prohibitin-1

Overview
Nameprohibitin-1 (AFJ24824.1)
Smed IDSMED30020615
Length (bp)989
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of prohibitin-1 (SMED30020615) t-SNE clustered cells

Violin plots show distribution of expression levels for prohibitin-1 (SMED30020615) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of prohibitin-1 (SMED30020615) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for prohibitin-1 (SMED30020615) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020615

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30020615SMESG000021272.1 SmedASXL_018897SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30020615SMESG000021272.1 SmedASXL_018897SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30020615SMESG000021272.1 dd_Smed_v4_1089_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30020615SMESG000021272.1 dd_Smed_v4_1089_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30020615SMESG000021272.1 dd_Smed_v4_1089_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020615SMESG000021272.1 dd_Smed_v4_1089_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020615SMESG000021272.1 dd_Smed_v4_1089_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30020615SMESG000021272.1 dd_Smed_v4_1089_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020615SMESG000021272.1 dd_Smed_v4_1089_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020615SMESG000021272.1 dd_Smed_v4_1089_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020615SMESG000021272.1 Contig39559newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020615SMESG000021272.1 Contig39559uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020615SMESG000049778.1 SMESG000048378.1 SMESG000039423.1 SMESG000024543.1 SMESG000022136.1 SMESG000021272.1 SMESG000002434.1 Contig13665newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020615SMESG000049778.1 SMESG000048378.1 SMESG000039423.1 SMESG000024543.1 SMESG000022136.1 SMESG000021272.1 SMESG000002434.1 Contig13665uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of prohibitin-1 vs. Ensembl Human
Match: PHB2 (prohibitin 2 [Source:HGNC Symbol;Acc:HGNC:30306])

HSP 1 Score: 350.903 bits (899), Expect = 7.608e-121
Identity = 168/261 (64.37%), Postives = 222/261 (85.06%), Query Frame = 1
Query:  148 KSFYTVDGGQRSIIFSRFGGIKEN-IYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGKRK 927
            +S +TV+GG R+I F+R GG++++ I AEGLH RIP  QYPII+D+R+RPR ISSPTGSKDLQMVNISLRVLSRP+  ++P +Y+ +G DY+E+VLPSI NEVLK+VVAKFNA QLITQR QVSLLIR+ L ERAKDF++I+DDV+IT+LSFSR+Y+ AVE KQ++QQEAQRAQF V +AKQE++QKIV AEGEA+AA ++G+AL+++ GY+KLRKI+AA+ I++T++TSQN+ YL A+ L+LNL ++SF  S   I  +K
Sbjct:   38 ESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRSDSLIKGKK 298          
BLAST of prohibitin-1 vs. Ensembl Human
Match: PHB2 (prohibitin 2 [Source:HGNC Symbol;Acc:HGNC:30306])

HSP 1 Score: 350.132 bits (897), Expect = 1.500e-120
Identity = 167/261 (63.98%), Postives = 222/261 (85.06%), Query Frame = 1
Query:  148 KSFYTVDGGQRSIIFSRFGGIKEN-IYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGKRK 927
            +S +TV+GG R+I F+R GG++++ I AEGLH RIP  QYPII+D+R+RPR ISSPTGSKDLQMVNISLRVLSRP+  ++P +Y+ +G DY+E+VLPSI NEVLK+VVAKFNA QLITQR QVSLLIR+ L ERAKDF++I+DDV+IT+LSFSR+Y+ AVE KQ++QQEAQRAQF V +AKQE++QKIV AEGEA+AA ++G+AL+++ GY+KLRKI+AA+ I++T++TSQN+ YL A+ L+LNL ++SF    + + K K
Sbjct:   38 ESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGK 298          
BLAST of prohibitin-1 vs. Ensembl Human
Match: PHB2 (prohibitin 2 [Source:HGNC Symbol;Acc:HGNC:30306])

HSP 1 Score: 320.472 bits (820), Expect = 2.414e-109
Identity = 152/226 (67.26%), Postives = 198/226 (87.61%), Query Frame = 1
Query:  148 KSFYTVDGGQRSIIFSRFGGIKEN-IYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIART 822
            +S +TV+GG R+I F+R GG++++ I AEGLH RIP  QYPII+D+R+RPR ISSPTGSKDLQMVNISLRVLSRP+  ++P +Y+ +G DY+E+VLPSI NEVLK+VVAKFNA QLITQR QVSLLIR+ L ERAKDF++I+DDV+IT+LSFSR+Y+ AVE KQ++QQEAQRAQF V +AKQE++QKIV AEGEA+AA ++G+AL+++ GY+KLRKI+AA+ I++T
Sbjct:   38 ESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKT 263          
BLAST of prohibitin-1 vs. Ensembl Human
Match: PHB2 (prohibitin 2 [Source:HGNC Symbol;Acc:HGNC:30306])

HSP 1 Score: 279.256 bits (713), Expect = 3.720e-93
Identity = 141/261 (54.02%), Postives = 188/261 (72.03%), Query Frame = 1
Query:  148 KSFYTVDGGQRSIIFSRFGGIKEN-IYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGKRK 927
            +S +TV+GG R+I F+R GG++++ I AEGLH RIP  QYPII+D+R+RPR ISSPTGSKDLQMVNISLRVLSRP+  ++P +Y+ +G DY+E+VLPSI NEVLK+VVAKFNA QLITQR QVSLLIR+ L ERAKDF++I+DDV+IT+LSFSR+Y+ AVE KQ+                                      AL+++ GY+KLRKI+AA+ I++T++TSQN+ YL A+ L+LNL ++SF    + + K K
Sbjct:   38 ESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQV--------------------------------------ALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGK 260          
BLAST of prohibitin-1 vs. Ensembl Human
Match: PHB (prohibitin [Source:HGNC Symbol;Acc:HGNC:8912])

HSP 1 Score: 263.848 bits (673), Expect = 5.870e-87
Identity = 129/248 (52.02%), Postives = 187/248 (75.40%), Query Frame = 1
Query:  142 MSKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDAL-TQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNAN-TLMLNL 879
            ++ + Y VD G R++IF RF G+++ +  EG H  IP +Q PIIFD RSRPR +   TGSKDLQ VNI+LR+L RP  +++P I+ +IGEDYDE+VLPSI+ E+LK+VVA+F+AG+LITQRE VS  +   L ERA  F +I+DDVS+T L+F ++++EAVE KQ++QQEA+RA+F V +A+Q+++  I++AEG+++AA LI ++L T   G ++LRK++AAE IA  LS S+N  YL A  +++L L
Sbjct:   23 VNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQL 270          
BLAST of prohibitin-1 vs. Ensembl Celegans
Match: phb-2 (Mitochondrial prohibitin complex protein 2 [Source:UniProtKB/Swiss-Prot;Acc:P50093])

HSP 1 Score: 331.257 bits (848), Expect = 1.648e-113
Identity = 156/249 (62.65%), Postives = 200/249 (80.32%), Query Frame = 1
Query:  148 KSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSF 894
            +S +TV+ G R+I+F+R GG+  ++Y EGLH RIP  QYPII+D+R+RP  I SPTGSKDLQMVNI LRVLSRP+   +  IYR +G++++E+VLPSI NEVLK VVAKFNA QLITQR+QVS+L+RK LIERA DFNII+DDVS+T+L+FS QYS AVE KQ++ QEAQRA F V RAKQ++Q+KIV AEGEA++A L+G+A+    G+LKLRKI+AA+KIAR +S S NK YL    LMLN+ +  +
Sbjct:   38 QSMFTVEAGHRAIMFNRIGGLSTDLYKEGLHFRIPWFQYPIIYDIRARPNQIRSPTGSKDLQMVNIGLRVLSRPNPEHLVHIYRTLGQNWEERVLPSICNEVLKGVVAKFNASQLITQRQQVSMLVRKTLIERALDFNIILDDVSLTELAFSPQYSAAVEAKQVAAQEAQRATFYVERAKQQKQEKIVQAEGEAESAKLLGEAMKNDPGFLKLRKIRAAQKIARIVSESGNKTYLPTGGLMLNIADTDY 286          
BLAST of prohibitin-1 vs. Ensembl Celegans
Match: phb-2 (Mitochondrial prohibitin complex protein 2 [Source:UniProtKB/Swiss-Prot;Acc:P50093])

HSP 1 Score: 331.257 bits (848), Expect = 1.648e-113
Identity = 156/249 (62.65%), Postives = 200/249 (80.32%), Query Frame = 1
Query:  148 KSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSF 894
            +S +TV+ G R+I+F+R GG+  ++Y EGLH RIP  QYPII+D+R+RP  I SPTGSKDLQMVNI LRVLSRP+   +  IYR +G++++E+VLPSI NEVLK VVAKFNA QLITQR+QVS+L+RK LIERA DFNII+DDVS+T+L+FS QYS AVE KQ++ QEAQRA F V RAKQ++Q+KIV AEGEA++A L+G+A+    G+LKLRKI+AA+KIAR +S S NK YL    LMLN+ +  +
Sbjct:   38 QSMFTVEAGHRAIMFNRIGGLSTDLYKEGLHFRIPWFQYPIIYDIRARPNQIRSPTGSKDLQMVNIGLRVLSRPNPEHLVHIYRTLGQNWEERVLPSICNEVLKGVVAKFNASQLITQRQQVSMLVRKTLIERALDFNIILDDVSLTELAFSPQYSAAVEAKQVAAQEAQRATFYVERAKQQKQEKIVQAEGEAESAKLLGEAMKNDPGFLKLRKIRAAQKIARIVSESGNKTYLPTGGLMLNIADTDY 286          
BLAST of prohibitin-1 vs. Ensembl Celegans
Match: phb-1 (Mitochondrial prohibitin complex protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9BKU4])

HSP 1 Score: 245.743 bits (626), Expect = 3.087e-80
Identity = 127/245 (51.84%), Postives = 179/245 (73.06%), Query Frame = 1
Query:  151 SFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSS-GYLKLRKIKAAEKIARTLSTSQNKAYLNAN-TLMLNL 879
            + Y VDGGQR++IF RF G+K  +  EG H  IP +Q PIIFD+RS PR +++ TGSKDLQ VNI+LR+L RP   ++P+IY NIG DY E+VLPSI+NEVLKAVVA+F+A ++ITQRE VS      L ERA  F +++DD++IT L+F R+++EAVE KQ++QQEA++A++ V +A+Q +   +  AEG+AQAA L+  A   +  G ++LRKI+AAE+IA  ++ ++N  YL  N   +LNL
Sbjct:   29 ALYNVDGGQRAVIFDRFSGVKNEVVGEGTHFLIPWVQKPIIFDIRSTPRAVTTITGSKDLQNVNITLRILHRPSPDRLPNIYLNIGLDYAERVLPSITNEVLKAVVAQFDAHEMITQREVVSQRASVALRERAAQFGLLLDDIAITHLNFGREFTEAVEMKQVAQQEAEKARYLVEKAEQMKIAAVTTAEGDAQAAKLLAKAFASAGDGLVELRKIEAAEEIAERMAKNKNVTYLPGNQQTLLNL 273          
BLAST of prohibitin-1 vs. Ensembl Fly
Match: Phb2 (gene:FBgn0010551 transcript:FBtr0086614)

HSP 1 Score: 372.474 bits (955), Expect = 1.100e-129
Identity = 174/261 (66.67%), Postives = 223/261 (85.44%), Query Frame = 1
Query:  145 SKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGKRK 927
            S+S YTV+GG R+IIFSR GGI+ +IY+EGLH+RIP  QYPII+D+RSRPR ISSPTGSKDLQM+NISLRVLSRPD   +P +++ +G DYDEKVLPSI NEVLK+V+AKFNA QLITQR+QVSLLIRK L+ERA+DFNII+DDVS+T+LSF ++Y+ A+E KQ++QQEAQRA F V RAKQE+QQKIV AEGEA+AA ++G A+ Q+  YLKLRK++AA+ IART+++SQNK YL+A++LMLN+ +  F++  E + K K
Sbjct:   39 SQSLYTVEGGHRAIIFSRLGGIQSDIYSEGLHVRIPWFQYPIIYDIRSRPRKISSPTGSKDLQMINISLRVLSRPDSLNLPYLHKQLGVDYDEKVLPSICNEVLKSVIAKFNASQLITQRQQVSLLIRKELVERARDFNIILDDVSLTELSFGKEYTAAIEAKQVAQQEAQRAVFFVERAKQEKQQKIVQAEGEAEAAKMLGLAVKQNPAYLKLRKLRAAQSIARTIASSQNKVYLSADSLMLNIQDSGFDDMTEKVYKSK 299          
BLAST of prohibitin-1 vs. Ensembl Fly
Match: Phb2 (gene:FBgn0010551 transcript:FBtr0086615)

HSP 1 Score: 372.474 bits (955), Expect = 1.100e-129
Identity = 174/261 (66.67%), Postives = 223/261 (85.44%), Query Frame = 1
Query:  145 SKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGKRK 927
            S+S YTV+GG R+IIFSR GGI+ +IY+EGLH+RIP  QYPII+D+RSRPR ISSPTGSKDLQM+NISLRVLSRPD   +P +++ +G DYDEKVLPSI NEVLK+V+AKFNA QLITQR+QVSLLIRK L+ERA+DFNII+DDVS+T+LSF ++Y+ A+E KQ++QQEAQRA F V RAKQE+QQKIV AEGEA+AA ++G A+ Q+  YLKLRK++AA+ IART+++SQNK YL+A++LMLN+ +  F++  E + K K
Sbjct:   39 SQSLYTVEGGHRAIIFSRLGGIQSDIYSEGLHVRIPWFQYPIIYDIRSRPRKISSPTGSKDLQMINISLRVLSRPDSLNLPYLHKQLGVDYDEKVLPSICNEVLKSVIAKFNASQLITQRQQVSLLIRKELVERARDFNIILDDVSLTELSFGKEYTAAIEAKQVAQQEAQRAVFFVERAKQEKQQKIVQAEGEAEAAKMLGLAVKQNPAYLKLRKLRAAQSIARTIASSQNKVYLSADSLMLNIQDSGFDDMTEKVYKSK 299          
BLAST of prohibitin-1 vs. Ensembl Fly
Match: Phb2 (gene:FBgn0010551 transcript:FBtr0086616)

HSP 1 Score: 372.474 bits (955), Expect = 1.100e-129
Identity = 174/261 (66.67%), Postives = 223/261 (85.44%), Query Frame = 1
Query:  145 SKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGKRK 927
            S+S YTV+GG R+IIFSR GGI+ +IY+EGLH+RIP  QYPII+D+RSRPR ISSPTGSKDLQM+NISLRVLSRPD   +P +++ +G DYDEKVLPSI NEVLK+V+AKFNA QLITQR+QVSLLIRK L+ERA+DFNII+DDVS+T+LSF ++Y+ A+E KQ++QQEAQRA F V RAKQE+QQKIV AEGEA+AA ++G A+ Q+  YLKLRK++AA+ IART+++SQNK YL+A++LMLN+ +  F++  E + K K
Sbjct:   39 SQSLYTVEGGHRAIIFSRLGGIQSDIYSEGLHVRIPWFQYPIIYDIRSRPRKISSPTGSKDLQMINISLRVLSRPDSLNLPYLHKQLGVDYDEKVLPSICNEVLKSVIAKFNASQLITQRQQVSLLIRKELVERARDFNIILDDVSLTELSFGKEYTAAIEAKQVAQQEAQRAVFFVERAKQEKQQKIVQAEGEAEAAKMLGLAVKQNPAYLKLRKLRAAQSIARTIASSQNKVYLSADSLMLNIQDSGFDDMTEKVYKSK 299          
BLAST of prohibitin-1 vs. Ensembl Fly
Match: Phb2 (gene:FBgn0010551 transcript:FBtr0112863)

HSP 1 Score: 372.474 bits (955), Expect = 1.100e-129
Identity = 174/261 (66.67%), Postives = 223/261 (85.44%), Query Frame = 1
Query:  145 SKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGKRK 927
            S+S YTV+GG R+IIFSR GGI+ +IY+EGLH+RIP  QYPII+D+RSRPR ISSPTGSKDLQM+NISLRVLSRPD   +P +++ +G DYDEKVLPSI NEVLK+V+AKFNA QLITQR+QVSLLIRK L+ERA+DFNII+DDVS+T+LSF ++Y+ A+E KQ++QQEAQRA F V RAKQE+QQKIV AEGEA+AA ++G A+ Q+  YLKLRK++AA+ IART+++SQNK YL+A++LMLN+ +  F++  E + K K
Sbjct:   39 SQSLYTVEGGHRAIIFSRLGGIQSDIYSEGLHVRIPWFQYPIIYDIRSRPRKISSPTGSKDLQMINISLRVLSRPDSLNLPYLHKQLGVDYDEKVLPSICNEVLKSVIAKFNASQLITQRQQVSLLIRKELVERARDFNIILDDVSLTELSFGKEYTAAIEAKQVAQQEAQRAVFFVERAKQEKQQKIVQAEGEAEAAKMLGLAVKQNPAYLKLRKLRAAQSIARTIASSQNKVYLSADSLMLNIQDSGFDDMTEKVYKSK 299          
BLAST of prohibitin-1 vs. Ensembl Fly
Match: Phb2 (gene:FBgn0010551 transcript:FBtr0112861)

HSP 1 Score: 371.318 bits (952), Expect = 3.491e-129
Identity = 173/259 (66.80%), Postives = 222/259 (85.71%), Query Frame = 1
Query:  145 SKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGK 921
            S+S YTV+GG R+IIFSR GGI+ +IY+EGLH+RIP  QYPII+D+RSRPR ISSPTGSKDLQM+NISLRVLSRPD   +P +++ +G DYDEKVLPSI NEVLK+V+AKFNA QLITQR+QVSLLIRK L+ERA+DFNII+DDVS+T+LSF ++Y+ A+E KQ++QQEAQRA F V RAKQE+QQKIV AEGEA+AA ++G A+ Q+  YLKLRK++AA+ IART+++SQNK YL+A++LMLN+ +  F++  E + K
Sbjct:   39 SQSLYTVEGGHRAIIFSRLGGIQSDIYSEGLHVRIPWFQYPIIYDIRSRPRKISSPTGSKDLQMINISLRVLSRPDSLNLPYLHKQLGVDYDEKVLPSICNEVLKSVIAKFNASQLITQRQQVSLLIRKELVERARDFNIILDDVSLTELSFGKEYTAAIEAKQVAQQEAQRAVFFVERAKQEKQQKIVQAEGEAEAAKMLGLAVKQNPAYLKLRKLRAAQSIARTIASSQNKVYLSADSLMLNIQDSGFDDMTEKVYK 297          
BLAST of prohibitin-1 vs. Ensembl Zebrafish
Match: phb2b (prohibitin 2b [Source:ZFIN;Acc:ZDB-GENE-040718-430])

HSP 1 Score: 352.829 bits (904), Expect = 1.192e-121
Identity = 167/249 (67.07%), Postives = 217/249 (87.15%), Query Frame = 1
Query:  157 YTVDGGQRSIIFSRFGGIK-ENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNE 900
            YTV+GGQR+IIF+R GG++ + +  EGLH RIP  QYPII+D+R+RPR ISS TGSKDLQMVNI+LRVLSRP  + +P +Y+ +G+DYDE+VLPSI NEVLK+VVAKFNA QLITQR QVSLLIR+ L ERAKDFNII+DDV+IT+LSFSR+Y+ AVE KQ++QQEAQRAQF V +AKQE++QKI+ AEGEAQAA ++G+A+T++ GYLKLR+I+AA+ IA+T++ SQNK YL+A++L++NL + SFN+
Sbjct:   49 YTVEGGQRAIIFNRIGGVQLDTVLTEGLHFRIPWFQYPIIYDIRARPRKISSLTGSKDLQMVNIALRVLSRPLASNLPIMYQQLGQDYDERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELFERAKDFNIILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFFVEKAKQEQKQKIIQAEGEAQAAKMLGEAVTKNPGYLKLRRIRAAQNIAKTVAASQNKVYLSADSLVMNLQDDSFNK 297          
BLAST of prohibitin-1 vs. Ensembl Zebrafish
Match: phb2b (prohibitin 2b [Source:ZFIN;Acc:ZDB-GENE-040718-430])

HSP 1 Score: 352.829 bits (904), Expect = 1.192e-121
Identity = 167/249 (67.07%), Postives = 217/249 (87.15%), Query Frame = 1
Query:  157 YTVDGGQRSIIFSRFGGIK-ENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNE 900
            YTV+GGQR+IIF+R GG++ + +  EGLH RIP  QYPII+D+R+RPR ISS TGSKDLQMVNI+LRVLSRP  + +P +Y+ +G+DYDE+VLPSI NEVLK+VVAKFNA QLITQR QVSLLIR+ L ERAKDFNII+DDV+IT+LSFSR+Y+ AVE KQ++QQEAQRAQF V +AKQE++QKI+ AEGEAQAA ++G+A+T++ GYLKLR+I+AA+ IA+T++ SQNK YL+A++L++NL + SFN+
Sbjct:   49 YTVEGGQRAIIFNRIGGVQLDTVLTEGLHFRIPWFQYPIIYDIRARPRKISSLTGSKDLQMVNIALRVLSRPLASNLPIMYQQLGQDYDERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELFERAKDFNIILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFFVEKAKQEQKQKIIQAEGEAQAAKMLGEAVTKNPGYLKLRRIRAAQNIAKTVAASQNKVYLSADSLVMNLQDDSFNK 297          
BLAST of prohibitin-1 vs. Ensembl Zebrafish
Match: phb2b (prohibitin 2b [Source:ZFIN;Acc:ZDB-GENE-040718-430])

HSP 1 Score: 352.829 bits (904), Expect = 1.192e-121
Identity = 167/249 (67.07%), Postives = 217/249 (87.15%), Query Frame = 1
Query:  157 YTVDGGQRSIIFSRFGGIK-ENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNE 900
            YTV+GGQR+IIF+R GG++ + +  EGLH RIP  QYPII+D+R+RPR ISS TGSKDLQMVNI+LRVLSRP  + +P +Y+ +G+DYDE+VLPSI NEVLK+VVAKFNA QLITQR QVSLLIR+ L ERAKDFNII+DDV+IT+LSFSR+Y+ AVE KQ++QQEAQRAQF V +AKQE++QKI+ AEGEAQAA ++G+A+T++ GYLKLR+I+AA+ IA+T++ SQNK YL+A++L++NL + SFN+
Sbjct:   49 YTVEGGQRAIIFNRIGGVQLDTVLTEGLHFRIPWFQYPIIYDIRARPRKISSLTGSKDLQMVNIALRVLSRPLASNLPIMYQQLGQDYDERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELFERAKDFNIILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFFVEKAKQEQKQKIIQAEGEAQAAKMLGEAVTKNPGYLKLRRIRAAQNIAKTVAASQNKVYLSADSLVMNLQDDSFNK 297          
BLAST of prohibitin-1 vs. Ensembl Zebrafish
Match: phb2a (prohibitin 2a [Source:ZFIN;Acc:ZDB-GENE-030131-3141])

HSP 1 Score: 350.132 bits (897), Expect = 1.167e-120
Identity = 166/248 (66.94%), Postives = 217/248 (87.50%), Query Frame = 1
Query:  157 YTVDGGQRSIIFSRFGGIK-ENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFN 897
            YTV+GGQR++IFSR GG++ + + AEGLH R+P  QYPII+D+R+RPR ISS TGSKDLQMVNI LRVLSRP  +++P +Y+ +G+DYDE+VLPSI NEVLK+VVAKFNA QLITQR QVSLLIR+ LIERAKDFNII+DDV+IT+LSFS++Y+ AVE KQ++QQEAQRAQF V +AKQ+++QKI+ AEGEA+AA ++G A+T++ GYLKLR+I+AA+ IA+T++ SQNK YL+A++L+LNL + SFN
Sbjct:   49 YTVEGGQRAVIFSRIGGMQMDTVLAEGLHFRMPWFQYPIIYDIRARPRKISSLTGSKDLQMVNIGLRVLSRPVASQLPIMYQQLGKDYDERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRDLIERAKDFNIILDDVAITELSFSKEYTAAVEAKQVAQQEAQRAQFFVEKAKQDQRQKIIQAEGEAEAAKMLGQAVTKNPGYLKLRRIRAAQNIAKTVAASQNKVYLSADSLVLNLQDSSFN 296          
BLAST of prohibitin-1 vs. Ensembl Zebrafish
Match: phb (prohibitin [Source:ZFIN;Acc:ZDB-GENE-030131-6577])

HSP 1 Score: 266.544 bits (680), Expect = 2.995e-88
Identity = 127/238 (53.36%), Postives = 183/238 (76.89%), Query Frame = 1
Query:  142 MSKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSS-GYLKLRKIKAAEKIARTLSTSQNKAYL 852
            ++ + Y VD G R++IF RF G+++ +  EG H  IP +Q PIIFD RSRPR +   TGSKDLQ VNI+LR+L RP   ++P I+ +IGEDYDE+VLPSI+ EVLK+VVA+F+AG+LITQRE VS  + + L ERA  F +I+DDVS+T L+F ++++EAVE KQ++QQEA+RA+F V +A+Q++Q  I++AEG++QAA+LI ++L ++  G ++LRK++AAE IA  LS ++N  YL
Sbjct:   22 VNSALYNVDAGHRAVIFDRFRGVQDVVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVAGQLPRIFTSIGEDYDERVLPSITTEVLKSVVARFDAGELITQRELVSRQVSEDLTERASTFGLILDDVSLTHLTFGKEFTEAVEMKQVAQQEAERARFVVEKAEQQKQAAIISAEGDSQAALLIANSLAEAGDGLVELRKLEAAEDIAFQLSRARNVTYL 259          
BLAST of prohibitin-1 vs. Ensembl Xenopus
Match: cgref1 (cell growth regulator with EF-hand domain 1 [Source:Xenbase;Acc:XB-GENE-997667])

HSP 1 Score: 350.903 bits (899), Expect = 9.104e-121
Identity = 166/259 (64.09%), Postives = 220/259 (84.94%), Query Frame = 1
Query:  142 MSKSFYTVDGGQRSIIFSRFGGIKEN-IYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHI 915
            + +S +TV+GG R+I F+R GG++++ I AEGLH R P  QYPII+D+R+RPR ISSPTGSKDLQMVNI+LRVLSRP  +++P +Y+ +G DYDE+VLPSI NEVLK+VVAKFNA QLITQR QVSLLIR+ L ERAKDF+II+DDV+IT+LSFSR+Y+ AVE KQ++QQEAQRAQF V +AKQ+++QKIV AEGEA AA +IGDAL+++ GYLKLR+I+AA+ IA+T+++SQN+ YLNA++L+LNL + +F    + +
Sbjct:   36 VKESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRFPWFQYPIIYDIRARPRKISSPTGSKDLQMVNITLRVLSRPLASELPFMYQRLGLDYDERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSIILDDVAITELSFSREYTAAVESKQVAQQEAQRAQFLVEKAKQDQKQKIVQAEGEAAAAKMIGDALSKNPGYLKLRRIRAAQSIAKTIASSQNRVYLNADSLVLNLQDDTFTRGSDSL 294          
BLAST of prohibitin-1 vs. Ensembl Xenopus
Match: cgref1 (cell growth regulator with EF-hand domain 1 [Source:Xenbase;Acc:XB-GENE-997667])

HSP 1 Score: 350.132 bits (897), Expect = 1.239e-120
Identity = 166/253 (65.61%), Postives = 218/253 (86.17%), Query Frame = 1
Query:  142 MSKSFYTVDGGQRSIIFSRFGGIKEN-IYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFN 897
            + +S +TV+GG R+I F+R GG++++ I AEGLH R P  QYPII+D+R+RPR ISSPTGSKDLQMVNI+LRVLSRP  +++P +Y+ +G DYDE+VLPSI NEVLK+VVAKFNA QLITQR QVSLLIR+ L ERAKDF+II+DDV+IT+LSFSR+Y+ AVE KQ++QQEAQRAQF V +AKQ+++QKIV AEGEA AA +IGDAL+++ GYLKLR+I+AA+ IA+T+++SQN+ YLNA++L+LNL + +F 
Sbjct:   36 VKESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRFPWFQYPIIYDIRARPRKISSPTGSKDLQMVNITLRVLSRPLASELPFMYQRLGLDYDERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSIILDDVAITELSFSREYTAAVESKQVAQQEAQRAQFLVEKAKQDQKQKIVQAEGEAAAAKMIGDALSKNPGYLKLRRIRAAQSIAKTIASSQNRVYLNADSLVLNLQDDTFT 288          
BLAST of prohibitin-1 vs. Ensembl Xenopus
Match: cgref1 (cell growth regulator with EF-hand domain 1 [Source:Xenbase;Acc:XB-GENE-997667])

HSP 1 Score: 350.132 bits (897), Expect = 1.239e-120
Identity = 166/253 (65.61%), Postives = 218/253 (86.17%), Query Frame = 1
Query:  142 MSKSFYTVDGGQRSIIFSRFGGIKEN-IYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFN 897
            + +S +TV+GG R+I F+R GG++++ I AEGLH R P  QYPII+D+R+RPR ISSPTGSKDLQMVNI+LRVLSRP  +++P +Y+ +G DYDE+VLPSI NEVLK+VVAKFNA QLITQR QVSLLIR+ L ERAKDF+II+DDV+IT+LSFSR+Y+ AVE KQ++QQEAQRAQF V +AKQ+++QKIV AEGEA AA +IGDAL+++ GYLKLR+I+AA+ IA+T+++SQN+ YLNA++L+LNL + +F 
Sbjct:   36 VKESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRFPWFQYPIIYDIRARPRKISSPTGSKDLQMVNITLRVLSRPLASELPFMYQRLGLDYDERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSIILDDVAITELSFSREYTAAVESKQVAQQEAQRAQFLVEKAKQDQKQKIVQAEGEAAAAKMIGDALSKNPGYLKLRRIRAAQSIAKTIASSQNRVYLNADSLVLNLQDDTFT 288          
BLAST of prohibitin-1 vs. Ensembl Xenopus
Match: phb (prohibitin [Source:NCBI gene;Acc:394635])

HSP 1 Score: 259.225 bits (661), Expect = 3.387e-85
Identity = 123/238 (51.68%), Postives = 181/238 (76.05%), Query Frame = 1
Query:  142 MSKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSS-GYLKLRKIKAAEKIARTLSTSQNKAYL 852
            ++ + Y VD G +++IF RF G++E +  EG H  IP +Q PIIFD RSRPR +   TGSKDLQ VNI+LR+L RP   ++P I+ +IGEDYDE+VLPSI+ E+LK+VVA+F+AG+LITQRE VS  + + L+ERA  F +I+DDVS+T L+F ++++EAVE KQ++QQEA+RA+F V +A+Q+++  +++AEG+++AA LI  +L  +  G ++LRK++AAE IA  LS ++N  YL
Sbjct:   23 VNSALYNVDAGHQAVIFDRFRGVQETVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVVTGSKDLQNVNITLRILFRPMGNQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSEDLMERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFIVEKAEQQKKAAVISAEGDSKAAELIATSLADAGDGLIELRKLEAAEDIAYQLSRARNVTYL 260          
BLAST of prohibitin-1 vs. Ensembl Mouse
Match: Phb2 (prohibitin 2 [Source:MGI Symbol;Acc:MGI:102520])

HSP 1 Score: 350.132 bits (897), Expect = 1.030e-120
Identity = 167/261 (63.98%), Postives = 222/261 (85.06%), Query Frame = 1
Query:  148 KSFYTVDGGQRSIIFSRFGGIKEN-IYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGKRK 927
            +S +TV+GG R+I F+R GG++++ I AEGLH RIP  QYPII+D+R+RPR ISSPTGSKDLQMVNISLRVLSRP+  ++P +Y+ +G DY+E+VLPSI NEVLK+VVAKFNA QLITQR QVSLLIR+ L ERAKDF++I+DDV+IT+LSFSR+Y+ AVE KQ++QQEAQRAQF V +AKQE++QKIV AEGEA+AA ++G+AL+++ GY+KLRKI+AA+ I++T++TSQN+ YL A+ L+LNL ++SF    + + K K
Sbjct:   38 ESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGK 298          
BLAST of prohibitin-1 vs. Ensembl Mouse
Match: Phb (prohibitin [Source:MGI Symbol;Acc:MGI:97572])

HSP 1 Score: 265.388 bits (677), Expect = 1.141e-87
Identity = 130/248 (52.42%), Postives = 187/248 (75.40%), Query Frame = 1
Query:  142 MSKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDAL-TQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNAN-TLMLNL 879
            ++ + Y VD G R++IF RF G+++ +  EG H  IP +Q PIIFD RSRPR +   TGSKDLQ VNI+LR+L RP  +++P IY +IGEDYDE+VLPSI+ E+LK+VVA+F+AG+LITQRE VS  +   L ERA  F +I+DDVS+T L+F ++++EAVE KQ++QQEA+RA+F V +A+Q+++  I++AEG+++AA LI ++L T   G ++LRK++AAE IA  LS S+N  YL A  +++L L
Sbjct:   23 VNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQL 270          
BLAST of prohibitin-1 vs. Ensembl Mouse
Match: Phb (prohibitin [Source:MGI Symbol;Acc:MGI:97572])

HSP 1 Score: 221.861 bits (564), Expect = 1.510e-71
Identity = 102/185 (55.14%), Postives = 143/185 (77.30%), Query Frame = 1
Query:  142 MSKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQER 696
            ++ + Y VD G R++IF RF G+++ +  EG H  IP +Q PIIFD RSRPR +   TGSKDLQ VNI+LR+L RP  +++P IY +IGEDYDE+VLPSI+ E+LK+VVA+F+AG+LITQRE VS  +   L ERA  F +I+DDVS+T L+F ++++EAVE KQ++QQEA+RA+F V +A+Q++
Sbjct:   23 VNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQK 207          
BLAST of prohibitin-1 vs. Ensembl Mouse
Match: Phb2 (prohibitin 2 [Source:MGI Symbol;Acc:MGI:102520])

HSP 1 Score: 179.489 bits (454), Expect = 1.140e-55
Identity = 98/207 (47.34%), Postives = 131/207 (63.29%), Query Frame = 1
Query:  307 SPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGKRK 927
            SPTGSKDLQMVNISLRVLSRP+  ++P +Y+ +G DY+E+VLPSI NEVLK+VVAKFNA QLIT                                                    QRAQF V +AKQE++QKIV AEGEA+AA ++G+AL+++ GY+KLRKI+AA+ I++T++TSQN+ YL A+ L+LNL ++SF    + + K K
Sbjct:    2 SPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLIT----------------------------------------------------QRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGK 156          
BLAST of prohibitin-1 vs. Ensembl Mouse
Match: Phb2 (prohibitin 2 [Source:MGI Symbol;Acc:MGI:102520])

HSP 1 Score: 154.836 bits (390), Expect = 7.160e-47
Identity = 72/97 (74.23%), Postives = 84/97 (86.60%), Query Frame = 1
Query:  226 AEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVS 516
            AEGLH RIP  QYPII+D+R+RPR ISSPTGSKDLQMVNISLRVLSRP+  ++P +Y+ +G DY+E+VLPSI NEVLK+VVAKFNA QLITQR Q S
Sbjct:    2 AEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQFS 98          
BLAST of prohibitin-1 vs. UniProt/SwissProt
Match: sp|A9UMS3|PHB2_XENTR (Prohibitin-2 OS=Xenopus tropicalis OX=8364 GN=phb2 PE=2 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 4.823e-120
Identity = 166/259 (64.09%), Postives = 220/259 (84.94%), Query Frame = 1
Query:  142 MSKSFYTVDGGQRSIIFSRFGGIKEN-IYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHI 915
            + +S +TV+GG R+I F+R GG++++ I AEGLH R P  QYPII+D+R+RPR ISSPTGSKDLQMVNI+LRVLSRP  +++P +Y+ +G DYDE+VLPSI NEVLK+VVAKFNA QLITQR QVSLLIR+ L ERAKDF+II+DDV+IT+LSFSR+Y+ AVE KQ++QQEAQRAQF V +AKQ+++QKIV AEGEA AA +IGDAL+++ GYLKLR+I+AA+ IA+T+++SQN+ YLNA++L+LNL + +F    + +
Sbjct:   36 VKESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRFPWFQYPIIYDIRARPRKISSPTGSKDLQMVNITLRVLSRPLASELPFMYQRLGLDYDERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSIILDDVAITELSFSREYTAAVESKQVAQQEAQRAQFLVEKAKQDQKQKIVQAEGEAAAAKMIGDALSKNPGYLKLRRIRAAQSIAKTIASSQNRVYLNADSLVLNLQDDTFTRGSDSL 294          
BLAST of prohibitin-1 vs. UniProt/SwissProt
Match: sp|Q2HJ97|PHB2_BOVIN (Prohibitin-2 OS=Bos taurus OX=9913 GN=PHB2 PE=2 SV=1)

HSP 1 Score: 350.517 bits (898), Expect = 5.481e-120
Identity = 167/261 (63.98%), Postives = 222/261 (85.06%), Query Frame = 1
Query:  148 KSFYTVDGGQRSIIFSRFGGIKEN-IYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGKRK 927
            +S +TV+GG R+I F+R GG++++ I AEGLH RIP  QYPII+D+R+RPR ISSPTGSKDLQMVNISLRVLSRP+  ++P +Y+ +G DY+E+VLPSI NEVLK+VVAKFNA QLITQR QVSLLIR+ L ERAKDF++I+DDV+IT+LSFSR+Y+ AVE KQ++QQEAQRAQF V +AKQE++QKIV AEGEA+AA ++G+AL+++ GY+KLRKI+AA+ I++T++TSQN+ YL A+ L+LNL ++SF    + + K K
Sbjct:   38 ESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAMELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAARMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGK 298          
BLAST of prohibitin-1 vs. UniProt/SwissProt
Match: sp|Q5XIH7|PHB2_RAT (Prohibitin-2 OS=Rattus norvegicus OX=10116 GN=Phb2 PE=1 SV=1)

HSP 1 Score: 350.517 bits (898), Expect = 5.852e-120
Identity = 167/261 (63.98%), Postives = 222/261 (85.06%), Query Frame = 1
Query:  148 KSFYTVDGGQRSIIFSRFGGIKEN-IYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGKRK 927
            +S +TV+GG R+I F+R GG++++ I AEGLH RIP  QYPII+D+R+RPR ISSPTGSKDLQMVNISLRVLSRP+  ++P +Y+ +G DY+E+VLPSI NEVLK+VVAKFNA QLITQR QVSLLIR+ L ERAKDF++I+DDV+IT+LSFSR+Y+ AVE KQ++QQEAQRAQF V +AKQE++QKIV AEGEA+AA ++G+AL+++ GY+KLRKI+AA+ I++T++TSQN+ YL A+ L+LNL ++SF    + + K K
Sbjct:   38 ESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGK 298          
BLAST of prohibitin-1 vs. UniProt/SwissProt
Match: sp|O35129|PHB2_MOUSE (Prohibitin-2 OS=Mus musculus OX=10090 GN=Phb2 PE=1 SV=1)

HSP 1 Score: 350.132 bits (897), Expect = 7.202e-120
Identity = 167/261 (63.98%), Postives = 222/261 (85.06%), Query Frame = 1
Query:  148 KSFYTVDGGQRSIIFSRFGGIKEN-IYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGKRK 927
            +S +TV+GG R+I F+R GG++++ I AEGLH RIP  QYPII+D+R+RPR ISSPTGSKDLQMVNISLRVLSRP+  ++P +Y+ +G DY+E+VLPSI NEVLK+VVAKFNA QLITQR QVSLLIR+ L ERAKDF++I+DDV+IT+LSFSR+Y+ AVE KQ++QQEAQRAQF V +AKQE++QKIV AEGEA+AA ++G+AL+++ GY+KLRKI+AA+ I++T++TSQN+ YL A+ L+LNL ++SF    + + K K
Sbjct:   38 ESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGK 298          
BLAST of prohibitin-1 vs. UniProt/SwissProt
Match: sp|Q99623|PHB2_HUMAN (Prohibitin-2 OS=Homo sapiens OX=9606 GN=PHB2 PE=1 SV=2)

HSP 1 Score: 350.132 bits (897), Expect = 7.202e-120
Identity = 167/261 (63.98%), Postives = 222/261 (85.06%), Query Frame = 1
Query:  148 KSFYTVDGGQRSIIFSRFGGIKEN-IYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGKRK 927
            +S +TV+GG R+I F+R GG++++ I AEGLH RIP  QYPII+D+R+RPR ISSPTGSKDLQMVNISLRVLSRP+  ++P +Y+ +G DY+E+VLPSI NEVLK+VVAKFNA QLITQR QVSLLIR+ L ERAKDF++I+DDV+IT+LSFSR+Y+ AVE KQ++QQEAQRAQF V +AKQE++QKIV AEGEA+AA ++G+AL+++ GY+KLRKI+AA+ I++T++TSQN+ YL A+ L+LNL ++SF    + + K K
Sbjct:   38 ESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGK 298          
BLAST of prohibitin-1 vs. TrEMBL
Match: I1ZIH0 (Prohibitin OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 290/291 (99.66%), Postives = 291/291 (100.00%), Query Frame = 1
Query:   58 MDQNINISKFIKSPATRXXXXXXXXXXXMSKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGKRKN 930
            MDQNINISKFIKSPATRLLILGGGLLYGMSKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERA+DFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGKRKN
Sbjct:    1 MDQNINISKFIKSPATRLLILGGGLLYGMSKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAQDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGKRKN 291          
BLAST of prohibitin-1 vs. TrEMBL
Match: A0A0A7AD70 (Prohibitin OS=Dugesia japonica OX=6161 GN=Phb2 PE=2 SV=1)

HSP 1 Score: 488.034 bits (1255), Expect = 7.475e-172
Identity = 236/262 (90.08%), Postives = 255/262 (97.33%), Query Frame = 1
Query:  142 MSKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGKRK 927
            ++K+FYTVDGGQRSIIFSRFGGIKENIYAEGLH RIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPD+ KIPDIYRN+GEDYDE+VLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFS+QY EAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAA+LIGDAL+ +SGYLKLRKIKA+EKIARTLST+QN+AYLNANTLM+N+NEK FN+SV+ + K+K
Sbjct:   32 LTKAFYTVDGGQRSIIFSRFGGIKENIYAEGLHFRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDILKIPDIYRNLGEDYDERVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSKQYGEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAILIGDALSANSGYLKLRKIKASEKIARTLSTAQNRAYLNANTLMMNINEKEFNDSVDRVVKKK 293          
BLAST of prohibitin-1 vs. TrEMBL
Match: A0A5S6Q8Q8 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 1.828e-132
Identity = 184/262 (70.23%), Postives = 222/262 (84.73%), Query Frame = 1
Query:  142 MSKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGKRK 927
            +S+SFYTVDGGQR+II+SR  G++  IY EGLH RIP  QYPI++DVR+RP  ISSPTGSKDLQMVNISLRVLSRPD   +P IYR +G D+DE+VLPSI NEVLK+VVAKFNA QLITQR+QVSLLIRK+L+ERAKDFNII+DDVSIT+LSF R+Y++AVE KQ++ QEAQRA F V RAKQERQQKIV AEGEAQAA ++G+A+ +  GYLKLRKI+AA+ IARTL+ S N+AYLNAN LMLN+  + F +S + I K+K
Sbjct:   36 LSQSFYTVDGGQRAIIYSRISGVRPEIYPEGLHFRIPWFQYPIVYDVRARPHKISSPTGSKDLQMVNISLRVLSRPDAPFLPRIYRTLGTDWDERVLPSICNEVLKSVVAKFNASQLITQRQQVSLLIRKMLVERAKDFNIILDDVSITELSFGREYAQAVEAKQVAAQEAQRAAFYVERAKQERQQKIVQAEGEAQAAKMLGEAMAKDPGYLKLRKIRAAQSIARTLAQSSNRAYLNANNLMLNIGSEEFLQSADEIFKKK 297          
BLAST of prohibitin-1 vs. TrEMBL
Match: A0A1D1VV90 (Prohibitin OS=Ramazzottius varieornatus OX=947166 GN=RvY_15538-1 PE=3 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 1.852e-132
Identity = 183/263 (69.58%), Postives = 226/263 (85.93%), Query Frame = 1
Query:  142 MSKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEH-IGKRK 927
            +S+S YTV+GG R+IIFSR GG++  +YAEGLH RIP +QYPII+D+RSRPR ISSPTGSKDLQMVNISLRVL+RPD A +P +YR +G DYDE+VLPSI NEVLK+VVAKFNA QLITQR QVSLL+RK L +RA DFNII+DDV+ITDLSF ++Y+ +VE KQ++QQEAQRAQF V +AKQERQQKIV AEGEAQAA+L+GDA+++S GYLKLRKI+AA+ IART+S SQN+AYL+AN+LMLN+ +  +++     IGK K
Sbjct:   38 VSQSMYTVEGGHRAIIFSRIGGVQNEVYAEGLHFRIPWLQYPIIYDIRSRPRSISSPTGSKDLQMVNISLRVLARPDQATLPRLYRQLGTDYDERVLPSICNEVLKSVVAKFNAAQLITQRSQVSLLVRKELTQRAMDFNIILDDVAITDLSFGKEYTASVESKQVAQQEAQRAQFLVEKAKQERQQKIVQAEGEAQAALLLGDAVSKSPGYLKLRKIRAAQSIARTISQSQNRAYLDANSLMLNITDVEYDQGTRSIIGKNK 300          
BLAST of prohibitin-1 vs. TrEMBL
Match: A0A3P7LBU4 (Prohibitin OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS10045 PE=3 SV=1)

HSP 1 Score: 385.185 bits (988), Expect = 2.604e-131
Identity = 183/262 (69.85%), Postives = 224/262 (85.50%), Query Frame = 1
Query:  142 MSKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGKRK 927
            + +S +TVDGG R I+FSR GG+K +IY EGLHLRIP  QYPII+D+RSRP  I+SPTGSKDLQ +N++LRVLSRP+++K+P+IYR +G DYD++VLPSI NEVLKAVVAKFNA QLITQR+QVSLLIRK L++RA+DF I+VDDVSITDL+FS+ Y+ AVE KQI+QQEAQRAQF V RAKQERQQKIV A+GEAQAA LIGDAL  + GYLKLRKIKAA +IARTLS S N+ +LNANTL++NL++  F+ S E + K+K
Sbjct:   28 IQQSLFTVDGGHRGIMFSRIGGVKPDIYPEGLHLRIPWFQYPIIYDIRSRPHKITSPTGSKDLQTINLTLRVLSRPEVSKLPEIYRTLGTDYDDRVLPSIVNEVLKAVVAKFNASQLITQRQQVSLLIRKQLVDRARDFYIVVDDVSITDLTFSQVYASAVESKQIAQQEAQRAQFLVERAKQERQQKIVMADGEAQAAKLIGDALQANPGYLKLRKIKAAAQIARTLSQSSNRVFLNANTLLMNLSDPQFDASCEKVIKKK 289          
BLAST of prohibitin-1 vs. Ensembl Cavefish
Match: phb2a (prohibitin-2-like [Source:NCBI gene;Acc:103035142])

HSP 1 Score: 355.91 bits (912), Expect = 6.095e-123
Identity = 169/253 (66.80%), Postives = 222/253 (87.75%), Query Frame = 1
Query:  142 MSKSFYTVDGGQRSIIFSRFGGI-KENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFN 897
            + ++ YTV+GGQR+IIF+R GG+ K+ + AEGLH RIP  QYPII+D+R+RPR ISS TGSKDLQMVNI+LRVLSRP  + +P +Y+++G DYDE+VLPSI NEVLK+VVAKFNA QLITQR QVS+LIR+ LIERAKDFNII+DDV+IT+LSFSR+Y+ AVE KQ++QQEAQRAQF V +AKQ+++QKI+ AEGEA+AA L+G+A+T++ GYLKLR+I+AA+ IA+T+++SQNK YLNA++L++NL + SFN
Sbjct:   44 VKEAMYTVEGGQRAIIFNRIGGMEKDTVLAEGLHFRIPWFQYPIIYDIRARPRKISSLTGSKDLQMVNIALRVLSRPVASNLPFLYQHLGVDYDERVLPSIVNEVLKSVVAKFNASQLITQRAQVSMLIRRELIERAKDFNIILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFYVEKAKQDQRQKIIQAEGEAEAAKLLGEAVTKNPGYLKLRRIRAAQNIAKTVASSQNKLYLNADSLVMNLQDSSFN 296          
BLAST of prohibitin-1 vs. Ensembl Cavefish
Match: phb2b (prohibitin-2-like [Source:NCBI gene;Acc:103047478])

HSP 1 Score: 351.288 bits (900), Expect = 3.957e-121
Identity = 164/248 (66.13%), Postives = 218/248 (87.90%), Query Frame = 1
Query:  157 YTVDGGQRSIIFSRFGGIK-ENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFN 897
            YTV+GGQR+I+F+R GG++ + + +EGLH RIP  QYPII+D+R++PR ISS TGSKDLQMVNI+LRVLSRP  + +P +Y+++G+DYDE+VLPSI NEVLK+VVAKFNA QL+TQR QVSLLIR+ L ERAKDFNII+DDV+IT+LSFSR+Y+ AVE KQ++QQEAQRAQF V +AKQE++QKI+ AEGEA+AA ++G+A+T++ GYLKLR+I+AA+ IA+T++ SQNK YLNA++L++NL + SFN
Sbjct:   49 YTVEGGQRAIVFNRVGGMQMDTVLSEGLHFRIPWFQYPIIYDIRAKPRKISSLTGSKDLQMVNIALRVLSRPVASNLPYMYQHLGKDYDERVLPSIVNEVLKSVVAKFNASQLLTQRAQVSLLIRRELFERAKDFNIILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFFVEKAKQEQKQKIIQAEGEAEAAKMLGEAVTKNPGYLKLRRIRAAQNIAKTVAASQNKVYLNADSLVMNLQDDSFN 296          
BLAST of prohibitin-1 vs. Ensembl Cavefish
Match: phb2b (prohibitin-2-like [Source:NCBI gene;Acc:103047478])

HSP 1 Score: 332.028 bits (850), Expect = 8.043e-114
Identity = 159/254 (62.60%), Postives = 212/254 (83.46%), Query Frame = 1
Query:  157 YTVDGGQRSIIFSRFGGIK-ENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLST-----SQNKAYLNANTLMLNLNEKSFNE 900
            YTV+GGQR+I+F+R GG++ + + +EGLH RIP  QYPII+D+R++PR ISS TGSKDLQMVNI+LRVLSRP  + +P +Y+++G+DYDE+VLPSI NEVLK+VVAKFNA QL+TQR QVSLLIR+ L ERAKDFNII+DDV+IT+LSFSR+Y+ AVE KQ++QQEAQRAQF V +AKQE++QKI+ AEGEA+AA ++G+A+T++ GYLKLR+I+A   +    S       +NK YLNA++L++NL + SFN+
Sbjct:   30 YTVEGGQRAIVFNRVGGMQMDTVLSEGLHFRIPWFQYPIIYDIRAKPRKISSLTGSKDLQMVNIALRVLSRPVASNLPYMYQHLGKDYDERVLPSIVNEVLKSVVAKFNASQLLTQRAQVSLLIRRELFERAKDFNIILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFFVEKAKQEQKQKIIQAEGEAEAAKMLGEAVTKNPGYLKLRRIRAVFLLTVVCSCFLSKNRKNKVYLNADSLVMNLQDDSFNK 283          
BLAST of prohibitin-1 vs. Ensembl Cavefish
Match: phb2a (prohibitin-2-like [Source:NCBI gene;Acc:103035142])

HSP 1 Score: 330.872 bits (847), Expect = 1.547e-112
Identity = 160/247 (64.78%), Postives = 209/247 (84.62%), Query Frame = 1
Query:  142 MSKSFYTVDGGQRSIIFSRFGGI-KENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNL 879
            + ++ YTV+GGQR+IIF+R GG+ K+ + AEGLH RIP  QYPII+D+R+RPR ISS TGSKDLQMVNI+LRVLSRP  + +P +Y+++G DYDE+VLPSI NEVLK+VVAKFNA QLITQR QVS+LIR+ LIERAKDFNII+DDV+IT+LSFSR+Y+ AVE KQ++QQEAQRAQF V +AKQ+++QKI+ AEGEA+AA L+G+A+T++ GYLKLR+I+AA+ IA+T+S   +  Y N N  + +L
Sbjct:   44 VKEAMYTVEGGQRAIIFNRIGGMEKDTVLAEGLHFRIPWFQYPIIYDIRARPRKISSLTGSKDLQMVNIALRVLSRPVASNLPFLYQHLGVDYDERVLPSIVNEVLKSVVAKFNASQLITQRAQVSMLIRRELIERAKDFNIILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFYVEKAKQDQRQKIIQAEGEAEAAKLLGEAVTKNPGYLKLRRIRAAQNIAKTVSLLLSYPYKNFNCKIWSL 290          
BLAST of prohibitin-1 vs. Ensembl Cavefish
Match: phb (prohibitin [Source:NCBI gene;Acc:103031128])

HSP 1 Score: 265.774 bits (678), Expect = 4.667e-88
Identity = 128/238 (53.78%), Postives = 181/238 (76.05%), Query Frame = 1
Query:  142 MSKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSS-GYLKLRKIKAAEKIARTLSTSQNKAYL 852
            ++ + + VD G R++IF RF G+++ +  EG H  IP +Q PIIFD RSRPR +   TGSKDLQ VNI+LR+L RP   ++P I+ +IGEDYDE+VLPSI+ EVLKAVVA+F+AG+LITQRE VS  + + L ERA  F +I+DDVS+T L+F ++++EAVE KQ++QQEA+RA+F V +A+Q++Q  I++A G++QAA+LI D+L  +  G ++LRK++AAE IA  LS S+N  YL
Sbjct:   22 VNSALFNVDAGHRAVIFDRFRGVQDAVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVVTGSKDLQNVNITLRILFRPVANQLPRIFTSIGEDYDERVLPSITTEVLKAVVARFDAGELITQRELVSRQVSEDLTERASTFGLILDDVSLTHLTFGKEFTEAVEMKQVAQQEAERARFVVEKAEQQKQAAIISAAGDSQAALLIADSLAVAGDGLVELRKLEAAEDIAFQLSRSRNVTYL 259          
BLAST of prohibitin-1 vs. Ensembl Sea Lamprey
Match: phb (prohibitin [Source:ZFIN;Acc:ZDB-GENE-030131-6577])

HSP 1 Score: 269.24 bits (687), Expect = 4.701e-90
Identity = 132/243 (54.32%), Postives = 187/243 (76.95%), Query Frame = 1
Query:  151 SFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSS-GYLKLRKIKAAEKIARTLSTSQNKAYLNA--NTLM 870
            +F TV+GG R++IF RF G+++ +  EG H  IP +Q PIIFD RSRPR +   TGSKD+Q VNI+LR+L RP  +++P IY +IGEDYDE+VLPSI+ EVLKAVVA+F+AG+LITQRE VS  +   L+ERA  F +I+DDVS+T L+F R++++AVE KQ++QQEA+RA+F V RA+Q+++  I+ AEG+A+AA LI  A++++  G ++LRK++AAE IA  LS S+  AYL +  +TL+
Sbjct:   24 AFLTVEGGHRAVIFDRFRGVQDLVVGEGTHFVIPWVQRPIIFDCRSRPRNVPVVTGSKDMQNVNITLRILFRPIASQLPKIYMSIGEDYDERVLPSITTEVLKAVVARFDAGELITQRELVSRQVSNDLMERAATFGLILDDVSLTHLTFGREFTQAVEAKQVAQQEAERARFVVERAEQQKKAAIIAAEGDAKAAQLIATAISEAGEGLVELRKLEAAEDIAMQLSKSRGVAYLPSGQHTLL 266          
BLAST of prohibitin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006512.1 (pep scaffold:Pmarinus_7.0:GL479067:257:4164:-1 gene:ENSPMAG00000005886.1 transcript:ENSPMAT00000006512.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 189.889 bits (481), Expect = 1.633e-60
Identity = 89/120 (74.17%), Postives = 104/120 (86.67%), Query Frame = 1
Query:  157 YTVDGGQRSIIFSRFGGIKEN-IYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQV 513
            YTVDGGQR+IIFSR GGI+EN I AEGLH RIP   YPII+D+R++PR ISSPTGSKDLQMVNI+LRVLSRPD  K+P +++ +G DY+E+VLPSI NEVLK+VVAKFNA QLITQR QV
Sbjct:   41 YTVDGGQRAIIFSRLGGIQENTILAEGLHFRIPWFHYPIIYDIRAKPRKISSPTGSKDLQMVNITLRVLSRPDALKLPRMFQQLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQV 160          
BLAST of prohibitin-1 vs. Ensembl Yeast
Match: PHB2 (Subunit of the prohibitin complex (Phb1p-Phb2p); prohibitin is a 1.2 MDa ring-shaped inner mitochondrial membrane chaperone that stabilizes newly synthesized proteins; determinant of replicative life span; involved in mitochondrial segregation; prohibitin deficiency induces a mitochondrial unfolded protein response (mtUPR) [Source:SGD;Acc:S000003463])

HSP 1 Score: 284.263 bits (726), Expect = 1.391e-95
Identity = 133/245 (54.29%), Postives = 190/245 (77.55%), Query Frame = 1
Query:  142 MSKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLN 876
            ++ + + VDGG R+I++SR  G+   I+ EG H   P +  PII+DVR++PR ++S TG+KDLQMVNI+ RVLSRPD+ ++P IYR +G+DYDE+VLPSI NEVLKAVVA+FNA QLITQRE+VS LIR+ L+ RA  FNI++DDVSIT ++FS +++ AVE KQI+QQ+AQRA F V +A+QE+Q  +V A+GEA++A LIG+A+ +S  Y++L+++  A  IA+ L++S N+  L+   L+LN
Sbjct:   54 INNALFNVDGGHRAIVYSRIHGVSSRIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGTKDLQMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREKVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQEKQGMVVRAQGEAKSAELIGEAIKKSRDYVELKRLDTARDIAKILASSPNRVILDNEALLLN 298          
BLAST of prohibitin-1 vs. Ensembl Yeast
Match: PHB1 (Subunit of the prohibitin complex (Phb1p-Phb2p); prohibitin is a 1.2 MDa ring-shaped inner mitochondrial membrane chaperone that stabilizes newly synthesized proteins; determinant of replicative life span; involved in mitochondrial segregation; prohibitin deficiency induces a mitochondrial unfolded protein response (mtUPR) [Source:SGD;Acc:S000003364])

HSP 1 Score: 253.447 bits (646), Expect = 8.498e-84
Identity = 124/259 (47.88%), Postives = 186/259 (71.81%), Query Frame = 1
Query:  151 SFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQ-SSGYLKLRKIKAAEKIARTLSTSQNKAYLNA--------------NTLMLNLN 882
            S Y V GG R +IF R  G+K+ +  EG H  +P +Q  II+DVR++P+ I++ TG+KDLQMV+++LRVL RP++ ++P IY+N+G DYDE+VLPSI NEVLK++VA+F+A +LITQRE +S  IRK L  RA +F I ++DVSIT ++F  ++++AVE+KQI+QQ+A+RA+F V +A+QERQ  ++ AEGEA++A  I  AL +   G L +R+++A++ IA+TL+ S N  YL +              N+L+LN+ 
Sbjct:   28 SMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVVYLPSQHSGGGNSESSGSPNSLLLNIG 286          
BLAST of prohibitin-1 vs. Ensembl Nematostella
Match: EDO42348 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1L7])

HSP 1 Score: 352.829 bits (904), Expect = 2.440e-122
Identity = 167/262 (63.74%), Postives = 213/262 (81.30%), Query Frame = 1
Query:  142 MSKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGKRK 927
            + +S YTVDGG R+IIFSR GG+++ +Y EGLH RIP  QYPII+D+RSRPR I SPTGSKDLQMVNI LRVL+RP+  K+P +YR +G D+DE+VLPSI NEVLK+VVA+FNA QLIT R+QVSLLIR+ L+ERA+DF II+DDVSITDLSF ++Y+ A+E KQ++QQEAQRAQF V +A QERQQKIV AEGEAQAA L+G+AL  + GYL+LRKI+AA+KI+R ++ SQN  YL+++ L+LNL      +   ++ K K
Sbjct:   36 IKESVYTVDGGHRAIIFSRIGGVQDTVYTEGLHFRIPWFQYPIIYDIRSRPRKIISPTGSKDLQMVNIGLRVLARPEANKLPPMYRKLGLDFDERVLPSIMNEVLKSVVAQFNASQLITMRQQVSLLIRRQLMERARDFYIILDDVSITDLSFGKEYTSAIEAKQVAQQEAQRAQFIVEKAIQERQQKIVQAEGEAQAAKLLGEALKDNPGYLRLRKIRAAQKISRVIAASQNPVYLDSDGLLLNLRHADVIDDTSYLKKEK 297          
BLAST of prohibitin-1 vs. Ensembl Nematostella
Match: EDO49486 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG85])

HSP 1 Score: 270.781 bits (691), Expect = 2.294e-90
Identity = 127/247 (51.42%), Postives = 187/247 (75.71%), Query Frame = 1
Query:  145 SKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSS-GYLKLRKIKAAEKIARTLSTSQNKAYL-NANTLMLNL 879
            + + + VDGG R++IF RF G+K ++  EG H  IP +Q PIIFD+R+RPR +   TGSKDLQ VNI+LR+L RP    +P IY N+GEDYDE+VLPSI+ EVLKAVVA+F+AG+LITQRE VS  +++ L ERA  F +++DD+S+T L+F ++++EAVE KQ++QQ+A+RA+F V RA+Q+++  +++AEG+A+ A L+  A  ++  G ++LRKI+A+E+IA  +S S+N AYL     ++LNL
Sbjct:   24 NSALFNVDGGHRAVIFDRFQGVKPDVVGEGTHFLIPWVQRPIIFDIRTRPRNVPVTTGSKDLQNVNITLRILYRPQPQVLPKIYMNLGEDYDERVLPSITTEVLKAVVAQFDAGELITQREMVSQKVQEDLTERASSFGLVLDDISLTHLTFGKEFTEAVELKQVAQQDAERARFLVERAEQQKKAAVISAEGDARGAALLAQAFKEAGEGLVELRKIEASEEIAERMSRSRNVAYLPGGQKMLLNL 270          
BLAST of prohibitin-1 vs. Ensembl Medaka
Match: phb2b (prohibitin 2 [Source:NCBI gene;Acc:101159337])

HSP 1 Score: 342.043 bits (876), Expect = 1.434e-117
Identity = 163/257 (63.42%), Postives = 219/257 (85.21%), Query Frame = 1
Query:  157 YTVDGGQRSIIFSRFGGIK-ENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGKR 924
            YTV+GG R+I+F+R GG++ + I +EGLH RIP IQYPII+D+R++PR ISS TGSKDLQMVNI++RVLSRP  + +P +Y+ +G+DYDE+VLPSI NEVLK+VVAKFNA QLITQR QVSLL+R+ L +RAKDFNII+DDVSIT+LSFS QY+ AVE KQ++QQEAQRAQF V +AKQ+++QKI+ AEGEA+AA ++G A+T++ GYLKLR+I+AA+ IA+T++ SQN+ YLNA+ L+LNL ++SF  ++  + K+
Sbjct:   49 YTVEGGHRAIVFNRIGGMQMDTILSEGLHFRIPWIQYPIIYDIRAKPRKISSLTGSKDLQMVNIAVRVLSRPLASNLPIMYQQLGKDYDERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLVRRELYDRAKDFNIILDDVSITELSFSSQYTAAVEAKQVAQQEAQRAQFYVEKAKQDQRQKIIQAEGEAEAAKMLGQAVTKNPGYLKLRRIRAAQNIAKTVAASQNRIYLNADGLVLNLQDQSFFNTLSLMQKK 305          
BLAST of prohibitin-1 vs. Ensembl Medaka
Match: phb (prohibitin [Source:NCBI gene;Acc:101158276])

HSP 1 Score: 266.544 bits (680), Expect = 2.781e-88
Identity = 127/238 (53.36%), Postives = 183/238 (76.89%), Query Frame = 1
Query:  142 MSKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSS-GYLKLRKIKAAEKIARTLSTSQNKAYL 852
            ++ + Y VD G R++IF RF G+++ +  EG H  IP +Q P+IFD RSRPR +   TGSKDLQ VNI+LR+L RP  +++P I+ +IGEDYDE+VLPSI+ EVLKAVVA+F+AG+LITQRE VS  + + L ERA  F +I+DDVS+T L+F ++++EAVE KQ++QQEA+RA+F V +A+Q++Q  I++AEG++QAA+LI ++L  +  G ++LRK++AAE IA  L+ S+N  YL
Sbjct:   22 VNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPVIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVTSQLPRIFTSIGEDYDERVLPSITTEVLKAVVARFDAGELITQRELVSRQVSEDLTERATTFGLILDDVSLTHLTFGKEFTEAVEMKQVAQQEAERARFVVEKAEQQKQATIISAEGDSQAALLIANSLMDAGDGLVELRKLEAAEDIAFQLARSRNVTYL 259          
BLAST of prohibitin-1 vs. Ensembl Medaka
Match: phb (prohibitin [Source:NCBI gene;Acc:101158276])

HSP 1 Score: 266.159 bits (679), Expect = 8.291e-88
Identity = 127/238 (53.36%), Postives = 183/238 (76.89%), Query Frame = 1
Query:  142 MSKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSS-GYLKLRKIKAAEKIARTLSTSQNKAYL 852
            ++ + Y VD G R++IF RF G+++ +  EG H  IP +Q P+IFD RSRPR +   TGSKDLQ VNI+LR+L RP  +++P I+ +IGEDYDE+VLPSI+ EVLKAVVA+F+AG+LITQRE VS  + + L ERA  F +I+DDVS+T L+F ++++EAVE KQ++QQEA+RA+F V +A+Q++Q  I++AEG++QAA+LI ++L  +  G ++LRK++AAE IA  L+ S+N  YL
Sbjct:   50 VNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPVIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVTSQLPRIFTSIGEDYDERVLPSITTEVLKAVVARFDAGELITQRELVSRQVSEDLTERATTFGLILDDVSLTHLTFGKEFTEAVEMKQVAQQEAERARFVVEKAEQQKQATIISAEGDSQAALLIANSLMDAGDGLVELRKLEAAEDIAFQLARSRNVTYL 287          
BLAST of prohibitin-1 vs. Planmine SMEST
Match: SMESG000021272.1 (SMESG000021272.1)

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 290/291 (99.66%), Postives = 291/291 (100.00%), Query Frame = 1
Query:   58 MDQNINISKFIKSPATRXXXXXXXXXXXMSKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGKRKN 930
            MDQNINISKFIKSPATRLLILGGGLLYGMSKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERA+DFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGKRKN
Sbjct:    1 MDQNINISKFIKSPATRLLILGGGLLYGMSKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAQDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGKRKN 291          
BLAST of prohibitin-1 vs. Planmine SMEST
Match: SMESG000021272.1 (SMESG000021272.1)

HSP 1 Score: 530.02 bits (1364), Expect = 0.000e+0
Identity = 262/263 (99.62%), Postives = 263/263 (100.00%), Query Frame = 1
Query:  142 MSKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGKRKN 930
            MSKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERA+DFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGKRKN
Sbjct:    1 MSKSFYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAQDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAEKIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGKRKN 263          
BLAST of prohibitin-1 vs. Planmine SMEST
Match: SMESG000038397.1 (SMESG000038397.1)

HSP 1 Score: 247.669 bits (631), Expect = 4.215e-81
Identity = 116/234 (49.57%), Postives = 173/234 (73.93%), Query Frame = 1
Query:  154 FYTVDGGQRSIIFSRFGGIKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRVLSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQREQVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQRAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSS-GYLKLRKIKAAEKIARTLSTSQNKAYL 852
             YTV GG R++IF R  G++ ++  EG H  IP IQ PII+D+R+RPR +   TGSKDLQ VNI+LR+L +P    +P IY N+G D++E+VLPSI+ EVLK VVA+F+A  LITQRE VS  + ++L  RA +F +++DD+S+T L+F  ++S+AVE KQ++QQEA+RA+F V +A+QE+   I++AEG++QAA L+  +  Q   G+++L++I+ +E+IAR LS ++N  YL
Sbjct:   25 LYTVPGGHRAVIFDRISGVRPDVIGEGTHFLIPWIQKPIIYDIRTRPRNVPVNTGSKDLQKVNITLRILYKPKAEMLPKIYTNLGLDFEERVLPSITYEVLKTVVAQFDASDLITQRELVSNKVNEMLTSRASNFGLMLDDISLTHLTFGTEFSDAVELKQVAQQEAERARFLVEKAEQEKLAAIISAEGDSQAANLLAKSFNQCGEGFIELQRIQTSEEIARLLSKNKNIVYL 258          
The following BLAST results are available for this feature:
BLAST of prohibitin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PHB27.608e-12164.37prohibitin 2 [Source:HGNC Symbol;Acc:HGNC:30306][more]
PHB21.500e-12063.98prohibitin 2 [Source:HGNC Symbol;Acc:HGNC:30306][more]
PHB22.414e-10967.26prohibitin 2 [Source:HGNC Symbol;Acc:HGNC:30306][more]
PHB23.720e-9354.02prohibitin 2 [Source:HGNC Symbol;Acc:HGNC:30306][more]
PHB5.870e-8752.02prohibitin [Source:HGNC Symbol;Acc:HGNC:8912][more]
back to top
BLAST of prohibitin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
phb-21.648e-11362.65Mitochondrial prohibitin complex protein 2 [Sourc... [more]
phb-21.648e-11362.65Mitochondrial prohibitin complex protein 2 [Sourc... [more]
phb-13.087e-8051.84Mitochondrial prohibitin complex protein 1 [Sourc... [more]
back to top
BLAST of prohibitin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Phb21.100e-12966.67gene:FBgn0010551 transcript:FBtr0086614[more]
Phb21.100e-12966.67gene:FBgn0010551 transcript:FBtr0086615[more]
Phb21.100e-12966.67gene:FBgn0010551 transcript:FBtr0086616[more]
Phb21.100e-12966.67gene:FBgn0010551 transcript:FBtr0112863[more]
Phb23.491e-12966.80gene:FBgn0010551 transcript:FBtr0112861[more]
back to top
BLAST of prohibitin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phb2b1.192e-12167.07prohibitin 2b [Source:ZFIN;Acc:ZDB-GENE-040718-430... [more]
phb2b1.192e-12167.07prohibitin 2b [Source:ZFIN;Acc:ZDB-GENE-040718-430... [more]
phb2b1.192e-12167.07prohibitin 2b [Source:ZFIN;Acc:ZDB-GENE-040718-430... [more]
phb2a1.167e-12066.94prohibitin 2a [Source:ZFIN;Acc:ZDB-GENE-030131-314... [more]
phb2.995e-8853.36prohibitin [Source:ZFIN;Acc:ZDB-GENE-030131-6577][more]
back to top
BLAST of prohibitin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cgref19.104e-12164.09cell growth regulator with EF-hand domain 1 [Sourc... [more]
cgref11.239e-12065.61cell growth regulator with EF-hand domain 1 [Sourc... [more]
cgref11.239e-12065.61cell growth regulator with EF-hand domain 1 [Sourc... [more]
phb3.387e-8551.68prohibitin [Source:NCBI gene;Acc:394635][more]
back to top
BLAST of prohibitin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Phb21.030e-12063.98prohibitin 2 [Source:MGI Symbol;Acc:MGI:102520][more]
Phb1.141e-8752.42prohibitin [Source:MGI Symbol;Acc:MGI:97572][more]
Phb1.510e-7155.14prohibitin [Source:MGI Symbol;Acc:MGI:97572][more]
Phb21.140e-5547.34prohibitin 2 [Source:MGI Symbol;Acc:MGI:102520][more]
Phb27.160e-4774.23prohibitin 2 [Source:MGI Symbol;Acc:MGI:102520][more]
back to top
BLAST of prohibitin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A9UMS3|PHB2_XENTR4.823e-12064.09Prohibitin-2 OS=Xenopus tropicalis OX=8364 GN=phb2... [more]
sp|Q2HJ97|PHB2_BOVIN5.481e-12063.98Prohibitin-2 OS=Bos taurus OX=9913 GN=PHB2 PE=2 SV... [more]
sp|Q5XIH7|PHB2_RAT5.852e-12063.98Prohibitin-2 OS=Rattus norvegicus OX=10116 GN=Phb2... [more]
sp|O35129|PHB2_MOUSE7.202e-12063.98Prohibitin-2 OS=Mus musculus OX=10090 GN=Phb2 PE=1... [more]
sp|Q99623|PHB2_HUMAN7.202e-12063.98Prohibitin-2 OS=Homo sapiens OX=9606 GN=PHB2 PE=1 ... [more]
back to top
BLAST of prohibitin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIH00.000e+099.66Prohibitin OS=Schmidtea mediterranea OX=79327 PE=2... [more]
A0A0A7AD707.475e-17290.08Prohibitin OS=Dugesia japonica OX=6161 GN=Phb2 PE=... [more]
A0A5S6Q8Q81.828e-13270.23Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A1D1VV901.852e-13269.58Prohibitin OS=Ramazzottius varieornatus OX=947166 ... [more]
A0A3P7LBU42.604e-13169.85Prohibitin OS=Dibothriocephalus latus OX=60516 GN=... [more]
back to top
BLAST of prohibitin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phb2a6.095e-12366.80prohibitin-2-like [Source:NCBI gene;Acc:103035142][more]
phb2b3.957e-12166.13prohibitin-2-like [Source:NCBI gene;Acc:103047478][more]
phb2b8.043e-11462.60prohibitin-2-like [Source:NCBI gene;Acc:103047478][more]
phb2a1.547e-11264.78prohibitin-2-like [Source:NCBI gene;Acc:103035142][more]
phb4.667e-8853.78prohibitin [Source:NCBI gene;Acc:103031128][more]
back to top
BLAST of prohibitin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
phb4.701e-9054.32prohibitin [Source:ZFIN;Acc:ZDB-GENE-030131-6577][more]
ENSPMAT00000006512.11.633e-6074.17pep scaffold:Pmarinus_7.0:GL479067:257:4164:-1 gen... [more]
back to top
BLAST of prohibitin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
PHB21.391e-9554.29Subunit of the prohibitin complex (Phb1p-Phb2p); p... [more]
PHB18.498e-8447.88Subunit of the prohibitin complex (Phb1p-Phb2p); p... [more]
back to top
BLAST of prohibitin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO423482.440e-12263.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494862.294e-9051.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of prohibitin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
phb2b1.434e-11763.42prohibitin 2 [Source:NCBI gene;Acc:101159337][more]
phb2.781e-8853.36prohibitin [Source:NCBI gene;Acc:101158276][more]
phb8.291e-8853.36prohibitin [Source:NCBI gene;Acc:101158276][more]
back to top
BLAST of prohibitin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000021272.10.000e+099.66SMESG000021272.1[more]
SMESG000021272.10.000e+099.62SMESG000021272.1[more]
SMESG000038397.14.215e-8149.57SMESG000038397.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30020615
GenBankAFJ24824.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020615 ID=SMED30020615|Name=prohibitin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=989bp
TTGTCTTGTGTTTTAATTAAGAAAACTTTTGAAAAAACCTGCGCACGCCA
TTAATAAATGGATCAAAATATTAATATATCAAAATTTATAAAAAGCCCTG
CTACACGCTTATTAATACTCGGAGGAGGTCTTTTATATGGCATGAGCAAA
TCTTTTTATACAGTTGATGGTGGCCAAAGGAGTATTATTTTCAGTAGATT
TGGGGGAATTAAAGAAAATATTTATGCTGAAGGACTTCATCTTAGAATTC
CTGGTATACAATATCCAATTATTTTTGATGTTAGATCCCGTCCTAGAATT
ATTTCTTCGCCAACTGGTAGTAAAGATTTGCAAATGGTGAATATTTCATT
AAGAGTATTAAGCAGACCAGATATGGCAAAAATTCCCGATATTTATCGAA
ATATTGGTGAAGACTATGATGAGAAAGTGTTACCGTCTATATCAAATGAG
GTTTTAAAAGCTGTTGTTGCAAAATTCAACGCTGGTCAGCTAATAACTCA
AAGAGAACAGGTGTCTTTGTTAATTCGAAAGCTTCTAATAGAAAGAGCTA
AAGATTTTAACATAATTGTTGATGACGTTTCGATTACGGATTTATCATTT
TCCAGACAATATAGCGAAGCAGTCGAACGAAAACAAATTTCACAACAAGA
AGCTCAAAGGGCTCAATTTACTGTAATGCGAGCTAAACAAGAACGACAGC
AGAAAATTGTCAACGCCGAAGGAGAGGCACAAGCTGCAGTTTTGATTGGA
GATGCTTTAACCCAGAGTTCCGGTTATTTGAAGCTACGTAAAATAAAGGC
TGCCGAAAAGATTGCGCGGACATTGTCGACTTCTCAAAATAAGGCTTATT
TGAATGCGAATACTCTGATGCTGAATTTGAACGAGAAGAGTTTCAACGAA
AGTGTGGAACACATAGGCAAACGTAAAAATTAAAAATTCACATAAAAATA
TTAGTTCGATTTAAATAAATTACAAACTGTGTTGTCTTG
back to top

protein sequence of SMED30020615-orf-1

>SMED30020615-orf-1 ID=SMED30020615-orf-1|Name=SMED30020615-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=292bp
MDQNINISKFIKSPATRLLILGGGLLYGMSKSFYTVDGGQRSIIFSRFGG
IKENIYAEGLHLRIPGIQYPIIFDVRSRPRIISSPTGSKDLQMVNISLRV
LSRPDMAKIPDIYRNIGEDYDEKVLPSISNEVLKAVVAKFNAGQLITQRE
QVSLLIRKLLIERAKDFNIIVDDVSITDLSFSRQYSEAVERKQISQQEAQ
RAQFTVMRAKQERQQKIVNAEGEAQAAVLIGDALTQSSGYLKLRKIKAAE
KIARTLSTSQNKAYLNANTLMLNLNEKSFNESVEHIGKRKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0016020membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036013Band_7/SPFH_dom_sf
IPR000163Prohibitin
IPR001107Band_7
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000163ProhibitinPRINTSPR00679PROHIBITINcoord: 94..113
score: 58.46
coord: 117..135
score: 76.52
coord: 140..156
score: 69.23
coord: 188..211
score: 64.1
coord: 163..182
score: 60.0
coord: 211..227
score: 56.56
coord: 76..92
score: 68.78
IPR000163ProhibitinPANTHERPTHR23222PROHIBITINcoord: 19..281
IPR000163ProhibitinCDDcd03401SPFH_prohibitincoord: 33..227
e-value: 2.58086E-90
score: 264.761
IPR001107Band 7 domainSMARTSM00244PHB_4coord: 32..193
e-value: 1.2E-40
score: 151.0
IPR001107Band 7 domainPFAMPF01145Band_7coord: 35..214
e-value: 4.3E-20
score: 72.5
NoneNo IPR availablePANTHERPTHR23222:SF1PROHIBITIN-2coord: 19..281
IPR036013Band 7/SPFH domain superfamilySUPERFAMILYSSF117892Band 7/SPFH domaincoord: 64..199