NR  F +  + +  +  +   +L  A  +     + V+  +++   GL +G  ++  +   A +N+T  E+   K+Y YL++ +G F NP++ G ++NL+ + + R+
Sbjct:  122 VRDSSGHTVAHWACLHGHLDVVAYLAEVSSNSKG-------VINLCHRASSHELAQYPIHWACVNGHVPVVEFLLDRCSVDIDVRDAKGATPLIIACQYGQTVTAGYLLSRGANRTSAGDNEGDTPLHWAAFKGQPDLMRLLVYSGFNPHQRDAFGQTPLHLASIAGNINAVRDLCRVDKVELNVADKNGKTPLMLAAGRRHDQVERFLKAEIRSRASMLGARFRWSHLIFGPPGNSKAPMLFLLFCILVWGYPTYVIKAVPLTFHLFPWLHWAFLLLNALMWFAFYHANTSDPGFLPRNVPEYDRAIQQAGV--NSADIGLGRMGNPLERLCHTCRCVKPVRAKHCRVCDRCVLEMDHHCPYIYNCIGKNNRFAFAVLSVTLMTLGGMT-MVLAAATLWLGGMDWIVLLGTVIATFGLTVGSVVSSCVWYHAAINMTTNESMNKKRYTYLKDSNGNFRNPFDRGIVNNLLEFCHMRS 589          
BLAST of Palmitoyltransferase vs. TrEMBL
Match: A0A210QC19 (Palmitoyltransferase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT13002 PE=3 SV=1)

HSP 1 Score: 342.813 bits (878), Expect = 1.264e-107
Identity = 166/473 (35.10%), Postives = 269/473 (56.87%), Query Frame = 3
Query:  282 LYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVNKLSSFSRLKYKIIGAPNKNRFPMIFLILCAFLWGNPYYYYVIRPCSINYAQFTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIMLMNAVNFLAGYLLYIAYTFTNLFIYTVIFTSLLIALGLVLGFTINFFLCKQALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFNAR 1700
            ++++    G T  HWACL G+  ++ Y+      ++ +NV+ PS     N+L   P+HWAC   +++++  L++ G   +  D K  TPLI+  QYG+   A YL+  GA + + D +GDNALHWA +KGH EL R+L++ G N  Q+D +GQTPLH A +SGNI+ + +L E+D VE++V D N KTP+ LA GRK+  + +YLK QI ++ + L     L     G P  ++  ++F ++    WG P Y     P + N  Q  ++LF +F  LMWF     +  DPG++  +   Y+  + ++   D ++       +NP ++LCH+C+ V+ +R+KHCRIC+RCV   DHHCPY+ NC+G +NR WF+ F++ +  +     Y  Y        + + V+  ++   +GL     ++  +   A  N+T  E   +K+Y YL++  G F NP+N G++ NL  +F  R
Sbjct:   63 IFNMRDDKGHTPAHWACLGGHSTVLRYMI-----ESKANVNEPS----DNDLGARPVHWACVNGHIAIVDILLQSGVSYDVADNKGCTPLIVGAQYGHTMMAGYLMGKGARLQICDKDGDNALHWAAFKGHSELMRLLIYSGFNPRQRDVYGQTPLHLACISGNITSVQELCEQDGVEVDVADKNGKTPMSLATGRKHDAVVDYLKRQIKQKKSLLPKIDLLTIA-FGPPGNSKGAILFFMINVLCWGYPMYVLKCLPYTWNELQILHILFFIFNVLMWFCLFHASTTDPGYLPRNIPEYDLAIKQVAHFDEWKQG-----ENPLSRLCHTCRTVKPLRSKHCRICNRCVTMFDHHCPYIYNCVGYKNRPWFFAFVITILVLAIFTNYFCYFLLRDFG-WDWVVVIGAVEAGVGLTAVTAVSILMTYHAAANITANERVNYKRYLYLKDGKGAFHNPFNRGFVENLKEFFFLR 519          
BLAST of Palmitoyltransferase vs. TrEMBL
Match: A0A151IF40 (Palmitoyltransferase OS=Cyphomyrmex costatus OX=456900 GN=ALC62_09742 PE=3 SV=1)

HSP 1 Score: 340.117 bits (871), Expect = 2.474e-106
Identity = 176/521 (33.78%), Postives = 287/521 (55.09%), Query Frame = 3
Query:  144 DNKIFIPPSEKCIKSESNTLGDLLEIIKSGKKELLFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVNKLSSFSRLKYKIIGAPNKNRFPMIFLILCAFLWGNPYYYYVIRPCSINYAQFTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIMLMNAVN-----FLAGYLLYIAYTFTNLFIYTVIFTSLLIALGLVLGFTINFFLCKQALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYF 1691
            D+ I++  +    +S ++    + E++++G+ E + E ++ +G   +       G T  HWA L  N++++ YL            S P  + C       P+HWAC   + +++Q L+K G  +NA D K +TPL+ +C +G  + A +L+ +GA   LTD+ GD ALHWA YKGH EL ++L++ G++  + D FG TPLH A LSGNISC+  L EK  ++L   D N KTPL LA   ++  I   L+ +  +R   +   + L   + G    ++ P++  I+   LWG P Y     P + N  + ++  FI +  LMW ++++   +DPG++  +  TY   + +I   D +R   +       ++LCHSC+C R +RAKHCRIC+RCV   DHHCP++ NC+G RNR+WF+LF+M + A+N     + A Y + I      L++  V+   +   LG +L  T     C    +NLT  E   +K+Y+YL+++ GK+ NP++ G + N I +F
Sbjct:   30 DDNIYVDEATTTGQSPTDETKLIFELLRAGEIEAVEELVEKNGLNTVLSARDEWGYTPAHWAALDSNVEVMRYL---------IERSGPVDLPCLGTQGPRPIHWACRKGHSAIVQLLLKTGVTVNAADFKGLTPLMTACMFGKFATAAFLLGSGAQGHLTDINGDTALHWAAYKGHAELIKLLIYSGVDLQKPDYFGSTPLHLACLSGNISCVQILCEKSKIDLEPRDKNGKTPLQLAKSHRHSEIVRILQAEQKRRARWIPPINELWALLFGGAGNSKGPLLLFIISVLLWGYPMYLLKCIPLTWNLLRGSHYCFIYWNILMWISWIVANRRDPGYVPQNSDTYYRAIKQIPYFDKWRKRNVL-----LSRLCHSCRCFRPLRAKHCRICNRCVTYFDHHCPFIYNCVGLRNRMWFFLFVMCV-AINCSFTLYFACYCIAIE-GIQLLYVLGVLEALVFCGLGWILTCTSVLHAC----MNLTTNEMFNYKRYSYLRDKKGKYLNPFSRGPVLNFIEFF 530          
BLAST of Palmitoyltransferase vs. TrEMBL
Match: A0A2C9JLV2 (Palmitoyltransferase OS=Biomphalaria glabrata OX=6526 GN=106059420 PE=3 SV=1)

HSP 1 Score: 338.961 bits (868), Expect = 3.131e-106
Identity = 193/507 (38.07%), Postives = 282/507 (55.62%), Query Frame = 3
Query:  210 LLEIIKSGKKELLFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVNKLSSFSRLKYKIIGAPNKNRFPMIFLILCAFLWGNPYYYYVIRPCSINYAQFTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIMLMNAVNFLAGYLLYIAYTFTNLFIYTVIFT-----SLLIALGLV----LGFTINFFLCKQALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFNARN 1703
            + E +K+G    +   ++  G  +L  +    G T  HWACL G+  I+ Y+      +    +  PS     NEL   P+HWAC   +++++  L + G +++A D KN TPLI++ QYG    A YL+  GA + LTD +GDNALHWA +KGH EL R+L++ G N  QKD FGQT LH A ++GNI+ + +L E+D VE+++ D N KTPL LA GRK+  I  YLK ++  R + L         I G P  ++  ++F ++   LWG P Y +   P + N     +L FI    +MW         DPGF+  +   Y+  + ++   D +     +  +NP ++LCH+C+ V+ IRAKHCR+C+RCV E DHHCPY+ NC+G  NRV F LF++++N +N L  + L   YT   L  +T+ +       LL   GLV    LG TI       A  NLTL E    K+Y YL+N  G+FFNP + G + NL +YF+  N
Sbjct:   22 IFEAVKAGLLIPVQTLVETQGLPVL-TLRDDKGHTPAHWACLGGHTAILRYMI-----ENKIPIDEPS----SNELGARPIHWACVNGHIAIVDILTQAGVELDAVDNKNCTPLIVAAQYGQTMLAGYLMGKGARLQLTDKDGDNALHWAAFKGHNELMRLLIYSGFNPRQKDNFGQTALHLACINGNITAVQELCEQDGVEIDIPDVNGKTPLQLAIGRKHDKIVNYLKKEVQTRNSILPRIDCWAI-IFGPPGNSKGALLFFLVNVVLWGYPMYIFKCFPLTWNELPIYHLTFIFTNVVMWICLYHANTVDPGFLPRNIPEYDLAIKQVAHFDEW-----KQGQNPLSRLCHTCRTVKPIRAKHCRVCNRCVKEFDHHCPYIHNCVGYYNRVSFILFVLMVN-INGL--FELKFLYTLAELEGFTLRYDFLLALCLLAVYGLVAVNILGLTIYL-----AARNLTLNEIINRKRYRYLRNSKGEFFNPNDRGIVENLKHYFHLEN 504          
BLAST of Palmitoyltransferase vs. Ensembl Cavefish
Match: zdhhc17 (zinc finger DHHC-type containing 17 [Source:NCBI gene;Acc:103025153])

HSP 1 Score: 151.754 bits (382), Expect = 6.798e-39
Identity = 143/564 (25.35%), Postives = 257/564 (45.57%), Query Frame = 3
Query:  213 LEIIKSGKKELLFEKLKNSGSEILYDVFPSTGD--TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIIN-CKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHP-ELSRMLVFYGLNCNQKDAFGQ-TPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLK-YQINKRVNKLSSFSRLKYK-------IIGAPNKNRFPMIFLI----------------LCAFLW------GNPYYYYVIR---PCSINYAQ------------FTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWF--WLFIMLMNAVNFLAGYLLYI------AYTFTNLFIY-TVIFTSLLIALGLVLGFTINFF---------LCKQALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFNAR 1700
            L+I+K+ +  + FE+ +    E  YDV     +  TL+HWA ++  +D+V Y            +S  ++++    +L+ TPLHWA    +LS++  L+K G D +  D +  + + ++ Q+G+ S   YLI  G ++ + D  G   L WA Y+ H  + +R+L+ + ++ N  D + + T LH+A L+GN + I+ L+E  N  ++  +   +TPL LA  RK   +  +L+  +  K  +  S   RLK         ++G P    F +I+L+                + A +W         ++ + +    P  I  A             + ++LF  F   +++ F  +   DPG +   E+  +  + E+    +             +  C +C   + IR+KHC +C+RC+ + DHHCP+VGNC+G  N  +F  +LF +L      + G + Y       +Y+   L++Y T I T       + L    +F          L + A L +T  E    ++Y + +       +P+NHG + NLI +F  R
Sbjct:   45 LDIVKATQYGI-FERCREL-VEAGYDVRQPDKENVTLLHWAAINNRIDLVKYY-----------ISKGAVVDQLGGDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCVHLAAQFGHTSIVAYLIAKGQDVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVNLGDKYHKNTALHWAVLAGNTTVISLLLES-NANVDAQNIKGETPLDLAKQRKNVWMINHLQEARQAKGYDSPSYLKRLKMDKEFRQKVMLGTP----FVVIWLVGFIADLDIDSWLIKGLMYAGVWLTVQFLSKSFFDHSMHSALPLGIYLATKFWMYITWFYWFWNDILFNKFILALFYNFGKSWKSDPGIIKASEEQKKKTIVELAETGSL----------DLSIFCSTCLIRKPIRSKHCAVCNRCIAKFDHHCPWVGNCVGSGNHRYFMGYLFFLLCMICWMMYGCISYWRLHCVSSYSRDGLWVYVTQIATCSPWMFWMFLNSVFHFMWVAVLIMCQLYQIAGLGITTNERMNARRYKHFRVTATSIESPFNHGCVRNLIDFFELR 580          
BLAST of Palmitoyltransferase vs. Ensembl Cavefish
Match: zdhhc17 (zinc finger DHHC-type containing 17 [Source:NCBI gene;Acc:103025153])

HSP 1 Score: 146.747 bits (369), Expect = 3.982e-37
Identity = 144/571 (25.22%), Postives = 257/571 (45.01%), Query Frame = 3
Query:  213 LEIIKSGKKELLFEKLKNSGSEILYDVFPSTGD--TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIIN-CKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHP-ELSRMLVFYGLNCNQKDAFGQ-TPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLK-YQINKRVNKLSSFSRLKYK-------IIGAPNKNRFPMIFLI----------------LCAFLW------GNPYYYYVIR---PCSINYAQ-----------FTN--------LLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWF--WLFIMLMNAVNFLAGYLLYI------AYTFTNLFIY-TVIFTSLLIALGLVLGFTINFF---------LCKQALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFNAR 1700
            L+I+K+ +  + FE+ +    E  YDV     +  TL+HWA ++  +D+V Y            +S  ++++    +L+ TPLHWA    +LS++  L+K G D +  D +  + + ++ Q+G+ S   YLI  G ++ + D  G   L WA Y+ H  + +R+L+ + ++ N  D + + T LH+A L+GN + I+ L+E  N  ++  +   +TPL LA  RK   +  +L+  +  K  +  S   RLK         ++G P    F +I+L+                + A +W         ++ + +    P  I  A            F N        L F++    +++ F  +   DPG +   E+  +  + E+    +             +  C +C   + IR+KHC +C+RC+ + DHHCP+VGNC+G  N  +F  +LF +L      + G + Y       +Y+   L++Y T I T       + L    +F          L + A L +T  E    ++Y + +       +P+NHG + NLI +F  R
Sbjct:   45 LDIVKATQYGI-FERCREL-VEAGYDVRQPDKENVTLLHWAAINNRIDLVKYY-----------ISKGAVVDQLGGDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCVHLAAQFGHTSIVAYLIAKGQDVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVNLGDKYHKNTALHWAVLAGNTTVISLLLES-NANVDAQNIKGETPLDLAKQRKNVWMINHLQEARQAKGYDSPSYLKRLKMDKEFRQKVMLGTP----FVVIWLVGFIADLDIDSWLIKGLMYAGVWLTVQFLSKSFFDHSMHSALPLGIYLATKFWMYITWFYWFWNDLPFVTTHLPFLLNSLALFYNFGKSWKSDPGIIKASEEQKKKTIVELAETGSL----------DLSIFCSTCLIRKPIRSKHCAVCNRCIAKFDHHCPWVGNCVGSGNHRYFMGYLFFLLCMICWMMYGCISYWRLHCVSSYSRDGLWVYVTQIATCSPWMFWMFLNSVFHFMWVAVLIMCQLYQIAGLGITTNERMNARRYKHFRVTATSIESPFNHGCVRNLIDFFELR 587          
BLAST of Palmitoyltransferase vs. Ensembl Cavefish
Match: zdhhc17 (zinc finger DHHC-type containing 17 [Source:NCBI gene;Acc:103025153])

HSP 1 Score: 146.362 bits (368), Expect = 5.476e-37
Identity = 144/572 (25.17%), Postives = 256/572 (44.76%), Query Frame = 3
Query:  213 LEIIKSGKKELLFEKLKNSGSEILYDVFPSTGD--TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIIN-CKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHP-ELSRMLVFYGLNCNQKDAFGQ-TPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLK-YQINKRVNKLSSFSRLKYK-------IIGAPNKNRFPMIFLI----------------LCAFLW------GNPYYYYVIR---PCSINYAQFTNLLFIVFQCLMW---------FAFLMTAL-----------KDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWF--WLFIMLMNAVNFLAGYLLYI------AYTFTNLFIY-TVIFTSLLIALGLVLGFTINFF---------LCKQALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFNAR 1700
            L+I+K+ +  + FE+ +    E  YDV     +  TL+HWA ++  +D+V Y            +S  ++++    +L+ TPLHWA    +LS++  L+K G D +  D +  + + ++ Q+G+ S   YLI  G ++ + D  G   L WA Y+ H  + +R+L+ + ++ N  D + + T LH+A L+GN + I+ L+E  N  ++  +   +TPL LA  RK   +  +L+  +  K  +  S   RLK         ++G P    F +I+L+                + A +W         ++ + +    P  I Y      ++I +    W           FL+ +L            DPG +   E+  +  + E+    +             +  C +C   + IR+KHC +C+RC+ + DHHCP+VGNC+G  N  +F  +LF +L      + G + Y       +Y+   L++Y T I T       + L    +F          L + A L +T  E    ++Y + +       +P+NHG + NLI +F  R
Sbjct:   40 LDIVKATQYGI-FERCREL-VEAGYDVRQPDKENVTLLHWAAINNRIDLVKYY-----------ISKGAVVDQLGGDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCVHLAAQFGHTSIVAYLIAKGQDVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVNLGDKYHKNTALHWAVLAGNTTVISLLLES-NANVDAQNIKGETPLDLAKQRKNVWMINHLQEARQAKGYDSPSYLKRLKMDKEFRQKVMLGTP----FVVIWLVGFIADLDIDSWLIKGLMYAGVWLTVQFLSKSFFDHSMHSALPLGI-YLATKFWMYITWFYWFWNDLPFVTTHLPFLLNSLALFYNFGKSWKSDPGIIKASEEQKKKTIVELAETGSL----------DLSIFCSTCLIRKPIRSKHCAVCNRCIAKFDHHCPWVGNCVGSGNHRYFMGYLFFLLCMICWMMYGCISYWRLHCVSSYSRDGLWVYVTQIATCSPWMFWMFLNSVFHFMWVAVLIMCQLYQIAGLGITTNERMNARRYKHFRVTATSIESPFNHGCVRNLIDFFELR 582          
BLAST of Palmitoyltransferase vs. Ensembl Cavefish
Match: zdhhc17 (zinc finger DHHC-type containing 17 [Source:NCBI gene;Acc:103025153])

HSP 1 Score: 143.665 bits (361), Expect = 2.468e-36
Identity = 142/560 (25.36%), Postives = 246/560 (43.93%), Query Frame = 3
Query:  246 LFEKLKNSGSEILYDVFPSTGD--TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHP-ELSRMLVFYGLNCNQKDAFGQ-TPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLK-YQINKRVNKLSSFSRLKYK-------IIGAPNKNRFPMIFLI----------------LCAFLW------GNPYYYYVIR---PCSINYAQFTNLLFIVFQCLMW---------FAFLMTAL-----------KDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWF--WLFIMLMNAVNFLAGYLLYI------AYTFTNLFIY-TVIFTSLLIALGLVLGFTINFF---------LCKQALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFNAR 1700
            +FE+ +    E  YDV     +  TL+HWA ++  +D+V Y   I K      +          +L+ TPLHWA    +LS++  L+K G D +  D +  + + ++ Q+G+ S   YLI  G ++ + D  G   L WA Y+ H  + +R+L+ + ++ N  D + + T LH+A L+GN + I+ L+E  N  ++  +   +TPL LA  RK   +  +L+  +  K  +  S   RLK         ++G P    F +I+L+                + A +W         ++ + +    P  I Y      ++I +    W           FL+ +L            DPG +   E+  +  + E+    +             +  C +C   + IR+KHC +C+RC+ + DHHCP+VGNC+G  N  +F  +LF +L      + G + Y       +Y+   L++Y T I T       + L    +F          L + A L +T  E    ++Y + +       +P+NHG + NLI +F  R
Sbjct:   10 IFERCREL-VEAGYDVRQPDKENVTLLHWAAINNRIDLVKYY--ISKGAVVDQLG--------GDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCVHLAAQFGHTSIVAYLIAKGQDVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVNLGDKYHKNTALHWAVLAGNTTVISLLLES-NANVDAQNIKGETPLDLAKQRKNVWMINHLQEARQAKGYDSPSYLKRLKMDKEFRQKVMLGTP----FVVIWLVGFIADLDIDSWLIKGLMYAGVWLTVQFLSKSFFDHSMHSALPLGI-YLATKFWMYITWFYWFWNDLPFVTTHLPFLLNSLALFYNFGKSWKSDPGIIKASEEQKKKTIVELAETGSL----------DLSIFCSTCLIRKPIRSKHCAVCNRCIAKFDHHCPWVGNCVGSGNHRYFMGYLFFLLCMICWMMYGCISYWRLHCVSSYSRDGLWVYVTQIATCSPWMFWMFLNSVFHFMWVAVLIMCQLYQIAGLGITTNERMNARRYKHFRVTATSIESPFNHGCVRNLIDFFELR 542          
BLAST of Palmitoyltransferase vs. Ensembl Cavefish
Match: zdhhc13 (zinc finger DHHC-type containing 13 [Source:NCBI gene;Acc:103037783])

HSP 1 Score: 108.227 bits (269), Expect = 2.230e-24
Identity = 130/558 (23.30%), Postives = 214/558 (38.35%), Query Frame = 3
Query:  276 EILYDVFPSTGD--TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYK-GHPELSRMLVFYGLNCNQKDAFGQ-TPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVNKLSSFSRL--KYKI-------------IGA---PNKNRFPMIFLILCAFL---------WGNPYYYYVIRPCSINYAQF------------------TNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYE---TVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIMLMNA----------------------------VNFLAGYLLYIAYTFTNLFIYTVIFTSLLIALGLVLGFTINFFLCKQALLNLTLVEAQRWKKYNYLQNEDGKFF---NPYNHGWISNLIYYFNAR 1700
            E  YDV     +  TL+HWA ++   D+V Y   I K           I     +L+ TPLHWA    +L ++  L++ G D +  D +    L ++  + ++  A Y++  G  + L D  G  +L  A  K   PE +  L+    + N  D   + +PLH A L+GN+  +  L+E     +++ + N  TP+ LA      ++   L     +RV   S   R+  KY++             +GA    N   + +  ++L   L         W N     +I   ++  + F                    +LF +    + + +L     DPG +   E+  +    VL E   LD                 C SC   + +RA+HC IC+ CV + DHH  ++  C+G RN  +F +F++ +N                             V  L G   ++ Y F   F +T   + LLI     + F             L L  A+R       +N    F    NP+N G + NL+ +F  R
Sbjct:   91 EAGYDVRQPDKENVTLLHWAAINNRADLVKYY--IAKGAV--------IDQLGGDLNSTPLHWAIRQGHLQMVIQLMRYGADPSLPDGEGYRGLHLAVLFQHMPIAAYMMAKGQEVDLPDTNGQTSLMLAAQKIIGPEPTNFLLKCNASVNAVDKINRNSPLHCAVLAGNVDAVHILLEA-GASVDLQNTNGHTPIDLAHQVHSPLLIHMLNVVQKERVKSNSPCLRVLSKYRVCLQCVFSVSVVWAVGAILDMNSESWLLKGVLLACVLAVINLTCRQWANAAVQALIPSTALLASVFWMLITWYFWFLPDGPSATVQVLFTLTGTALLYYYLRACRTDPGLIRATEEEKKKNVVVLAEAGCLDP-------------RIFCTSCMMKKPMRAQHCFICNTCVAKQDHHSVWINGCVGARNHHFFVMFLITLNLLGIWMFYGSLKYWMNHCAAVSELSLWGFVTGLVGCSPWVLYIFCLAFFHTAWASILLIHQIYQVAF-------------LGLTTAERGTLMRSQRNMPQTFSLRQNPFNRGVLKNLVNFFQLR 611          
BLAST of Palmitoyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004672.1 (pep scaffold:Pmarinus_7.0:GL477315:17052:39954:-1 gene:ENSPMAG00000004227.1 transcript:ENSPMAT00000004672.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 121.709 bits (304), Expect = 2.320e-29
Identity = 128/583 (21.96%), Postives = 248/583 (42.54%), Query Frame = 3
Query:  186 SESNTLGDLLEIIKSGKKELLFEKLKNSGSEILYDVFPSTGD--TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIIN-CKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHP-ELSRMLVFYGLNCNQKDAFGQ-TPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKR-------VNKLSSFSRLKYKI-IGAPNKNRFPMIFLI----------------LCAFLW-------------------------GNPYYYYV-----IRPCSINYAQFTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWF--WLFIMLMNAVNFLAGYLLY------IAYTFTNLFIYTV--------IFTSLLIALGLVLGFTINFFLCKQ---ALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFNAR 1700
            S+  +  D+++  + G    +FE+ +    E  YDV     +  TL+HWA ++  +D+V +            +S  +I++    +L+ TPLHWA    +LS++  L+K G D +  D +  + + ++ Q+ + +   YLI  G ++ + D  G   L WA Y+ +  + +R+L+ +    N  D F + T LH+A L+ N + I  L++     ++  +   ++ L LA  RK   I   L+     +       +++  S   ++ K+ +G P    F +I+LI                L   +W                         G  ++ Y+     + P   +   F  + F++    +++ F  +   DPG +   E+  +  + E+    +             +  C +C   + +R+KHC +C+RC+ + DHHCP+VGNC+G  N  +F  +LF +L      + G +++        Y     + Y          IF   + +L  +   TI   +C+    + L +T  E    ++Y + +       +P+NHG   N + +F  R
Sbjct:   57 SDDYSTWDIIKATQYG----IFERCREL-VEAGYDVRQPDKENVTLLHWAAINNRIDLVKFY-----------ISKGAIVDQLGGDLNSTPLHWATRQGHLSMVVLLMKYGTDPSLLDGEGCSCIHLAAQFQHTAIVAYLIAKGLDVDMMDQNGMTPLMWAAYRTYGVDPTRLLLTFNATVNLGDKFHKNTALHWAVLASNTNVIGLLLDA-GANVDAQNVKGESALDLAKQRKNAWIVNRLQEARQAKGLDNASFLHRFKSDKSVRQKVMLGTP----FLVIWLIGFIADLDTGSWLIKGALYVGVWALVQFLSKTFFDHSMHSALPLGIYLGTKFWMYITWFGWLWP---DILCFQQVPFLINTAALFYNFGKSWKSDPGVVKATEEQKKKTIVELAEAGSL----------DLSIFCSTCLIRKPVRSKHCSVCNRCIAKFDHHCPWVGNCVGAGNHRYFVGYLFFLLGTICWLIYGCIIFWSRRCHTTYHTDGFWTYVSQVAMCSPWIFWMFINSLFHLTWVTI-LLMCQLYQISCLGITTNERMNARRYKHFKVTATTIESPFNHGCFRNSVDFFQCR 604          
BLAST of Palmitoyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.8113 bits (216), Expect = 2.414e-18
Identity = 62/203 (30.54%), Postives = 103/203 (50.74%), Query Frame = 3
Query:  288 DVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILN-GANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAA--GRKYRVIT 887
            +V    G T +H A  +G+ ++V++L           V+  + IN  ++  +  +HWA  + +  V++ LV  G D+  KD K  +PL  +   G I G + L+L+ G +I   +  G+ ALH A Y G   +   L+  G N NQ +  G TPLHFA+ S + +   +L+  +  ++NV   + K+PL + A  GR  R  T
Sbjct:  132 NVSDRAGRTALHHAAFNGHSEMVNFL-----------VAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQI-GVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQT 322          

HSP 2 Score: 77.7962 bits (190), Expect = 3.237e-15
Identity = 59/199 (29.65%), Postives = 91/199 (45.73%), Query Frame = 3
Query:  300 STGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSV-IQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEY 893
            S G+T +H AC +G   +V+ L      D  +NV      N  NE   TPLH+A    + ++ ++ LV  G D+N +     +PL M+  +G  + +  LI NG  I   D +G+  LH A   GH  L   L+  G +  ++   G  PLH A+LSG   C   L                    L+AG+KY +++ +
Sbjct:  235 SFGNTALHVACYNGQDVVVNELI-----DCGANV------NQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKL--------------------LSAGQKYSIVSSF 402          

HSP 3 Score: 75.8702 bits (185), Expect = 1.445e-14
Identity = 53/191 (27.75%), Postives = 82/191 (42.93%), Query Frame = 3
Query:  312 TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKD------------------TKNVTPLIMSCQYGNISGAL---------------YLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCI 785
            T +H A   G  +I+  L           V   + +N K+    TPLH AC   + + +Q L+K   D+NA+D                   + + P++ S    + +G                 +L+  GANI   D +   A+HWA Y GH E+ ++LV +G +   KD  G +PLH AS SG I  +
Sbjct:   41 TPLHAAAYLGEAEIIELL-----------VLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVV 220          

HSP 4 Score: 66.2402 bits (160), Expect = 1.313e-11
Identity = 57/217 (26.27%), Postives = 97/217 (44.70%), Query Frame = 3
Query:  306 GDTLMHWACLSGN---LDIVSYLKVIYKNDTNS--------------------NVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNG--ANIFLTDVEGDNALHWALYKGHPELS---RMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRK 872
            G T +HWAC +G+   ++++  L V  K + N+                    +     IINC +   + PLH A   +++  +Q L+     +N  D    +PL+M+C+ G  + A+ +++N    ++ L D   + ALH A  + H   +      +      N  +A  QTPLH A+ SG  + +  L+ K    L V D+N  TP +  A  K
Sbjct:  789 GYTPLHWACYNGHDGCVELLLELDVFQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQAT-AVEVLVNSTKTDLKLQDANRNTALHLACSRSHETCALLILDKLDDLNLINATNAALQTPLHLAARSGMATVVQVLLNKGASILAV-DHNGYTPALSCAPNK 1003          

HSP 5 Score: 64.3142 bits (155), Expect = 4.815e-11
Identity = 67/260 (25.77%), Postives = 103/260 (39.62%), Query Frame = 3
Query:  231 GKKELLFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMS--CQYGNISGAL--YLILNGANIFLTDVEGDNALHWALYKGHPELSRMLV------------FYGLNC----------------------NQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYL 896
            G  E L   ++N+ S    D   +   T +  A  +G+ D  S L           +S  + IN K+    T LH      +   +  L++   D++ ++ +   PL M+  C +  I  AL    + +GA I LTD  G   LHWA Y GH     +L+            F  L+C                      N  DA G+ PLH A+ + ++ C+  L+   N  +NV D   K+PLM+A         E L
Sbjct:  661 GHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLL-----------LSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLELDVFQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAKGRMPLHAAAFTDHVECL-QLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVL 908          

HSP 6 Score: 63.5438 bits (153), Expect = 9.256e-11
Identity = 56/214 (26.17%), Postives = 98/214 (45.79%), Query Frame = 3
Query:  231 GKKELLFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCD----INAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVE---KDNVELNVHDNNNKTPL 851
            G  E+L   L      +  DV    G T +  A L G+ D V   +V+ ++         S++  +    +T LH A T  ++  ++ LV E  D    ++A D    TP++++   G+   A  L+  GA+I   D +G  ALH     GH E   +L+   ++ + ++  G+ PLH A+  G++  ++ LV+        + + D N  TPL
Sbjct:  597 GALEVLIRSL------VDLDVREGNGYTPLGLAALRGHTDCV---RVLIQHGA-------SVLLKEGPDRRTALHSAATNGHVECLRLLV-ENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPL 793          

HSP 7 Score: 58.5362 bits (140), Expect = 3.299e-9
Identity = 58/225 (25.78%), Postives = 95/225 (42.22%), Query Frame = 3
Query:  243 LLFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMS--------CQYGNISGALYLILN----------GANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAA 863
            L  E L N+G+++  +V    G + +H   + G     +  + + +N           I+C++    TPLH A    +  +I  L+  G D   +    + PL ++        C+    +G  Y I++          G  I   D  G   LH A   G+ E   +L+  G + N+KD F +T LH+A+ + N+ C+  LV      LN  D    TPL  AA
Sbjct:  285 LCLELLVNNGADV--NVQSKDGKSPLHMTAVHGRF---TRSQTLIQNGGE--------IDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVAS-GARLNEQDERRCTPLHYAA 495          

HSP 8 Score: 57.7658 bits (138), Expect = 5.763e-9
Identity = 52/213 (24.41%), Postives = 86/213 (40.38%), Query Frame = 3
Query:  324 WACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANI---------------------------------FLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAA 863
             A  +G+ D V  L  IYK +          +N  ++  +TPLH A  +    +I+ LV  G  +N+KD K +TPL  +C   + +    L+ + A++                                  ++D  G  ALH A + GH E+   LV  G N N  D   +  +H+A+  G+   +  LV     ++   D    +PL  A+
Sbjct:   12 QAIFNGDPDEVRSL--IYKKEE---------VNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAH-GADVRCKDKKGYSPLHAAS 212          

HSP 9 Score: 56.225 bits (134), Expect = 1.572e-8
Identity = 43/169 (25.44%), Postives = 82/169 (48.52%), Query Frame = 3
Query:  444 TPLHWACTIENLSVIQFLVKE--GCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQ-TPLHFASLSGNISCIADLVE--KDNVELNVHDNNNKTPLMLAAGRKYRVITEYL---KYQINKRVNK 926
            TP+H+A    +   ++ L+++      + K    ++PL ++  +G+      LI +  ++ + +  G   L  A  +GH +  R+L+ +G +   K+   + T LH A+ +G++ C+  LVE    N  ++  D N +TP+MLA G  +      L      IN + NK
Sbjct:  550 TPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNK 718          
BLAST of Palmitoyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009608.1 (pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 gene:ENSPMAG00000008655.1 transcript:ENSPMAT00000009608.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.2705 bits (212), Expect = 7.486e-18
Identity = 57/193 (29.53%), Postives = 91/193 (47.15%), Query Frame = 3
Query:  384 DTNSNVSWPSIINCKN--ELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHF--------------------ASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYL 896
            DT   +     +NC++    H TPLH+A     +SV+++L++ G D++AKD   + PL  +C YG+   A  L+  GA + + D+     LH A  KG  E+ ++L+ +G +  +K+  G TPL                      A+  G ++ +  L   +NV        N TPL LAAG     + EYL
Sbjct:  630 DTVKQLCTTQTVNCRDMEGRHSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKRGAVVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCSGENVNCRDSQGRNSTPLHLAAGYNNLEVAEYL 822          

HSP 2 Score: 73.1738 bits (178), Expect = 9.946e-14
Identity = 41/117 (35.04%), Postives = 64/117 (54.70%), Query Frame = 3
Query:  417 INCKNE--LHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFAS 761
            +NC++    + TPLH A    NL V ++L++ G D+NA+D   + PL  +  YG++  A  LI   A +  TD      LH A  KG  +L  +L+ +G + + K+  GQTPL  A+
Sbjct:  794 VNCRDSQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYSACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPSMKNQEGQTPLDLAT 910          

HSP 3 Score: 62.3882 bits (150), Expect = 2.464e-10
Identity = 38/120 (31.67%), Postives = 59/120 (49.17%), Query Frame = 3
Query:  408 PSIINC--KNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYG-----LNCNQKDAFGQTP 746
            P  +NC   +    TPLH A     + ++Q L++ G D++AKD   + PL  +C YG+      L+ +GA++   D+     LH A  K   E+  +L+ YG     LNC+ K A    P
Sbjct:  322 PLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGASVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGADPTLLNCHSKSAIDLAP 441          

HSP 4 Score: 57.7658 bits (138), Expect = 5.537e-9
Identity = 45/174 (25.86%), Postives = 78/174 (44.83%), Query Frame = 3
Query:  444 TPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHF--------------------ASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAG-RKYRVITEYLKY 902
            TPLH+A       V++ L++ G +++A+D   + PL  +C +G+      L+  GA+    D      LH A  KG  ++  +L+ +G +   ++  G+T L                      A+ SGN   +  L+   NV  +  D    TPL LAAG  + R++   L++
Sbjct:  183 TPLHFAAGFGRKDVVEHLLQNGANVHARDDGGLIPLHNACSFGHAEVVNLLLRQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPGIRNTDGKTALDLAEPTAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQH 356          

HSP 5 Score: 54.299 bits (129), Expect = 6.357e-8
Identity = 51/192 (26.56%), Postives = 82/192 (42.71%), Query Frame = 3
Query:  414 IINCKN-ELHQTPLHWACT---IENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFG-----------QTPLHFASL----------------SGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYL 896
            IIN K+ + H+T LH A      +   V + L+++G ++N K    +TPL ++    +      L+ +GA I +TD  G  +LH A + GH    R+L+ +G + N     G           Q  LH +SL                +G++  +  L     V     +  + TPL  AAG     + EYL
Sbjct:  478 IINFKHPQTHETALHCAVASPYPKRKQVSELLLRKGANVNEKTKDLLTPLHVASDKAHNDVIDVLLKHGAKINVTDSLGQTSLHRAAHAGHLTTCRLLLSHGCDPNLPSLQGFTAAQLGNESVQQILHESSLPVRNSDVEHQLLEAAKAGDLDTVKQLCTTQTVNCRDMEGRHSTPLHFAAGYNRVSVVEYL 669          
BLAST of Palmitoyltransferase vs. Ensembl Sea Lamprey
Match: zdhhc13 (zinc finger DHHC-type containing 13 [Source:ZFIN;Acc:ZDB-GENE-041212-79])

HSP 1 Score: 83.1889 bits (204), Expect = 3.950e-17
Identity = 86/410 (20.98%), Postives = 161/410 (39.27%), Query Frame = 3
Query:  300 STGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINC-KNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGH-PELSRMLVFYGLNCNQKDAF-GQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVNKLSSFSRLKYKIIGAPNKNRFPMIFLILCAFL--------------------------WGNP-----YYYYVIRPCSINYAQFTN-LLFIVFQCLMWF----------AFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKN---PFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRN 1385
            + G +L+HWA ++  +D+  +            +S  +++N     L+ TP+HWA    +L ++  L+  G D    D +  + L  + Q+ +     YL+  G +I L D  G   +  A  +   PE +RMLV  G +  + D   G + LH+ S+ G       ++      +++ +   +TPL++A   K  ++   L   +  R  +    SRL + +    ++    M+ + L A L                          WG+      + ++         A F++ LL+  F  ++W           +  M  +       C  K         +     R   I+  +      +  C  C   R   +KHC +C RC++  D HC ++GNC+G +N
Sbjct:   34 AEGISLLHWAAINNRIDVAKFY-----------LSKGAVVNQFAGVLNATPMHWAVRQGHLEMVVLLMAFGGDPGLWDDEGGSCLHTAAQFDHPHIIAYLLAKGQDIDLLDKHGRTPIMLAALRTQGPEPTRMLVQCGASLGRVDQLHGNSVLHY-SVQGGAGIPTQVLLDAGAPIDIVNKEGETPLIMAVRTKASLVARLL---VEARKTRGLHGSRLMHAL---KSRKSLGMVLVWLLAGLSFGLVGGVLTLKSESWLLKGTLLSAVWGSSALVTRFLFFQESQKIARLAAFSSTLLWTHFTWILWLWPHILCVFTHSEPMAVIVSGAAFYCLAKVARPPPGIARNQQEQRQTVIKMAEAGTFTASTYCIICLAPRPPLSKHCPMCGRCIEGYDSHCWWIGNCVGAKN 425          
BLAST of Palmitoyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.1889 bits (204), Expect = 7.807e-17
Identity = 51/151 (33.77%), Postives = 76/151 (50.33%), Query Frame = 3
Query:  444 TPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYL 896
            TPLH AC    + V++ L+K G  I A     +TP+ +S   GN++  L L+  GA+   T+V G+ ALH A   G  E+ R L+  G   + K    QTPLH A+  G +  I  L+ +     +   +N  TPL +AA   +  +T  L
Sbjct:   17 TPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLE-IVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAIL 166          

HSP 2 Score: 72.7886 bits (177), Expect = 1.245e-13
Identity = 48/163 (29.45%), Postives = 72/163 (44.17%), Query Frame = 3
Query:  306 GDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADL 794
            G   +H     G+ D+ S L   Y +           +N   +   +PLH A   + ++V + LVK G  +NA      TPLI++C YGNI    +L+ +GA++      G   LH A  +GH  +  +L+  G   N     G T L  A   G IS +  L
Sbjct:  279 GVAPLHLGAQEGHADVASLLLARYAD-----------VNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 430          

HSP 3 Score: 67.781 bits (164), Expect = 3.885e-12
Identity = 55/206 (26.70%), Postives = 93/206 (45.15%), Query Frame = 3
Query:  246 LFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAA 863
            + E L   G+ I  +    +G T MH +   GNL+IV  L            + P+  N + E   T LH A       V++ L++ G  ++AK  +  TPL ++ + G +     L+ + A+       G   LH A  +GH +++ +L+ +G +       G TPLH AS  G +  +A L+ +     +    N  TPL +A+
Sbjct:   30 VMELLLKYGASI--EAVTESGLTPMHVSAFMGNLNIVLILL--------QGGASPNATNVRGE---TALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKME-VASLLLQRFASPDAAGKNGLTPLHVAS 221          

HSP 4 Score: 65.4698 bits (158), Expect = 2.290e-11
Identity = 61/246 (24.80%), Postives = 100/246 (40.65%), Query Frame = 3
Query:  225 KSGKKELLFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYL-KVIYKNDTNSNVSWPSIINCKNELHQ---------------------TPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYL 896
            ++G+ E++   L+N G+++  D       T +H A   G L+IV  L + +   D  ++  +  +     E H+                     TPLH A     + V   L++     +A     +TPL ++  Y N   AL L+  GA+   T   G   LH A  K   E++  L+ YG   N     G  PLH  +  G+   +A L+     ++N    +  +PL LAA      + E L
Sbjct:   90 RAGQTEVVRSLLRN-GAQV--DAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHAD-VASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEIL 331          

HSP 5 Score: 61.2326 bits (147), Expect = 5.150e-10
Identity = 44/151 (29.14%), Postives = 69/151 (45.70%), Query Frame = 3
Query:  444 TPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYL 896
            TPLH A   + L +   L++ G + NA   + V PL +  Q G+   A  L+   A++      G + LH A  +    ++ +LV +G + N     G TPL  A   GNI  +  L++    ++N    N  TPL  AA + +  I   L
Sbjct:  248 TPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQH-GADVNSKTKNGYTPLHQAAQQGHTHIVNLL 397          

HSP 6 Score: 59.3066 bits (142), Expect = 1.759e-9
Identity = 46/185 (24.86%), Postives = 81/185 (43.78%), Query Frame = 3
Query:  306 GDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLA 860
            G T +H A   G +++ S L   + +   +          KN L  TPLH A   +N  V   L+ +G   +A      TPL ++ +   +  A  L+  GA       +G   LH    +GH +++ +L+    + N     G +PLH A+    ++ +A+++ K    +N       TPL++A
Sbjct:  180 GFTPLHVASKYGKMEVASLLLQRFASPDAAG---------KNGL--TPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVN-VAEILVKHGAHVNATTKLGYTPLIVA 352          
BLAST of Palmitoyltransferase vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 97.8265 bits (242), Expect = 7.879e-22
Identity = 100/437 (22.88%), Postives = 168/437 (38.44%), Query Frame = 3
Query:  312 TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCK-NELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILN--------------------------------------GANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVH--------DNNNK-----TPLMLAAGRKYRVITE-----------YLKYQINKRVNKLSSFSRLKYKIIGAPNKN--RFPMIF-LILCAFLWGNPYYYYVIRPCSINYAQFTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIMLMNA 1424
            T +HWA ++  L +V +L           VS  + +N +   LH TPLHWA     + ++ FL+K G D    D +    L +S    NI   LY++ N                                      GA+I + D EG   LHW   KG P + + L+  G +  QK   G+     A     +  + + +     + + +          + K     TP +   G  + + +             L    NK +NK   F    Y  +G  N    R P++  +     LW    +++ + P + +  Q+TN+L +V    +++ F    + DPG +  +E  +E V   I    N   +   D KN     C      + +R+K   + +  V   DH+CP++ N +G +N   F  FI LM +
Sbjct:  111 TGLHWASINNRLSVVDFL-----------VSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMNTVYSLREALTHSGFDYHGYPIKKWFKKSQHAKLVTFITPFLFL-GIAFALFSHINPLFVIIVLFLLAIATNKGLNK---FVLPSYGRMGVHNVTLLRSPLLSGVFFGTLLWVTIVWFFKVMPRTFSDEQYTNILMLVILVSVFYLFGQLVIMDPGCL-PEETDHENVRQTIS---NLLEIGKFDTKN----FCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFITLMES 524          
BLAST of Palmitoyltransferase vs. Ensembl Yeast
Match: SWF1 (Palmitoyltransferase that acts on transmembrane proteins; including the SNAREs Snc1p, Syn8p, Tlg1p and likely all SNAREs; contains an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain; may have a role in vacuole fusion [Source:SGD;Acc:S000002533])

HSP 1 Score: 63.1586 bits (152), Expect = 2.737e-11
Identity = 25/49 (51.02%), Postives = 36/49 (73.47%), Query Frame = 3
Query: 1266 CHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIM 1412
            C +C+ V+  R+KHC IC+RCV   DHHC ++ NCIGK N + F+LF++
Sbjct:  136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLI 184          
BLAST of Palmitoyltransferase vs. Ensembl Yeast
Match: AKR2 (Ankyrin repeat-containing protein; member of a family of putative palmitoyltransferases containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain; possibly involved in constitutive endocytosis of Ste3p; AKR2 has a paralog, AKR1, that arose from the whole genome duplication [Source:SGD;Acc:S000005560])

HSP 1 Score: 63.929 bits (154), Expect = 3.838e-11
Identity = 104/496 (20.97%), Postives = 176/496 (35.48%), Query Frame = 3
Query:  240 ELLFEKLKNSGSEILYDVFPSTG--------DTL--MHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGC---------------------------------------DINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVEL--NVHDNNNKTP-------------LMLAAGRKYRVITEYLKYQINKRVNKLSSFSRLKYKIIGAPNKNR----------FPMIFLILCAFL---WGNPYYYYVIRPCSINYAQFTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIMLMNAVNFLAGYLLYIAYTFTNLFIYTVI 1496
            ++  E  K+   +++ DV  S          D L  +HWAC++    +  +L  + +    +  + P           T LHWA    N+ ++  L+K G                                        DI++KD  N TPL+ +   G+      L+  G+ +  TD  G NALH AL  G   +   L+  G N  +++   Q     A   G  S     ++    +   N  D   K               LM+       V++  L   ++  V  +   +  K+ +   P KN           F  +FL    FL   W    Y     P S++     N+ F+V   L    FL     DPG +  D+ +  ++   IK L +       ++       C      + +R+K+       V   DH+CP++ N +G +N   F  F + +    FL  +L    +  TN +IY  +
Sbjct:   52 DIFIEAAKDGDLKVVKDVVESGAVDINNDRIDELSGLHWACINNRFSVAKFL--LLRGANPNQAAGPG--------GATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRGFNALHCALVGGDQRVICDLILSGANFYERNNQKQDCFDLAEGMGTKSLFEQALQHHGYDRLGNQKDKLFKKSSHAQFTIFLSPFLLMVYIYLISLVLSPVLAIMLSLLVTVVMVNTLKKFVLPCLPRKNTYKVSLTRTPFFSGLFLSTFCFLIYIWTKKLY-----PYSVSDYTMKNVQFLVTSFLTVVLFLRLVRSDPGCLKTDD-SLTSIQETIKQLIDLGKFDRENF-------CVETLERKPLRSKYSFFSGALVARYDHYCPWIYNDVGLKNHKLFVFFAVTVQYHMFLFMWLCLAYFKKTN-YIYEQV 523          
BLAST of Palmitoyltransferase vs. Ensembl Yeast
Match: ERF2 (Subunit of a palmitoyltransferase; this complex adds a palmitoyl lipid moiety to heterolipidated substrates such as Ras1p and Ras2p through a thioester linkage; mutants partially mislocalize Ras2p to the vacuole; palmitoyltransferase is composed of Erf2p and Shr5p [Source:SGD;Acc:S000004236])

HSP 1 Score: 61.6178 bits (148), Expect = 1.075e-10
Identity = 38/132 (28.79%), Postives = 67/132 (50.76%), Query Frame = 3
Query: 1086 LLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQ-----LCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIM--LMNAVNFLAGYLLYIA 1460
            + F  F  +   +F+ TA  DPG +  +    + + N  ++   + N+      +  ++      C SC+  R  R+ HC  C+ CV   DHHC +V NCIGKRN  +F +F++  ++++V  L    ++IA
Sbjct:  111 IFFYYFWVITLASFIRTATSDPGVLPRNIHLSQ-LRNNYQIPQEYYNLITLPTHSSISKDITIKYCPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIFLLGAILSSVILLTNCAIHIA 241          
BLAST of Palmitoyltransferase vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 59.6918 bits (143), Expect = 1.224e-10
Identity = 49/174 (28.16%), Postives = 79/174 (45.40%), Query Frame = 3
Query:  402 SWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKD---TKNVTPLIMSCQYGNIS--GALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLM--LAAGRKYRVITEYLKY 902
            S PS++  K++  + PLHW+ + +   +  FL+ +  ++N  D       TP  ++C  GN+    +LY      ++     +G   LH A+ K   E+S+ L+  G +   KD F Q PLH A+  G++  I  L       +N  D    TPL   LA G     +    KY
Sbjct:   24 SKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKY 197          

HSP 2 Score: 50.8322 bits (120), Expect = 1.316e-7
Identity = 51/183 (27.87%), Postives = 77/183 (42.08%), Query Frame = 3
Query:  306 GDTLMHWACLSGNLDIVSYLKVIYKN----DTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGC--DINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNC-NQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDN 833
            G   +HW+      +I S+L    +N    D   +  W            TP H AC++ NL V++ L       D+N    + VT L ++        + +LI NGA++ + D      LH A   G  +L  +L   G +  N +D  G TPL  A   G+      LVEK   E ++ DN
Sbjct:   36 GRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGW------------TPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDN 206          
BLAST of Palmitoyltransferase vs. Ensembl Nematostella
Match: EDO43161 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:A7RZK6])

HSP 1 Score: 100.523 bits (249), Expect = 1.687e-22
Identity = 95/370 (25.68%), Postives = 152/370 (41.08%), Query Frame = 3
Query:  495 LVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHP-ELSRMLVFYGLNCNQKDAF-GQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLK-YQINKRVNKLSSFSRLKYKIIGAPNKNRFPMIFL-ILCAFLWGNPYYY-------------------YVIR-----------PCSINYAQFTNLLFIVFQCLMWFAFLMTALKDP-----------GFMVCDEKTYETVLNEIKLL--DNFRNVKIRDYKN--PFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIMLMNAVNFLAGYLLYI 1457
            L+K   D   +D +  T L  + Q G  S   YL+  G ++ L D  G   L WA Y+    +  RMLV  G + N+ D+    T LH+A  S N + I   + K    +++ +   +TP  +A  +K + ++  L+ + ++K   K      L   +       R+ +IF  I+  FL G    Y                   Y++R           PC++  A        ++    WF F    +  P           G M C  K+++T    +K    +  R +     +N   F++ C +C   R IR+KHC +CDRCV   DHHCP+V NC+G  N              +F  GYL ++
Sbjct:    5 LMKHKADPTIQDVEGCTALHAAAQNGQTSIMAYLLAKGMDVDLPDKNGMTPLMWAAYRCFSVDAVRMLVTMGASVNKTDSVHSNTALHWAVSSNNHNVIHP-IAKAGASIDLVNAKGETPADIATEKKNKWVSLQLELFSMDKGKGK----PLLLRPLTTDKAVRRYVLIFTPIIAMFLIGAILEYSSVWWSALLLLGALTAVVMYIMRLFHRNDPGSPLPCAVYLAT------KLYMYTTWFLFYWPYVNTPKTLIVFFVNTAGLMYCFYKSWKTDPGYLKTTPAEQKRTIIQLAERNMLDFSRFCSTCLIRRPIRSKHCSVCDRCVARFDHHCPWVENCVGAGNH-------------HFFIGYLFFL 350          
BLAST of Palmitoyltransferase vs. Ensembl Nematostella
Match: EDO38725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC11])

HSP 1 Score: 81.2629 bits (199), Expect = 1.403e-17
Identity = 53/184 (28.80%), Postives = 87/184 (47.28%), Query Frame = 3
Query:  312 TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAA 863
            T +H AC  G++++   L           V   + ++ KN+  +TPLH A  I +   ++FL+ +G  I+ +D  + TP + +   G    A+ L+         D    + LH A   G       L   GL+ N++D  GQ+ LH A+LSG    +  L+ +   ++N  D+N  TPLM AA
Sbjct:   38 TPLHVACKKGSMEVGRLL-----------VEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEK-------DENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLL-RYGADINARDSNRWTPLMCAA 202          

HSP 2 Score: 51.6026 bits (122), Expect = 1.988e-7
Identity = 37/120 (30.83%), Postives = 62/120 (51.67%), Query Frame = 3
Query:  516 INAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLM--LAAGR 869
            +N  D    + L  + +Y  +     LI NG+   + D+     LH A  KG  E+ R+LV  G   ++K+  G+TPLH A+  G+   +  L+ K  V ++  D +++TP +  +AAGR
Sbjct:    1 LNKMDDTGFSALHHATRYNRVEAMAELIRNGS---IEDL--STPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSK-GVAIDERDFSHRTPFLSAVAAGR 114          
BLAST of Palmitoyltransferase vs. Ensembl Nematostella
Match: EDO44298 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:A7RWD7])

HSP 1 Score: 76.6406 bits (187), Expect = 1.730e-15
Identity = 54/206 (26.21%), Postives = 97/206 (47.09%), Query Frame = 3
Query: 1125 FLMTALKDPGFMVCDEK-----TYETVLNEIKLL-----DNFRNVKIRDYKNPFN---QLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIMLMNAVNFLAGYLLYIAYTFTNLFIYTVIFTSLLIALGLVLGF---TINFFLCKQALLNLTLVEAQRW---KKYNYLQ--NEDGKFFNPYNHGWISNL 1679
            + +  + DPG++   E      +YE    +I+       DN           PF    + C  C  ++ +R KHC  C RCV + DHHCP++G C+G+RN  +FW F++  NA+   A  + +  + + + +   V+  + L+    +L F   T+   LC    L +T      +    + +YL+  +ED    NP++ G++ N+
Sbjct:   60 YFIAGIMDPGYVETQEHNNILISYEKAEVDIESQSENESDNAEETCKILATPPFGSRLRRCGYCAIMQPLRTKHCEDCGRCVRKYDHHCPWLGTCVGERNHRFFWCFLVSQNALVAWAIEIAWHGFVYKDSWWDWVVANAFLLISMFILIFGMITVFLLLCCHTYLMVTAQTTWEYMSRSRISYLKTLSED---INPFDQGYLCNV 262          
BLAST of Palmitoyltransferase vs. Ensembl Nematostella
Match: EDO38596 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:A7SCF8])

HSP 1 Score: 77.0258 bits (188), Expect = 1.816e-15
Identity = 34/100 (34.00%), Postives = 58/100 (58.00%), Query Frame = 3
Query: 1122 AFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIMLMN 1421
            A++  ++ +P     D +TY       ++  N + +K++         C +CK  R  RA HC +CD CV+  DHHCP+VGNC+GKRN  +F++F++ ++
Sbjct:   95 AYIEKSMAEPP--SGDPQTYRPPPRTKEVTVNGQTIKLK--------FCFTCKIFRPPRASHCSMCDNCVERFDHHCPWVGNCVGKRNYKFFYMFLLSLS 184          
BLAST of Palmitoyltransferase vs. Ensembl Nematostella
Match: EDO46319 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:A7RQ92])

HSP 1 Score: 74.7146 bits (182), Expect = 1.309e-14
Identity = 46/148 (31.08%), Postives = 71/148 (47.97%), Query Frame = 3
Query: 1260 QLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIMLMNAVNFLAGYLLYIAY---TFTNLF---IYTVIFTSLLIALGLVLGFTINFFL---CKQALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISN 1676
            Q CH C+  +  RA HC  C+RCV +MDHHCP++ NC+G  N   F LF+  +         +L++      +  L    +Y +IF +  I L + +   +   L    K   +N T +E+   +K N  + +   F  PYN GW  N
Sbjct:   85 QFCHVCQGYKAPRAHHCSKCNRCVMKMDHHCPWINNCVGHYNMKSFTLFLFFVPLGCTHCAIILFLCLYNEVYLRLLPFDVYHLIFVTFCIGLSIGVTVAVGLLLYYQVKGIRINETAIESWIVEKANRPRPKGEVFVYPYNFGWKEN 232          
BLAST of Palmitoyltransferase vs. Ensembl Medaka
Match: zdhhc17 (zinc finger DHHC-type containing 17 [Source:NCBI gene;Acc:101171457])

HSP 1 Score: 138.272 bits (347), Expect = 2.632e-34
Identity = 131/536 (24.44%), Postives = 232/536 (43.28%), Query Frame = 3
Query:  312 TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIIN-CKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHP-ELSRMLVFYGLNCNQKDAFGQ-TPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVNKLSSFSRLKYKIIGAPNKNRF----PMIFLILCAFLWGNPYYYYVIRPCSINYA------QFTNLLFI-----------------VFQCLMWF--------------AFLMTAL-----------KDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWF--WLFIMLMNAVNFLAGYLLY------IAYTFTNLFIY-TVIFTSLLIALGLVLGFTINFF---------LCKQALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFNAR 1700
            TL+HWA ++  +D+V Y            +S  +I++    +L+ TPLHWA    +LS++  L+K G D +  D +  + + ++ Q+G+ S   YLI  G ++ + D  G   L WA Y+ H  + +R+L+ + ++ N  D + + T LH+A L+GN + I+ L++  N  ++  +   +TPL LA  RK   +  +L  Q  ++     S S LK   +    + +     P + + L  F+       ++I+  S+ YA      QF +  F                   +    WF               FL+ +L            DPG +   E+  +  + E+    +             +  C +C   + +R+KHC +C+RC+ + DHHCP+VGNC+G  N  +F  +LF +L      + G + Y        Y     ++Y T I +       + L    +F          L + A L +T  E    ++Y + +       +P+NHG   NL+ +F  R
Sbjct:   82 TLLHWAAINNRIDLVKYY-----------ISKGAIVDQLGGDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCIHLAAQFGHTSIVAYLIAKGQDVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVNLGDKYHKNTALHWAVLAGNTTVISLLLDA-NANVDAQNIKGETPLDLAKQRKNVWMINHL--QEARQAKGYDSPSYLKRLKMDKEFRQKVMLGTPFVVVWLVGFIADLDIDSWLIK--SVMYAGVWVAVQFLSKAFFDHSMHSALPLGIYLATKFWMYATWFYWFWNDLPFATVHVPFLINSLVLFYNFGKSWKSDPGIIKASEEQKKKTIVELAETGSL----------DLSIFCSTCLIRKPVRSKHCAVCNRCIAKFDHHCPWVGNCVGSGNHRYFMAYLFFLLCMICWMIYGCISYWRVHCATTYAKDGFWLYLTQIASCSPWIFWMFLNSIFHFMWVAVLIMCQLYQIAALGITTNERMNARRYKHFKVTATSIESPFNHGCFRNLVDFFEIR 591          

HSP 2 Score: 65.4698 bits (158), Expect = 9.775e-11
Identity = 48/146 (32.88%), Postives = 70/146 (47.95%), Query Frame = 3
Query:  495 LVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGD---NALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVN 923
            LV+ G D+   D +NVT L  +     I    Y I  GA   +  + GD     LHWA  +GH  +   L+ YG + +  D  G + +H A+  G+ S +A L+ K   ++++ D N  TPLM AA R + V    L    N  VN
Sbjct:   66 LVEAGFDVRQPDKENVTLLHWAAINNRIDLVKYYISKGA--IVDQLGGDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCIHLAAQFGHTSIVAYLIAKGQ-DVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVN 208          
BLAST of Palmitoyltransferase vs. Ensembl Medaka
Match: zdhhc13 (zinc finger DHHC-type containing 13 [Source:NCBI gene;Acc:101157520])

HSP 1 Score: 98.5969 bits (244), Expect = 3.128e-21
Identity = 122/552 (22.10%), Postives = 213/552 (38.59%), Query Frame = 3
Query:  312 TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIIN-CKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYK-GHPELSRMLVFYGLNCNQKDAFGQ-TPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVNKLSSFSRLKYKIIGAPNKNRF-PMIFLILCAFLWGNPYYYY-----------VIRPCSINYAQFTNLLFIV--FQCL------------------MWFA----------------------FLMTALKDPGFMVCDEKTYE---TVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIM-----------------------------LMNAVNFLAGYLLYIAYTFTNLFIYTVIFTSLLIALGLVLGFTINFFLCKQALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFNAR 1700
            TL+HWA ++   ++V Y            +S  +II+    +L+ TPLHWA    +L ++  L++ G D +  D +    L ++  + +++ A YL+  G  +   D  G   L  A  K   PE +  L+    + +  D   + TPLH A L+GN+     L+E     +   +    TP+ LA      ++   L +   +R+   S  +R+          NR+   + L+ C  ++G+    +           ++  C I  +Q  +  F    FQ L                  +WF                       ++ T   DPGF+   E+  +    VL E   LD                 C SC   + +RA HC  CD CV + DHH  ++  CIG RN  +F LF++                             L +A + L G   ++   F  L +Y   +++L++ + L   + I F     A +     + ++++    L+       NP+N G + NL+ +F  R
Sbjct:  164 TLLHWAAINNRTELVKYY-----------ISKGAIIDQLGGDLNSTPLHWAIRQGHLPMVIQLMRYGADPSISDGEGYRGLHLAILFQHMAVAAYLMAKGQEVDGPDCNGQTPLMLAAQKIIGPEPTNFLIKNNASVSAVDKVNRNTPLHCAVLAGNVDAAHVLLEA-GASVEAENIKGHTPIDLAHQVHSPLLIHILNHVKQERIRSNSRCARI---------VNRYRAFLHLLYCIAVFGSVGAIFDLNSESWLLKAILLACVIGVSQLISRTFQSSNFQSLLPASALMASVFWMLVTWCLWFLPDGLSSTVQILFTLSATALLYYYIRTCRTDPGFIRTTEEKKKMNVVVLAEAGFLDP-------------RVFCTSCMVRKPLRANHCFSCDACVAKQDHHSAWLNTCIGARNHHFFILFLLSLVLTGCWMLFGCVSYWSTHCSLHYEDQGLWSAASALFGCSPWVLAIFL-LSLYHTCWSTLVLMIQL---YQIAFLGITSAEIPTLRFQQRKFRPSASLKQ------NPFNMGVVQNLVSFFQLR 671          
BLAST of Palmitoyltransferase vs. Ensembl Medaka
Match: zdhhc13 (zinc finger DHHC-type containing 13 [Source:NCBI gene;Acc:101157520])

HSP 1 Score: 97.4413 bits (241), Expect = 6.587e-21
Identity = 122/552 (22.10%), Postives = 213/552 (38.59%), Query Frame = 3
Query:  312 TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIIN-CKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYK-GHPELSRMLVFYGLNCNQKDAFGQ-TPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVNKLSSFSRLKYKIIGAPNKNRF-PMIFLILCAFLWGNPYYYY-----------VIRPCSINYAQFTNLLFIV--FQCL------------------MWFA----------------------FLMTALKDPGFMVCDEKTYE---TVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIM-----------------------------LMNAVNFLAGYLLYIAYTFTNLFIYTVIFTSLLIALGLVLGFTINFFLCKQALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFNAR 1700
            TL+HWA ++   ++V Y            +S  +II+    +L+ TPLHWA    +L ++  L++ G D +  D +    L ++  + +++ A YL+  G  +   D  G   L  A  K   PE +  L+    + +  D   + TPLH A L+GN+     L+E     +   +    TP+ LA      ++   L +   +R+   S  +R+          NR+   + L+ C  ++G+    +           ++  C I  +Q  +  F    FQ L                  +WF                       ++ T   DPGF+   E+  +    VL E   LD                 C SC   + +RA HC  CD CV + DHH  ++  CIG RN  +F LF++                             L +A + L G   ++   F  L +Y   +++L++ + L   + I F     A +     + ++++    L+       NP+N G + NL+ +F  R
Sbjct:  108 TLLHWAAINNRTELVKYY-----------ISKGAIIDQLGGDLNSTPLHWAIRQGHLPMVIQLMRYGADPSISDGEGYRGLHLAILFQHMAVAAYLMAKGQEVDGPDCNGQTPLMLAAQKIIGPEPTNFLIKNNASVSAVDKVNRNTPLHCAVLAGNVDAAHVLLEA-GASVEAENIKGHTPIDLAHQVHSPLLIHILNHVKQERIRSNSRCARI---------VNRYRAFLHLLYCIAVFGSVGAIFDLNSESWLLKAILLACVIGVSQLISRTFQSSNFQSLLPASALMASVFWMLVTWCLWFLPDGLSSTVQILFTLSATALLYYYIRTCRTDPGFIRTTEEKKKMNVVVLAEAGFLDP-------------RVFCTSCMVRKPLRANHCFSCDACVAKQDHHSAWLNTCIGARNHHFFILFLLSLVLTGCWMLFGCVSYWSTHCSLHYEDQGLWSAASALFGCSPWVLAIFL-LSLYHTCWSTLVLMIQL---YQIAFLGITSAEIPTLRFQQRKFRPSASLKQ------NPFNMGVVQNLVSFFQLR 615          
BLAST of Palmitoyltransferase vs. Ensembl Medaka
Match: invs (inversin [Source:NCBI gene;Acc:101168237])

HSP 1 Score: 96.2857 bits (238), Expect = 2.604e-20
Identity = 61/183 (33.33%), Postives = 98/183 (53.55%), Query Frame = 3
Query:  306 GDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSI-INCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPL 851
            G T   WA   G+ D++  +  +  N        P I IN  ++   T LH A    ++S +Q L+++G  ++A D    TPL  +C+ G+    L LI   A + L DV+G  ALHWA   G+ E+ +ML+  G++ N +D  G+TPL  A+  G I+C+A L+E ++ + N+ D   +T L
Sbjct:  321 GRTAFMWASGKGSDDVICTM--LEHN--------PHIDINMADKYGGTALHAAALSGHVSTVQLLLEKGAMVDALDVMKHTPLFRACEMGHRDVILTLIKGSARVDLVDVDGHTALHWAALGGNAEVCQMLMENGISPNVQDHAGRTPLQCAAYGGYITCMAVLIE-NHADPNIQDKEGRTAL 492          

HSP 2 Score: 57.7658 bits (138), Expect = 3.064e-8
Identity = 54/234 (23.08%), Postives = 93/234 (39.74%), Query Frame = 3
Query:  318 MHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDN-----------------------------------ALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNIS------CIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYL 896
            +H A ++G  D  + +K+I            S+ + +++  +TPL +    + L   + L+K G  +N  D    + L ++ Q GN+     L+   AN    D+EG                                     ALHW+ +   PE  R+L+ +  N    D+ G+ PLH+A+ S   S      CI +    +++ LN  D   +TPL  A     + + E L
Sbjct:   17 VHAAAVNG--DRSALIKLI--------AGESSLRDHEDQFGRTPLMYCVLADRLDCAEILLKAGASVNKTDHSQRSALHLAAQKGNVRFLKLLLSRRANWLQKDLEGMTPLHLATRHPSPKALALLLKHIGPGEVDTQDKNKQTALHWSAFYNRPEHVRLLIKHDSNIGIPDSEGKIPLHWAAHSQEASATQTVRCILEAAPTESL-LNWQDYEGRTPLHFAVADGNQAVVEVL 239          

HSP 3 Score: 56.6102 bits (135), Expect = 5.937e-8
Identity = 42/159 (26.42%), Postives = 71/159 (44.65%), Query Frame = 3
Query:  408 PSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPL--IMSCQYGNISGALYLILNGANIFL----TDVEGDNALHWALYKGHPELSRMLVFY-GLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAA 863
            P  ++ +++  QT LHW+        ++ L+K   +I   D++   PL      Q  + +  +  IL  A         D EG   LH+A+  G+  +  +L  Y G N    D   +TPLH+A+L G+   +  L+E++       D+   TPL   A
Sbjct:  138 PGEVDTQDKNKQTALHWSAFYNRPEHVRLLIKHDSNIGIPDSEGKIPLHWAAHSQEASATQTVRCILEAAPTESLLNWQDYEGRTPLHFAVADGNQAVVEVLTSYEGCNVTAYDNLFRTPLHWAALLGHAKIVHLLLERNKSGTIPSDSQGATPLHYGA 296          

HSP 4 Score: 55.8398 bits (133), Expect = 1.002e-7
Identity = 57/233 (24.46%), Postives = 95/233 (40.77%), Query Frame = 3
Query:  300 STGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVK-EGCDINAKDTKNVTPLIMSCQYGNISGALYLIL--NGANIFLTDVEGDNALHWALY----------------KGHPELSRMLVFY-------------------GLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVI 884
            S G   +HWA  S        ++ I +          S++N ++   +TPLH+A    N +V++ L   EGC++ A D    TPL  +   G+    ++L+L  N +    +D +G   LH+                   K  P+L     F                     ++ N  D +G T LH A+LSG++S +  L+EK  + ++  D    TPL  A    +R +
Sbjct:  179 SEGKIPLHWAAHSQEASATQTVRCILEA-----APTESLLNWQDYEGRTPLHFAVADGNQAVVEVLTSYEGCNVTAYDNLFRTPLHWAALLGHAK-IVHLLLERNKSGTIPSDSQGATPLHYGAQSNNAETVGVFLSHPSVKDEPDLEGRTAFMWASGKGSDDVICTMLEHNPHIDINMADKYGGTALHAAALSGHVSTVQLLLEKGAM-VDALDVMKHTPLFRACEMGHRDV 404          

HSP 5 Score: 54.6842 bits (130), Expect = 2.667e-7
Identity = 52/192 (27.08%), Postives = 81/192 (42.19%), Query Frame = 3
Query:  312 TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKE--GCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRML--VFYGLNC----NQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAA 863
            + +H A   GN   V +LK++     N    W      K+    TPLH A    +   +  L+K     +++ +D    T L  S  Y        LI + +NI + D EG   LHWA +      ++ +  +          N +D  G+TPLHFA   GN + +  L   +   +  +DN  +TPL  AA
Sbjct:   82 SALHLAAQKGN---VRFLKLLLSRRAN----WLQ----KDLEGMTPLHLATRHPSPKALALLLKHIGPGEVDTQDKNKQTALHWSAFYNRPEHVRLLIKHDSNIGIPDSEGKIPLHWAAHSQEASATQTVRCILEAAPTESLLNWQDYEGRTPLHFAVADGNQAVVEVLTSYEGCNVTAYDNLFRTPLHWAA 262          
BLAST of Palmitoyltransferase vs. Ensembl Medaka
Match: ENSORLT00000038944.1 (tankyrase-1 [Source:NCBI gene;Acc:101158122])

HSP 1 Score: 92.0485 bits (227), Expect = 5.844e-19
Identity = 89/368 (24.18%), Postives = 147/368 (39.95%), Query Frame = 3
Query:    3 LILI*FDFPVAYKIALFC*IMNSVFQSINDIITLTFKSLGLINLELEDNKIFIPPSEKCIKSESNTLGDLLEIIKSGKKELLFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDT-----------------------------NSNVSW-------------------PSIINCKN--ELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHF--------------------ASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYL 896
            L +I F  P  ++ AL C  + S       +  L  +    +N   E NK F+ P     +   N   D++E+            L+  G+++  +   + G T +H A L+G+L     L + Y  D                              NS+V +                   P  +NC++    H TPLH+A     +SV+++L+  G D++AKD   + PL  +C YG+   A  L+ +GA++ + D+     LH A  KG  E+ ++L+ +G +  +K+  G TPL                      A+  G ++ +  L   DN+        N TPL LAAG     + EYL
Sbjct:  458 LEIINFKHPHTHETALHC-AVASPHPKRKQVTELLLRKGANVN---EKNKDFMTPLHVAAERAHN---DIMEV------------LQKHGAKV--NALDTLGQTALHRAALAGHLQTCRLL-LGYGADASLVSLQGFTAAQMGNEAVQQILNESVPVRNSDVDYRLLEAAKAGDLDTIKSLCTPQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAALLDAAKKGCLARVQKLCSPDNINCRDTQGRNSTPLHLAAGYNNLEVAEYL 803          

HSP 2 Score: 72.7886 bits (177), Expect = 7.202e-13
Identity = 44/135 (32.59%), Postives = 68/135 (50.37%), Query Frame = 3
Query:  408 PSIINCKNEL--HQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKD 806
            P  INC++    + TPLH A    NL V ++L++ G D+NA+D   + PL  +  YG++  A  LI     +  TD      LH A  KG  +L  +L+ +G +   K+  GQTPL  A+     + + D +  D
Sbjct:  772 PDNINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLATADDIRALLIDAMPPD 906          

HSP 3 Score: 57.7658 bits (138), Expect = 3.179e-8
Identity = 36/120 (30.00%), Postives = 58/120 (48.33%), Query Frame = 3
Query:  408 PSIINC--KNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYG-----LNCNQKDAFGQTP 746
            P  +NC   +    TPLH A     + ++Q L++ G D++AKD   + PL  +C YG+      L+ +GA +   D+     LH A  K   E+  +L+ +G     LNC+ K +    P
Sbjct:  304 PLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLLNCHSKSSVDMAP 423          

HSP 4 Score: 56.225 bits (134), Expect = 9.356e-8
Identity = 45/174 (25.86%), Postives = 77/174 (44.25%), Query Frame = 3
Query:  444 TPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHF--------------------ASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAG-RKYRVITEYLKY 902
            TPLH+A       V+  L++ G +++A+D   + PL  +C +G+      L+  GA     D      LH A  KG  ++  +L+ +G + N ++  G++ L                      A+ SGN   +  L+   NV  +  D    TPL LAAG  + R++   L++
Sbjct:  165 TPLHFAAGFGRKDVVDHLLQMGANVHARDDGGLIPLHNACSFGHSEVVSLLLCQGAEPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLAEPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQH 338          
BLAST of Palmitoyltransferase vs. Planmine SMEST
Match: SMESG000006491.1 (SMESG000006491.1)

HSP 1 Score: 1124.77 bits (2908), Expect = 0.000e+0
Identity = 547/547 (100.00%), Postives = 547/547 (100.00%), Query Frame = 3
Query:   63 MNSVFQSINDIITLTFKSLGLINLELEDNKIFIPPSEKCIKSESNTLGDLLEIIKSGKKELLFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVNKLSSFSRLKYKIIGAPNKNRFPMIFLILCAFLWGNPYYYYVIRPCSINYAQFTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIMLMNAVNFLAGYLLYIAYTFTNLFIYTVIFTSLLIALGLVLGFTINFFLCKQALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFNARN 1703
            MNSVFQSINDIITLTFKSLGLINLELEDNKIFIPPSEKCIKSESNTLGDLLEIIKSGKKELLFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVNKLSSFSRLKYKIIGAPNKNRFPMIFLILCAFLWGNPYYYYVIRPCSINYAQFTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIMLMNAVNFLAGYLLYIAYTFTNLFIYTVIFTSLLIALGLVLGFTINFFLCKQALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFNARN
Sbjct:    1 MNSVFQSINDIITLTFKSLGLINLELEDNKIFIPPSEKCIKSESNTLGDLLEIIKSGKKELLFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVNKLSSFSRLKYKIIGAPNKNRFPMIFLILCAFLWGNPYYYYVIRPCSINYAQFTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIMLMNAVNFLAGYLLYIAYTFTNLFIYTVIFTSLLIALGLVLGFTINFFLCKQALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFNARN 547          
BLAST of Palmitoyltransferase vs. Planmine SMEST
Match: SMESG000051358.1 (SMESG000051358.1)

HSP 1 Score: 197.593 bits (501), Expect = 2.643e-56
Identity = 136/472 (28.81%), Postives = 229/472 (48.52%), Query Frame = 3
Query:  294 FPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVNKLSSFSRLKYKIIGAPNKNRFPMIFLILCAFLWGNPYYYYVIRPCSINYAQFTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIML----MNAVNFLAGYLLYIAYTFTNLFIYTVIFTSLLIALGLVLGFTINFFLCKQALLNLTLVEAQRWKK--YNYLQNEDGKFFNPYNHGWISNLIYYF 1691
            F   G TL+HWA   GN   V YL    KN  N     P +++  +E  Q  +H+A    ++  I+ L++ G  I + D    TPL +S  YG I  +++L+  GA++   D+ G++++H+A   G+ +L ++L++ G++ + K+ FG+TP H A   G+   +  L+  +   +   DN        A      V  E+L+ +  K  + + +F+     ++     +++P++ +I   + W  P Y   I   +       N L IV   +           +P ++    K Y+  L  + L    RN    +    F++LCH+C+ VR +RA HC IC RCV   DHHCPYV NCIG RNR +F LF++     ++   F AG + +          Y  +   L++  G V      F     A  N+T  E+ +W+K  Y YL+ ++G+F NP++ GW+ N + YF
Sbjct:   32 FDENGRTLLHWAAFLGNNAAVIYL---LKNGAN-----PLMVSENDENFQA-IHFAAVNNHVKCIETLLEFGVSIESCDMYRRTPLNISAFYGRIIASMFLLSRGADLNHQDMNGNHSIHFASLSGNSDLCQILLYSGVDIHIKNDFGETPFHLACRKGSKRLLKSLMRNERKLITQTDNKGINAFGHAKFNHNSVGLEFLRRESKK--SNVVNFNFKTTDLMYGRGGSKYPLMLVIFLIYFWAIPVYIKNILYLTYFDWPILNWLLIVDGIIFTLNLYAVNSIEPSYLPRYTKEYDETLKNVSL----RNQNENEILEIFSRLCHTCRTVRPLRASHCGICRRCVKHKDHHCPYVYNCIGFRNRQYFLLFLITVWIGLSLGIFFAGLIYFQYGYQYYFHEYFGL-GFLVLFYGFVTAMI--FGTLANAFRNITTNESLKWQKFGYEYLRTKNGQFTNPFDKGWLLNFLEYF 485          
BLAST of Palmitoyltransferase vs. Planmine SMEST
Match: SMESG000062442.1 (SMESG000062442.1)

HSP 1 Score: 120.939 bits (302), Expect = 1.276e-28
Identity = 108/420 (25.71%), Postives = 176/420 (41.90%), Query Frame = 3
Query:  312 TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGH-PELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEK-------DNVELNVHDNNNKTPLMLAAGRKYRVITEY-LKYQINKRVNKLSSFSRLKYKIIGAPNKNRFPMIFLIL------------------------------------------CAFLWGNPYYYYVIRPCSINYAQFTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIMLM 1418
            +L+HWA ++   +IV+Y         N +V          +L  TPLHWA     L +   L+K G + N  D + ++ + +S Q        YL+  G N+   D+ G   L WA  +   P+  R+L+ +G N N +D  G T  H+A+ SGN   +  L          +N  + V     K  +   A +   ++ E  LK   N  VN  S   + ++ I+       F +I L+L                                          C   +    Y +++ P +     F N+ F+V    +WF F+  A  DPG++  +    + V   + +  N  +VK+       N+ C +C   + +R+KHC ICDRCV + DHHCP+V NCIG  N   F L+++ +
Sbjct:   61 SLLHWAAINNRNEIVNYY---LSKGANIDV-------IGGDLKSTPLHWAVRQGLLDMTALLLKNGANPNIFDGQGLSCIHVSSQLAYTHIVSYLLAYGINVDFRDLNGMTPLMWAAARSTGPDPIRLLITWGANVNIQDINGFTAGHYAAQSGNFIAMKQLNAASIDWFLINNEGITVQQILQKRNMTWMANKLEELMIERGLKSHRNFFVNLTSRNKKFRFSIMVLTPILSFLIIGLVLHFTISYWMKLATLVLLIALIRFGLASFVDERAQILSMFSLATCTTFFLCFTYIWLLIPYN---GPFINISFVVSITCLWFHFIKCARMDPGYIKINST--DRVEAILSMASNDPSVKV-----ALNRFCTTCLIRKPLRSKHCSICDRCVSKFDHHCPWVYNCIGVNNISNFILYLLAL 460          
BLAST of Palmitoyltransferase vs. Planmine SMEST
Match: SMESG000062450.1 (SMESG000062450.1)

HSP 1 Score: 111.309 bits (277), Expect = 1.750e-25
Identity = 130/543 (23.94%), Postives = 219/543 (40.33%), Query Frame = 3
Query:  312 TLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGH-PELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEK-------DNVELNVHDNNNKTPLMLAAGRKYRVITEY-LKYQINKRVNKLSSFSRLKYKIIGAPNKNRFPMIFLIL------------------------------------------CAFLWGNPYYYYVIRPCSINYAQFTNLLFIVFQCLMWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQLCHSCKCVRLIRAKHCRICDRCVDEMDHHCPY----VGNCIGKRNRVWFWLFIMLMNAVNFLAGYLLY------IAYTFTNLFIYTVIFTSLLIALGLVLGFTINFFLCK--QA-LLNLTLVEAQRWKKYNY----LQNEDGKFFN------------PYNHGWISNLIYYFNAR 1700
            +L+HWA ++   +IV+Y         N +V          +L  TPLHWA     L +   L+K G + N  D + ++ + +S Q        YL+  G N+   D+ G   L WA  +   P+  R+L+ +G N N +D  G T  H+A+ SGN   +  L          +N  + V     K  +   A +   ++ E  LK   N  VN  S   + ++ I+       F +I L+L                                          C   +    Y +++ P +     F N+ F+V    +WF F+  A  DPG++  +    + V   + +  N  +VK+       N+ C +C   + +R+KHC ICDRCV + DHHCP+    + +C       +  +F++      F+AG ++       I    T  F     F++  +A     GF++   +C+  QA ++N T  E   W +Y +    ++N   K  N            PYN G I N+   F ++
Sbjct:   61 SLLHWAAINNRNEIVNYY---LSKGANIDV-------IGGDLKSTPLHWAVRQGLLDMTALLLKNGANPNIFDGQGLSCIHVSSQLAYTHIVSYLLAYGINVDFRDLNGMTPLMWAAARSTGPDPIRLLITWGANVNIQDINGFTAGHYAAQSGNFIAMKQLNAASIDWFLINNEGITVQQILQKRNMTWMANKLEELMIERGLKSHRNFFVNLTSRNKKFRFSIMVLTPILSFLIIGLVLHFTISYWMKLATLVLLIALIRFGLASFVDERAQILSMFSLATCTTFFLCFTYIWLLIPYN---GPFINISFVVSITCLWFHFIKCARMDPGYIKINST--DRVEAILSMASNDPSVKV-----ALNRFCTTCLIRKPLRSKHCSICDRCVSKFDHHCPWPLFHLYHC------TYMGVFVI---HCTFIAGIVMIRLDWHCINMLLTQPFYIRGYFSAFSMAAFTYFGFSM-LLICQLYQAFVVNQTTNERINWNRYTFADKPMENCSHKHSNPDENCLQKHNSSPYNMGLIKNIQDTFRSK 573          
BLAST of Palmitoyltransferase vs. Planmine SMEST
Match: SMESG000063648.1 (SMESG000063648.1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.260e-18
Identity = 65/222 (29.28%), Postives = 110/222 (49.55%), Query Frame = 3
Query:  249 FEKLKN---SGSEILYDVFPSTGDTLMHWACLSGNLDIVSYLKVIYKNDTNSNVSWPSI-INCKNELHQTPLHWACTIENLSVIQFLVKEGCDINAKDTKNV-TPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWALYKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNVELNVHDNNNKTPLMLAAGRKYRVITEYLK 899
            F+K+K    +G  ++ D     G + +H A  +G L+I+ YL            ++P   +N  +    TPLH A +I  + +IQ L++ G  +N +D+ ++ TPL ++ Q G+      LI  GA+I   +  GD  LH  +  GH  +SR+L+    + NQ++  G T LH A+          LVE     +++ +  N+TPL +A  + +  I E LK
Sbjct:   66 FDKVKEFIRAGHNLIID---KDGKSPIHIAAENGQLEILKYLLQ----------AFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVE-SGASIDIRNIQNETPLDVALKKSHSEIIEILK 273          
The following BLAST results are available for this feature:
BLAST of Palmitoyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZDHHC175.714e-3423.82zinc finger DHHC-type containing 17 [Source:HGNC S... [more]
ZDHHC133.461e-2623.69zinc finger DHHC-type containing 13 [Source:HGNC S... [more]
ANKRD442.627e-2031.19ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:H... [more]
ANKRD445.480e-2031.19ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:H... [more]
ANKRD441.545e-1931.19ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhhc-147.558e-2322.28Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
dhhc-138.436e-1622.33Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
dhhc-73.055e-1532.14Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
dhhc-78.332e-1527.05Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
dhhc-31.047e-1433.33Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Patsas4.782e-10034.59gene:FBgn0029137 transcript:FBtr0080362[more]
Patsas8.240e-10034.59gene:FBgn0029137 transcript:FBtr0474167[more]
Patsas1.862e-9934.59gene:FBgn0029137 transcript:FBtr0474166[more]
Hip147.711e-3525.52gene:FBgn0259824 transcript:FBtr0075518[more]
Hip147.711e-3525.52gene:FBgn0259824 transcript:FBtr0333577[more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zdhhc172.458e-3725.39zinc finger DHHC-type containing 17 [Source:ZFIN;A... [more]
zdhhc135.549e-2624.40zinc finger DHHC-type containing 13 [Source:ZFIN;A... [more]
ankrd52a3.077e-2131.96ankyrin repeat domain 52a [Source:NCBI gene;Acc:55... [more]
ankrd52a3.455e-2131.96ankyrin repeat domain 52a [Source:NCBI gene;Acc:55... [more]
invs8.775e-2031.32inversin [Source:NCBI gene;Acc:245946][more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000038057.13.347e-10135.32probable protein S-acyltransferase 23 [Source:NCBI... [more]
ZDHHC178.859e-3625.35zinc finger DHHC-type containing 17 [Source:NCBI g... [more]
ZDHHC173.289e-3423.58zinc finger DHHC-type containing 17 [Source:NCBI g... [more]
ZDHHC174.685e-3423.58zinc finger DHHC-type containing 17 [Source:NCBI g... [more]
ZDHHC175.748e-3423.58zinc finger DHHC-type containing 17 [Source:NCBI g... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zdhhc179.432e-3423.82zinc finger, DHHC domain containing 17 [Source:MGI... [more]
Zdhhc137.549e-2823.93zinc finger, DHHC domain containing 13 [Source:MGI... [more]
Ankrd231.061e-2031.43ankyrin repeat domain 23 [Source:MGI Symbol;Acc:MG... [more]
Ankrd441.467e-2031.68ankyrin repeat domain 44 [Source:MGI Symbol;Acc:MG... [more]
Ankrd441.517e-2031.68ankyrin repeat domain 44 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Palmitoyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3EC11|ZDHC2_ARATH3.231e-5727.08Probable protein S-acyltransferase 23 OS=Arabidops... [more]
sp|Q52T38|ZDH22_ARATH6.485e-4425.74Protein S-acyltransferase 24 OS=Arabidopsis thalia... [more]
sp|Q8T2Q0|ZDHC6_DICDI9.427e-3626.02Putative ZDHHC-type palmitoyltransferase 6 OS=Dict... [more]
sp|Q9VUW9|HIP14_DROME7.729e-3425.52Palmitoyltransferase Hip14 OS=Drosophila melanogas... [more]
sp|Q8IUH5|ZDH17_HUMAN2.744e-3323.82Palmitoyltransferase ZDHHC17 OS=Homo sapiens OX=96... [more]
back to top
BLAST of Palmitoyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H9N41.696e-12139.33Palmitoyltransferase (Fragment) OS=Macrostomum lig... [more]
A0A267DE561.696e-12139.33Palmitoyltransferase (Fragment) OS=Macrostomum lig... [more]
A0A210QC191.264e-10735.10Palmitoyltransferase OS=Mizuhopecten yessoensis OX... [more]
A0A151IF402.474e-10633.78Palmitoyltransferase OS=Cyphomyrmex costatus OX=45... [more]
A0A2C9JLV23.131e-10638.07Palmitoyltransferase OS=Biomphalaria glabrata OX=6... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zdhhc176.798e-3925.35zinc finger DHHC-type containing 17 [Source:NCBI g... [more]
zdhhc173.982e-3725.22zinc finger DHHC-type containing 17 [Source:NCBI g... [more]
zdhhc175.476e-3725.17zinc finger DHHC-type containing 17 [Source:NCBI g... [more]
zdhhc172.468e-3625.36zinc finger DHHC-type containing 17 [Source:NCBI g... [more]
zdhhc132.230e-2423.30zinc finger DHHC-type containing 13 [Source:NCBI g... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004672.12.320e-2921.96pep scaffold:Pmarinus_7.0:GL477315:17052:39954:-1 ... [more]
ENSPMAT00000003991.12.414e-1830.54pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
ENSPMAT00000009608.17.486e-1829.53pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 ... [more]
zdhhc133.950e-1720.98zinc finger DHHC-type containing 13 [Source:ZFIN;A... [more]
ENSPMAT00000007449.17.807e-1733.77pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AKR17.879e-2222.88Palmitoyl transferase involved in protein palmitoy... [more]
SWF12.737e-1151.02Palmitoyltransferase that acts on transmembrane pr... [more]
AKR23.838e-1120.97Ankyrin repeat-containing protein; member of a fam... [more]
ERF21.075e-1028.79Subunit of a palmitoyltransferase; this complex ad... [more]
NAS61.224e-1028.16Evolutionarily conserved 19S regulatory particle a... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO431611.687e-2225.68Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
EDO387251.403e-1728.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO442981.730e-1526.21Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
EDO385961.816e-1534.00Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
EDO463191.309e-1431.08Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zdhhc172.632e-3424.44zinc finger DHHC-type containing 17 [Source:NCBI g... [more]
zdhhc133.128e-2122.10zinc finger DHHC-type containing 13 [Source:NCBI g... [more]
zdhhc136.587e-2122.10zinc finger DHHC-type containing 13 [Source:NCBI g... [more]
invs2.604e-2033.33inversin [Source:NCBI gene;Acc:101168237][more]
ENSORLT00000038944.15.844e-1924.18tankyrase-1 [Source:NCBI gene;Acc:101158122][more]
back to top
BLAST of Palmitoyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006491.10.000e+0100.00SMESG000006491.1[more]
SMESG000051358.12.643e-5628.81SMESG000051358.1[more]
SMESG000062442.11.276e-2825.71SMESG000062442.1[more]
SMESG000062450.11.750e-2523.94SMESG000062450.1[more]
SMESG000063648.11.260e-1829.28SMESG000063648.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020616 ID=SMED30020616|Name=Palmitoyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1726bp
TGCTAATCTTAATTTAGTTTGATTTTCCAGTTGCGTATAAAATAGCACTA
TTTTGTTAAATAATGAATTCTGTCTTTCAATCCATAAATGATATCATTAC
TTTGACTTTTAAAAGTCTGGGACTTATTAATTTAGAGTTAGAAGATAATA
AAATATTTATTCCACCAAGTGAAAAGTGCATTAAATCTGAATCTAATACA
TTGGGAGATTTATTAGAAATTATAAAATCTGGTAAAAAGGAACTACTTTT
TGAAAAGTTAAAGAATTCTGGTAGTGAAATATTGTATGATGTTTTTCCTT
CTACTGGTGATACGTTGATGCATTGGGCTTGTCTTAGTGGAAATTTAGAT
ATTGTTTCTTATTTAAAAGTTATTTATAAAAATGATACAAATTCAAATGT
TTCATGGCCATCTATAATCAACTGTAAAAATGAATTACACCAAACTCCTT
TACATTGGGCGTGTACAATTGAAAACCTTAGTGTTATTCAATTTTTAGTT
AAAGAAGGTTGTGATATAAATGCTAAAGATACTAAAAATGTTACTCCACT
AATTATGTCCTGTCAGTATGGAAATATTTCTGGTGCTTTATATTTAATTT
TAAATGGAGCGAATATATTTTTGACAGATGTAGAAGGTGATAACGCCTTA
CACTGGGCACTTTATAAAGGGCATCCGGAATTATCTCGTATGTTAGTATT
CTATGGGTTAAATTGTAATCAAAAAGACGCATTTGGTCAAACTCCATTGC
ATTTTGCTAGTTTGTCTGGAAATATCAGTTGTATAGCCGATTTGGTTGAA
AAAGATAATGTTGAACTCAACGTGCACGATAACAACAACAAAACCCCATT
GATGTTAGCAGCCGGTAGAAAGTATAGAGTGATTACTGAATACCTGAAAT
ATCAAATTAATAAGCGTGTTAATAAATTGTCTTCATTTAGTCGATTAAAA
TACAAGATAATAGGAGCTCCGAATAAAAATAGATTTCCGATGATCTTTCT
GATTTTGTGTGCGTTTTTGTGGGGAAATCCATATTATTATTATGTGATTC
GTCCGTGTTCTATAAACTATGCGCAATTCACGAATCTATTATTTATTGTT
TTCCAATGTTTGATGTGGTTTGCATTTCTAATGACCGCTCTTAAAGATCC
GGGATTCATGGTATGTGATGAAAAAACCTATGAAACTGTGCTCAATGAAA
TAAAATTATTGGACAATTTCCGAAATGTGAAAATTAGAGATTATAAAAAT
CCATTTAATCAATTGTGTCATAGTTGCAAATGCGTTCGATTAATTCGTGC
TAAGCACTGTAGAATATGTGACAGGTGTGTTGATGAGATGGATCATCATT
GTCCGTATGTAGGCAATTGTATCGGCAAACGCAATAGAGTTTGGTTTTGG
CTGTTTATCATGTTAATGAATGCTGTCAATTTCCTGGCTGGCTACTTGTT
ATACATTGCATATACATTTACAAATTTATTCATTTATACTGTAATTTTCA
CTTCATTATTGATTGCTCTTGGACTTGTCTTAGGATTTACTATTAATTTT
TTTCTGTGTAAACAAGCCCTGCTCAATTTGACTTTAGTTGAAGCTCAGAG
GTGGAAAAAATATAATTATTTACAAAATGAAGATGGAAAGTTTTTCAATC
CTTATAATCACGGATGGATTTCTAACTTGATTTATTATTTCAATGCTAGA
AATTAATTTTCTTTTGACTTGTTATT
back to top

protein sequence of SMED30020616-orf-1

>SMED30020616-orf-1 ID=SMED30020616-orf-1|Name=SMED30020616-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=548bp
MNSVFQSINDIITLTFKSLGLINLELEDNKIFIPPSEKCIKSESNTLGDL
LEIIKSGKKELLFEKLKNSGSEILYDVFPSTGDTLMHWACLSGNLDIVSY
LKVIYKNDTNSNVSWPSIINCKNELHQTPLHWACTIENLSVIQFLVKEGC
DINAKDTKNVTPLIMSCQYGNISGALYLILNGANIFLTDVEGDNALHWAL
YKGHPELSRMLVFYGLNCNQKDAFGQTPLHFASLSGNISCIADLVEKDNV
ELNVHDNNNKTPLMLAAGRKYRVITEYLKYQINKRVNKLSSFSRLKYKII
GAPNKNRFPMIFLILCAFLWGNPYYYYVIRPCSINYAQFTNLLFIVFQCL
MWFAFLMTALKDPGFMVCDEKTYETVLNEIKLLDNFRNVKIRDYKNPFNQ
LCHSCKCVRLIRAKHCRICDRCVDEMDHHCPYVGNCIGKRNRVWFWLFIM
LMNAVNFLAGYLLYIAYTFTNLFIYTVIFTSLLIALGLVLGFTINFFLCK
QALLNLTLVEAQRWKKYNYLQNEDGKFFNPYNHGWISNLIYYFNARN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016409palmitoyltransferase activity
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0016740transferase activity
GO:0016746transferase activity, transferring acyl groups
GO:0019706protein-cysteine S-palmitoyltransferase activity
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
IPR001594Palmitoyltrfase_DHHC
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatPRINTSPR01415ANKYRINcoord: 141..155
score: 31.8
coord: 82..97
score: 33.54
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 191..220
e-value: 0.0016
score: 27.7
coord: 224..254
e-value: 0.099
score: 21.7
coord: 125..154
e-value: 8.9E-4
score: 28.5
coord: 81..111
e-value: 1.3
score: 18.1
coord: 158..187
e-value: 1.5
score: 17.8
coord: 258..288
e-value: 550.0
score: 6.9
IPR002110Ankyrin repeatPFAMPF00023Ankcoord: 225..257
e-value: 9.3E-4
score: 19.5
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 191..223
score: 10.659
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 224..257
score: 10.579
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 125..157
score: 11.995
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 130..222
e-value: 3.7E-13
score: 49.9
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 81..278
score: 42.786
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 207..297
e-value: 2.4E-15
score: 58.5
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 37..206
e-value: 4.6E-30
score: 106.5
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 50..279
IPR001594Palmitoyltransferase, DHHC domainPFAMPF01529DHHCcoord: 397..500
e-value: 2.1E-20
score: 73.2
NoneNo IPR availablePANTHERPTHR24161:SF71coord: 45..539
NoneNo IPR availablePANTHERPTHR24161FAMILY NOT NAMEDcoord: 45..539
NoneNo IPR availablePROSITEPS50216DHHCcoord: 400..450
score: 22.648
NoneNo IPR availableTMHMMTMhelixcoord: 443..465
NoneNo IPR availableTMHMMTMhelixcoord: 342..359
NoneNo IPR availableTMHMMTMhelixcoord: 307..329
NoneNo IPR availableTMHMMTMhelixcoord: 472..494