Kynurenine 3-monooxygenase

Overview
NameKynurenine 3-monooxygenase
Smed IDSMED30020600
Length (bp)1488
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kynurenine 3-monooxygenase (SMED30020600) t-SNE clustered cells

Violin plots show distribution of expression levels for Kynurenine 3-monooxygenase (SMED30020600) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kynurenine 3-monooxygenase (SMED30020600) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kynurenine 3-monooxygenase (SMED30020600) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020600

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30020600SMESG000055694.1 SmedASXL_011861SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30020600SMESG000055694.1 SmedASXL_011861SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30020600SMESG000055694.1 dd_Smed_v4_6831_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30020600SMESG000055694.1 SMU15032738SMUPMID:27240733
Stubenhaus et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
prepharyngeal regionSMED30020600SMESG000055694.1 SMU15032738SMUPMID:27240733
Stubenhaus et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30020600SMESG000055694.1 SMU15032738SMUPMID:27240733
Stubenhaus et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Human
Match: KMO (kynurenine 3-monooxygenase [Source:HGNC Symbol;Acc:HGNC:6381])

HSP 1 Score: 357.451 bits (916), Expect = 3.570e-118
Identity = 185/414 (44.69%), Postives = 267/414 (64.49%), Query Frame = 2
Query:  167 FDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQK-RIAKFSNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILTIFGFIGRAALAIS---LLIGY 1396
            F + + E R D R+ T   GRSINL+LSHRGR+AL+AVGLE+ I+   I M ARMIH   G    IPYG  +++  +V R+ LN+ LLT AE   NV + F  +L+  + ++  I    + K  +++  DL+VG DGAYSTVR  + K  RFD+SQ++IPHGY EL  PP   D + M+ N LHIWPRN FM+I LPN   SFT TLFMPF+ F+K+ T ++++ FF KYFPDA+ L+G+  L + +F   A  M+++KC+ ++F+  CV++GDAAHA+VPF+GQGMN GFED L+F E++ + +  L      F+  R  D   I DL+ YNY+EMR  V+S  F+ +K  +  ++ + PS ++PLY+MV+F+RI Y   ++    Q +++    F   + +AIS   LLI Y
Sbjct:   32 FQIDVYEAREDTRVATFTRGRSINLALSHRGRQALKAVGLEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKDLLTAAEKYPNVKMHFNHRLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKKPRFDYSQQYIPHGYMELTIPPKNGD-YAMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMPFEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVKCSSFHFKSHCVLLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRIPDDHAISDLSMYNYIEMRAHVNSSWFIFQKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKKVINKGLFFLGSLIAISSTYLLIHY 444          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Human
Match: KMO (kynurenine 3-monooxygenase [Source:HGNC Symbol;Acc:HGNC:6381])

HSP 1 Score: 338.191 bits (866), Expect = 6.520e-111
Identity = 180/414 (43.48%), Postives = 259/414 (62.56%), Query Frame = 2
Query:  167 FDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQK-RIAKFSNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILTIFGFIGRAALAIS---LLIGY 1396
            F + + E R D R+ T   GRSINL+LSHRGR+AL+AVGLE+ I+   I M ARMIH   G    IPYG  +++  +V R+ LN+ LLT AE   NV + F  +L+  + ++  I    + K  +++  DL+VG DGAYSTVR  + K  RFD+SQ++IPHGY EL  PP   D + M+ N LHIWPRN FM+I LPN   SFT TLFMPF+ F+K+ T ++++ FF KYFPDA+ L+G+  L + +F   A  M+++KC+ ++F+  CV++GDAAHA+VPF+GQGMN GFED L+F E++ + +  L      F+  R  D   I DL+ YNY+E             K  +  ++ + PS ++PLY+MV+F+RI Y   ++    Q +++    F   + +AIS   LLI Y
Sbjct:   32 FQIDVYEAREDTRVATFTRGRSINLALSHRGRQALKAVGLEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKDLLTAAEKYPNVKMHFNHRLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKKPRFDYSQQYIPHGYMELTIPPKNGD-YAMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMPFEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVKCSSFHFKSHCVLLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRIPDDHAISDLSMYNYIE-------------KNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKKVINKGLFFLGSLIAISSTYLLIHY 431          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Human
Match: KMO (kynurenine 3-monooxygenase [Source:HGNC Symbol;Acc:HGNC:6381])

HSP 1 Score: 314.694 bits (805), Expect = 4.667e-102
Identity = 159/337 (47.18%), Postives = 223/337 (66.17%), Query Frame = 2
Query:  167 FDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQK-RIAKFSNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEM 1174
            F + + E R D R+ T   GRSINL+LSHRGR+AL+AVGLE+ I+   I M ARMIH   G    IPYG  +++  +V R+ LN+ LLT AE   NV + F  +L+  + ++  I    + K  +++  DL+VG DGAYSTVR  + K  RFD+SQ++IPHGY EL  PP   D + M+ N LHIWPRN FM+I LPN   SFT TLFMPF+ F+K+ T ++++ FF KYFPDA+ L+G+  L + +F   A  M+++KC+ ++F+  CV++GDAAHA+VPF+GQGMN GFED L+F E++ + +  L      F+  R  D   I DL+ YNY+E+
Sbjct:   32 FQIDVYEAREDTRVATFTRGRSINLALSHRGRQALKAVGLEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKDLLTAAEKYPNVKMHFNHRLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKKPRFDYSQQYIPHGYMELTIPPKNGD-YAMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMPFEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVKCSSFHFKSHCVLLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRIPDDHAISDLSMYNYIEV 367          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Human
Match: KMO (kynurenine 3-monooxygenase [Source:HGNC Symbol;Acc:HGNC:6381])

HSP 1 Score: 84.7297 bits (208), Expect = 1.494e-18
Identity = 47/129 (36.43%), Postives = 74/129 (57.36%), Query Frame = 2
Query: 1019 GMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILTIFGFIGRAALAIS---LLIGY 1396
            GMN GFED L+F E++ + +  L      F+  R  D   I DL+ YNY+EMR  V+S  F+ +K  +  ++ + PS ++PLY+MV+F+RI Y   ++    Q +++    F   + +AIS   LLI Y
Sbjct:    2 GMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRIPDDHAISDLSMYNYIEMRAHVNSSWFIFQKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKKVINKGLFFLGSLIAISSTYLLIHY 130          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Celegans
Match: kmo-1 (Kynurenine 3-monooxygenase [Source:UniProtKB/Swiss-Prot;Acc:Q21795])

HSP 1 Score: 351.288 bits (900), Expect = 1.320e-116
Identity = 188/434 (43.32%), Postives = 268/434 (61.75%), Query Frame = 2
Query:  146 FFSKTDQFDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHG-NLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKR------------IAKFSNGKFIEE-----IQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDK-IKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRIL-------TIFGFIGRAA 1369
            FF++   +DV + E R DIR      GRSINL+LS RG+ AL AVGL+E I+   + +YAR+IH+  G    R PYG+P E   +++R+ LNE+++T+AE + NV   F  K+ +VD  K+            I  F N    +E     ++ DL++  DGAYS VR+ +    RFDFSQE+I HGY EL      ++ F  + N  H+WPR  F LI L N   +FT T+F PF  F+K + T +++L+FF + FPDA  L+GK ++   +       +V+IKC+P++F ++ V+MGDAAHAMVPFYGQGMNCGFED L+F E L+E    +      +++ R  DA +I DLA YNY E++  V+  S+ +RKKFD +MN +FP  W+PLYSMV+F+RIPYS  ++ RK+QD+IL       +    IG AA
Sbjct:   19 FFAQKG-WDVSVYEFRKDIRTMKHVQGRSINLALSQRGKSALEAVGLKEYIVNQGVPLYARLIHNKDGKTYSRQPYGKPGEHIVSINRRHLNEVMITQAEKSPNVKFFFEHKVKNVDYDKKQLVVQCTSQPSKIPTFGNKSPPQEHAEFHVEADLILACDGAYSAVRRSLMTIPRFDFSQEYIEHGYVELNIM-ANNNEFAFEENVFHLWPRGHFTLIALANRDKTFTVTIFAPFSEFEKHMSTSEDVLSFFEENFPDAFLLLGKEHIADTFNRVKPQPLVSIKCSPHSFFDNLVLMGDAAHAMVPFYGQGMNCGFEDCLVFSETLEEYGNDIAKAVKVYSDGRVNDAHSINDLAMYNYEELKDLVNKSSYKLRKKFDTIMNSIFPKSWIPLYSMVTFSRIPYSEVIERRKRQDKILSRIMTTTSTLALIGAAA 450          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Celegans
Match: kmo-2 (Kynurenine 3-MonoOxygenase [Source:UniProtKB/TrEMBL;Acc:Q21794])

HSP 1 Score: 183.341 bits (464), Expect = 3.777e-52
Identity = 112/395 (28.35%), Postives = 207/395 (52.41%), Query Frame = 2
Query:  185 EKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIH--DTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKFSNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDK-IKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKE-NNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSV-SSKSFL--IRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILTIF 1348
            E R D R +    G+SINL+L  R    ++ +GL+E ++   + +  ++ H  DT G LKR+P    ++F   ++R+ L+++L+ EAE   NV   F CK    DL+       N   +  +  DL +  DGA+S++R+ + K   F+FSQ++   GY +L     +     + +   + W R   +L+ + N   S T ++F  F  F+  +    E + FF   F +  +++G+ ++          ++++++C+ + F +  V+MGDAAHAMVPF GQG+NCGFED L+  EI+ +    +LE+   E+++ R  +   I  + +   + +  SV  S  ++  IR     L+ F+FPS     +++ +F+R  YS   ++ +  ++  ++F
Sbjct:   31 ESRFDPRGNHMENGKSINLALGVRAMSTMKRIGLKEKVIHIGVPIRDQIAHFGDTKGKLKRLPVLNDDDFILTINRQELSQILINEAEKYNNVKFHFNCKATKFDLKSESLIVQNSDNLSTVDGDLFLACDGAHSSIRRSLLKAPGFNFSQKYSEFGYIDL--SVNSTQQCDLKLGTHYSWRRRGIILVAIVNKDQSLTVSMFATFSEFESNLVGPVESVLFFKNNFYEIFKILGEDHIRNTIARNKPQAIISVQCSQHVFFDKLVLMGDAAHAMVPFNGQGVNCGFEDCLVLQEIMDQYEEDELEDVIKEYSKVRTNETNIINQMEWDVNLTLTSSVHGSLGWIREIRAHIKLLLCFIFPS----SFTLAAFSREKYSEIARKAQIVEKCTSLF 419          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Celegans
Match: kmo-2 (Kynurenine 3-MonoOxygenase [Source:UniProtKB/TrEMBL;Acc:Q21794])

HSP 1 Score: 180.259 bits (456), Expect = 1.856e-51
Identity = 108/382 (28.27%), Postives = 202/382 (52.88%), Query Frame = 2
Query:  224 GRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIH--DTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKFSNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDK-IKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKE-NNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSV-SSKSFL--IRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILTIF 1348
            G+SINL+L  R    ++ +GL+E ++   + +  ++ H  DT G LKR+P    ++F   ++R+ L+++L+ EAE   NV   F CK    DL+       N   +  +  DL +  DGA+S++R+ + K   F+FSQ++   GY +L     +     + +   + W R   +L+ + N   S T ++F  F  F+  +    E + FF   F +  +++G+ ++          ++++++C+ + F +  V+MGDAAHAMVPF GQG+NCGFED L+  EI+ +    +LE+   E+++ R  +   I  + +   + +  SV  S  ++  IR     L+ F+FPS     +++ +F+R  YS   ++ +  ++  ++F
Sbjct:    4 GKSINLALGVRAMSTMKRIGLKEKVIHIGVPIRDQIAHFGDTKGKLKRLPVLNDDDFILTINRQELSQILINEAEKYNNVKFHFNCKATKFDLKSESLIVQNSDNLSTVDGDLFLACDGAHSSIRRSLLKAPGFNFSQKYSEFGYIDL--SVNSTQQCDLKLGTHYSWRRRGIILVAIVNKDQSLTVSMFATFSEFESNLVGPVESVLFFKNNFYEIFKILGEDHIRNTIARNKPQAIISVQCSQHVFFDKLVLMGDAAHAMVPFNGQGVNCGFEDCLVLQEIMDQYEEDELEDVIKEYSKVRTNETNIINQMEWDVNLTLTSSVHGSLGWIREIRAHIKLLLCFIFPSS----FTLAAFSREKYSEIARKAQIVEKCTSLF 379          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Celegans
Match: kmo-2 (Kynurenine 3-MonoOxygenase [Source:UniProtKB/TrEMBL;Acc:Q21794])

HSP 1 Score: 180.259 bits (456), Expect = 1.856e-51
Identity = 108/382 (28.27%), Postives = 202/382 (52.88%), Query Frame = 2
Query:  224 GRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIH--DTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKFSNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDK-IKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKE-NNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSV-SSKSFL--IRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILTIF 1348
            G+SINL+L  R    ++ +GL+E ++   + +  ++ H  DT G LKR+P    ++F   ++R+ L+++L+ EAE   NV   F CK    DL+       N   +  +  DL +  DGA+S++R+ + K   F+FSQ++   GY +L     +     + +   + W R   +L+ + N   S T ++F  F  F+  +    E + FF   F +  +++G+ ++          ++++++C+ + F +  V+MGDAAHAMVPF GQG+NCGFED L+  EI+ +    +LE+   E+++ R  +   I  + +   + +  SV  S  ++  IR     L+ F+FPS     +++ +F+R  YS   ++ +  ++  ++F
Sbjct:    4 GKSINLALGVRAMSTMKRIGLKEKVIHIGVPIRDQIAHFGDTKGKLKRLPVLNDDDFILTINRQELSQILINEAEKYNNVKFHFNCKATKFDLKSESLIVQNSDNLSTVDGDLFLACDGAHSSIRRSLLKAPGFNFSQKYSEFGYIDL--SVNSTQQCDLKLGTHYSWRRRGIILVAIVNKDQSLTVSMFATFSEFESNLVGPVESVLFFKNNFYEIFKILGEDHIRNTIARNKPQAIISVQCSQHVFFDKLVLMGDAAHAMVPFNGQGVNCGFEDCLVLQEIMDQYEEDELEDVIKEYSKVRTNETNIINQMEWDVNLTLTSSVHGSLGWIREIRAHIKLLLCFIFPSS----FTLAAFSREKYSEIARKAQIVEKCTSLF 379          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Fly
Match: cn (gene:FBgn0000337 transcript:FBtr0344723)

HSP 1 Score: 333.954 bits (855), Expect = 1.012e-109
Identity = 189/406 (46.55%), Postives = 250/406 (61.58%), Query Frame = 2
Query:  173 VLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNN----AVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKFSN-GKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILT-IFGFIGRAAL 1372
            V L E R DIR      GRSINL+LS RGR+AL AVGLE+ +L ++I M  RM+HD  GN   + Y   +  NN    +V R+ LNE+LL   +   N+   F  KL   +L++   +F N  K       DL+VG DGA+S+VRQ   +   F++SQE+I  GY EL  P  + D F M  N LHIWPRN FM+I LPN   SFT TL MPF+IF  I+ +++LL FF   F DAL L+G+  L K +F      +V+IKC PY++ +  +I+GDAAHAMVP+YGQGMN G ED+ +  +IL +    L+ T + FTE R +DA  ICDLA YNYVEMR      +F +RK  D L+  LFP  W+PLY+ VSF+ +PY  C+  RK QD++L  IFG    AA+
Sbjct:   54 VDLYEYREDIRQALVVQGRSINLALSQRGRKALAAVGLEQEVLATAIPMRGRMLHDVRGNSSVVLY---DPINNQCLYSVGRRQLNEVLLNACDKLPNIRCHFEHKLTSANLREGSMEFRNPAKEAVAAHADLIVGCDGAFSSVRQNNVRLPGFNYSQEYIETGYLELCIPSKSGD-FQMPANYLHIWPRNTFMMIALPNQDKSFTVTLSMPFEIFAGIQNQNDLLEFFKLNFRDALPLIGEQQLIKDFFKTRPQFLVSIKCRPYHYADKALILGDAAHAMVPYYGQGMNAGMEDVTLLTDILAK-QLPLDETLALFTESRWQDAFAICDLAMYNYVEMRDLTKRWTFRLRKWLDTLLFRLFPG-WIPLYNSVSFSSMPYRQCIANRKWQDQLLKRIFGATFLAAI 453          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Zebrafish
Match: kmo (kynurenine 3-monooxygenase [Source:NCBI gene;Acc:368242])

HSP 1 Score: 387.882 bits (995), Expect = 2.162e-130
Identity = 201/407 (49.39%), Postives = 265/407 (65.11%), Query Frame = 2
Query:  167 FDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKF--SNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILT----IFGFIGRAA 1369
            FDV + E R DIR      GRSINL+LSHRGR+AL+ VG+E+ I+   I M+ARMIH+ +G    IPYG+  ++  +VDR  LN+ LLT AE+  N  + F  KL D   +     F  S+G+   E Q DL+VG DGA+S VR+   +  RF++SQ +IPHGY EL  PP  D  F M+ N LHIWPRN FM+I LPN   +FT TLFMPF+ F+KI+T DELL FF KYFPD++ L+G   L++ +F   A +MV++KC PY+  E CV+MGDAAHA+VPFYGQGMN GFED L+F EI+ + N  L     E+T  R  D   I DLA YNY+EMR  V+SK F+ RK  DNL++F  P   VPLY+MV+FTR  Y+  +     Q++++T    + GF+  A 
Sbjct:   40 FDVEVYESREDIRQAKVVKGRSINLALSHRGRQALKHVGMEDKIVSKGIPMHARMIHNVNGKRSPIPYGKKGQYILSVDRANLNKELLTAAEAYPNTRLNFNHKLHDWSPKTGTMTFIGSDGQ-KTETQADLIVGCDGAFSAVRKQFLRQSRFNYSQTYIPHGYMELTMPP-KDGDFAMEPNYLHIWPRNTFMMIALPNLDRTFTCTLFMPFEDFEKIRTGDELLRFFHKYFPDSVPLIGVEALKQDFFRLPAQAMVSVKCCPYHLFEKCVLMGDAAHAVVPFYGQGMNAGFEDCLVFDEIMDQFNENLAAVLQEYTRVRVPDDHAIADLAMYNYIEMRAHVNSKYFIFRKYLDNLLHFFMPQTIVPLYTMVTFTRTRYNDAVNRWHWQNKVITRGLWLCGFVSAAG 444          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Xenopus
Match: bend3 (BEN domain containing 3 [Source:Xenbase;Acc:XB-GENE-6051071])

HSP 1 Score: 374.785 bits (961), Expect = 3.766e-125
Identity = 199/422 (47.16%), Postives = 269/422 (63.74%), Query Frame = 2
Query:  146 FFSKTDQFDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKF-SNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILTI-------FGFIGRAALAISLL 1387
            FF+K   F V L E R DIR      GRSINL+LSHRG +AL+AVGL+E I    I M ARMIH   G    IPYG+ +++  +VDR  LN+ LL+ AE   NVT+ F  KL D ++      F +N + I E + DL+VG DGA+S VR+   +  RF++S  +IPHGYKEL  PP   + F M+ N LHIWPRN FM+I LPN   SFT TLFMPF+ F+K+ T D++L FF  YFPD++EL+G+  L + +F     +M+++KC+ +  +  CVIMGDAAHA+VPFYGQGMN GFED L+F E++++    L     EF+  R  DA  I DLA YNY EMR  V+SK F+ RK+ DN++N + P+ ++PLY+MV+F+RI Y   +   K Q +I+ +        G +G A L I  L
Sbjct:   26 FFAKKG-FQVELYEAREDIRYARMVSGRSINLALSHRGLQALKAVGLDEKIAAMGIPMRARMIHSVKGRKSSIPYGKQHQYILSVDRANLNKELLSAAEKYSNVTMHFEHKLRDCNVDSGTMTFLNNMENIIEKKADLIVGCDGAFSVVRKQFMRKSRFNYSHVYIPHGYKELTIPPRKGE-FAMEPNYLHIWPRNTFMMIALPNLDKSFTCTLFMPFEDFEKLTTGDQVLDFFKTYFPDSIELIGEKKLTEDFFLLPPQAMISVKCSSFCIDHKCVIMGDAAHAVVPFYGQGMNAGFEDCLVFSELMEQYQNNLRICLHEFSRLRVPDAHAISDLAMYNYKEMRAHVNSKWFIFRKQVDNILNAIMPTTFIPLYTMVTFSRIRYHEVILRWKWQKKIINVGLFTVGTTGSVGAAYLVIKYL 445          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Xenopus
Match: bend3 (BEN domain containing 3 [Source:Xenbase;Acc:XB-GENE-6051071])

HSP 1 Score: 368.237 bits (944), Expect = 4.086e-123
Identity = 192/397 (48.36%), Postives = 259/397 (65.24%), Query Frame = 2
Query:  146 FFSKTDQFDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKF-SNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDR 1333
            FF+K   F V L E R DIR      GRSINL+LSHRG +AL+AVGL+E I    I M ARMIH   G    IPYG+ +++  +VDR  LN+ LL+ AE   NVT+ F  KL D ++      F +N + I E + DL+VG DGA+S VR+   +  RF++S  +IPHGYKEL  PP   + F M+ N LHIWPRN FM+I LPN   SFT TLFMPF+ F+K+ T D++L FF  YFPD++EL+G+  L + +F     +M+++KC+ +  +  CVIMGDAAHA+VPFYGQGMN GFED L+F E++++    L     EF+  R  DA  I DLA YNY EMR  V+SK F+ RK+ DN++N + P+ ++PLY+MV+F+RI Y   +   K Q +
Sbjct:   26 FFAKKG-FQVELYEAREDIRYARMVSGRSINLALSHRGLQALKAVGLDEKIAAMGIPMRARMIHSVKGRKSSIPYGKQHQYILSVDRANLNKELLSAAEKYSNVTMHFEHKLRDCNVDSGTMTFLNNMENIIEKKADLIVGCDGAFSVVRKQFMRKSRFNYSHVYIPHGYKELTIPPRKGE-FAMEPNYLHIWPRNTFMMIALPNLDKSFTCTLFMPFEDFEKLTTGDQVLDFFKTYFPDSIELIGEKKLTEDFFLLPPQAMISVKCSSFCIDHKCVIMGDAAHAVVPFYGQGMNAGFEDCLVFSELMEQYQNNLRICLHEFSRLRVPDAHAISDLAMYNYKEMRAHVNSKWFIFRKQVDNILNAIMPTTFIPLYTMVTFSRIRYHEVILRWKWQKK 420          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Xenopus
Match: bend3 (BEN domain containing 3 [Source:Xenbase;Acc:XB-GENE-6051071])

HSP 1 Score: 337.806 bits (865), Expect = 1.049e-110
Identity = 185/426 (43.43%), Postives = 259/426 (60.80%), Query Frame = 2
Query:  146 FFSKTDQFDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKF-SNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDT----FLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILTI-------FGFIGRAALAISLL 1387
            FF+K   F V L E R DIR      GRSINL+LSHRG +AL+AVGL+E I    I M ARMIH   G    IPYG+ +++  +VDR  LN+ LL+ AE   NVT+ F  KL D ++      F +N + I E + DL+VG DGA+S VR+   +  RF++S  +IPHGYKEL  PP   +       + ++         F+++ L     SFT TLFMPF+ F+K+ T D++L FF  YFPD++EL+G+  L + +F     +M+++KC+ +  +  CVIMGDAAHA+VPFYGQGMN GFED L+F E++++    L     EF+  R  DA  I DLA YNY EMR  V+SK F+ RK+ DN++N + P+ ++PLY+MV+F+RI Y   +   K Q +I+ +        G +G A L I  L
Sbjct:   26 FFAKKG-FQVELYEAREDIRYARMVSGRSINLALSHRGLQALKAVGLDEKIAAMGIPMRARMIHSVKGRKSSIPYGKQHQYILSVDRANLNKELLSAAEKYSNVTMHFEHKLRDCNVDSGTMTFLNNMENIIEKKADLIVGCDGAFSVVRKQFMRKSRFNYSHVYIPHGYKELTIPPRKGEVRFSVVFLFLDAKMCKKNKTFLMVCLFQQDKSFTCTLFMPFEDFEKLTTGDQVLDFFKTYFPDSIELIGEKKLTEDFFLLPPQAMISVKCSSFCIDHKCVIMGDAAHAVVPFYGQGMNAGFEDCLVFSELMEQYQNNLRICLHEFSRLRVPDAHAISDLAMYNYKEMRAHVNSKWFIFRKQVDNILNAIMPTTFIPLYTMVTFSRIRYHEVILRWKWQKKIINVGLFTVGTTGSVGAAYLVIKYL 450          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Xenopus
Match: bend3 (BEN domain containing 3 [Source:Xenbase;Acc:XB-GENE-6051071])

HSP 1 Score: 314.694 bits (805), Expect = 7.139e-103
Identity = 172/383 (44.91%), Postives = 233/383 (60.84%), Query Frame = 2
Query:  146 FFSKTDQFDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKF-SNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPP--GADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFT 1285
            FF+K   F V L E R DIR      GRSINL+LSHRG +AL+AVGL+E I    I M ARMIH   G    IPYG+ +++  +VDR  LN+ LL+ AE   NVT+ F  KL D ++      F +N + I E + DL+VG DGA+S VR+   +  RF++S  +IPHGYKEL  PP  G D                            SFT TLFMPF+ F+K+ T D++L FF  YFPD++EL+G+  L + +F     +M+++KC+ +  +  CVIMGDAAHA+VPFYGQGMN GFED L+F E++++    L     EF+  R  DA  I DLA YNY EMR  V+SK F+ RK+ DN++N + P+ ++PLY+MV  +
Sbjct:   26 FFAKKG-FQVELYEAREDIRYARMVSGRSINLALSHRGLQALKAVGLDEKIAAMGIPMRARMIHSVKGRKSSIPYGKQHQYILSVDRANLNKELLSAAEKYSNVTMHFEHKLRDCNVDSGTMTFLNNMENIIEKKADLIVGCDGAFSVVRKQFMRKSRFNYSHVYIPHGYKELTIPPRKGEDK---------------------------SFTCTLFMPFEDFEKLTTGDQVLDFFKTYFPDSIELIGEKKLTEDFFLLPPQAMISVKCSSFCIDHKCVIMGDAAHAVVPFYGQGMNAGFEDCLVFSELMEQYQNNLRICLHEFSRLRVPDAHAISDLAMYNYKEMRAHVNSKWFIFRKQVDNILNAIMPTTFIPLYTMVRIS 380          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Mouse
Match: Kmo (kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) [Source:MGI Symbol;Acc:MGI:2138151])

HSP 1 Score: 363.229 bits (931), Expect = 8.941e-121
Identity = 183/413 (44.31%), Postives = 264/413 (63.92%), Query Frame = 2
Query:  146 FFSKTDQFDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVD-VDLQKRIAKFSNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILTIFGFIGRAALAIS 1381
            F +K + F V + E R DIR+     GRSINL+LS+RGR+AL+A+GLE+ I+   + M ARMIH   G    IPYG  +++  ++ R+ LN+ LLT  ES  N  + FG KL   +  +  +      K   ++  DL+VG DGAYSTVR  + K  RFD++Q++IPHGY EL  PP  +  + M+ NCLHIWPRN +M+I LPN   SFT TLFMPF+ F+++ T+ ++L FF K FPDA+ LMG+  L + +F   A  M+++KC+P++ +  CV+MGDAAHA+VPF+GQGMN GFED L+F E++ + N  L     EF+  R  D   I DL+ YNY+EMR  V+S+ FL +K  D  ++ + PS ++PLY+MV+FTRI Y   +     Q +++    F+  + +AI 
Sbjct:   26 FLAKRN-FQVDVYEAREDIRVAKSARGRSINLALSYRGRQALKAIGLEDQIVSKGVPMKARMIHSLSGKKSAIPYGNKSQYILSISRENLNKDLLTAVESYANAKVHFGHKLSKCIPEEGVLTVLGPDKVPRDVTCDLVVGCDGAYSTVRAHLMKKPRFDYTQQYIPHGYMELTIPP-KNGEYAMEPNCLHIWPRNAYMMIALPNMDKSFTCTLFMPFEEFERLPTRSDVLDFFQKNFPDAIPLMGEQALMRDFFLLPAQPMISVKCSPFHLKSHCVLMGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFNNNLSMCLPEFSRFRIPDDHAISDLSMYNYIEMRAHVNSRWFLFQKLLDKFLHAIMPSTFIPLYTMVAFTRIRYHEAVLRWHWQKKVINRGLFVLGSLIAIG 436          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Mouse
Match: Kmo (kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) [Source:MGI Symbol;Acc:MGI:2138151])

HSP 1 Score: 320.087 bits (819), Expect = 2.684e-104
Identity = 159/344 (46.22%), Postives = 224/344 (65.12%), Query Frame = 2
Query:  146 FFSKTDQFDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVD-VDLQKRIAKFSNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEM 1174
            F +K + F V + E R DIR+     GRSINL+LS+RGR+AL+A+GLE+ I+   + M ARMIH   G    IPYG  +++  ++ R+ LN+ LLT  ES  N  + FG KL   +  +  +      K   ++  DL+VG DGAYSTVR  + K  RFD++Q++IPHGY EL  PP  +  + M+ NCLHIWPRN +M+I LPN   SFT TLFMPF+ F+++ T+ ++L FF K FPDA+ LMG+  L + +F   A  M+++KC+P++ +  CV+MGDAAHA+VPF+GQGMN GFED L+F E++ + N  L     EF+  R  D   I DL+ YNY+E+
Sbjct:   26 FLAKRN-FQVDVYEAREDIRVAKSARGRSINLALSYRGRQALKAIGLEDQIVSKGVPMKARMIHSLSGKKSAIPYGNKSQYILSISRENLNKDLLTAVESYANAKVHFGHKLSKCIPEEGVLTVLGPDKVPRDVTCDLVVGCDGAYSTVRAHLMKKPRFDYTQQYIPHGYMELTIPP-KNGEYAMEPNCLHIWPRNAYMMIALPNMDKSFTCTLFMPFEEFERLPTRSDVLDFFQKNFPDAIPLMGEQALMRDFFLLPAQPMISVKCSPFHLKSHCVLMGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFNNNLSMCLPEFSRFRIPDDHAISDLSMYNYIEV 367          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Mouse
Match: Kmo (kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) [Source:MGI Symbol;Acc:MGI:2138151])

HSP 1 Score: 147.902 bits (372), Expect = 9.666e-41
Identity = 80/186 (43.01%), Postives = 112/186 (60.22%), Query Frame = 2
Query:  146 FFSKTDQFDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVD-VDLQKRIAKFSNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMD 700
            F +K + F V + E R DIR+     GRSINL+LS+RGR+AL+A+GLE+ I+   + M ARMIH   G    IPYG  +++  ++ R+ LN+ LLT  ES  N  + FG KL   +  +  +      K   ++  DL+VG DGAYSTVR  + K  RFD++Q++IPHGY EL  PP   +  L D
Sbjct:   53 FLAKRN-FQVDVYEAREDIRVAKSARGRSINLALSYRGRQALKAIGLEDQIVSKGVPMKARMIHSLSGKKSAIPYGNKSQYILSISRENLNKDLLTAVESYANAKVHFGHKLSKCIPEEGVLTVLGPDKVPRDVTCDLVVGCDGAYSTVRAHLMKKPRFDYTQQYIPHGYMELTIPPKNGEKCLYD 237          
BLAST of Kynurenine 3-monooxygenase vs. UniProt/SwissProt
Match: sp|Q1RLY6|KMO_DANRE (Kynurenine 3-monooxygenase OS=Danio rerio OX=7955 GN=kmo PE=2 SV=1)

HSP 1 Score: 386.726 bits (992), Expect = 3.485e-129
Identity = 201/407 (49.39%), Postives = 265/407 (65.11%), Query Frame = 2
Query:  167 FDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKF--SNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILT----IFGFIGRAA 1369
            FDV + E R DIR      GRSINL+LSHRGR+AL+ VG+E+ I+   I M+ARMIH+ +G    IPYG+  ++  +VDR  LN+ LLT AE+  N  + F  KL D   +     F  S+G+   E Q DL+VG DGA+S VR+   +  RF++SQ +IPHGY EL  PP  D  F M+ N LHIWPRN FM+I LPN   +FT TLFMPF+ F+KI+T DELL FF KYFPD++ L+G   L++ +F   A +MV++KC PY+  E CV+MGDAAHA+VPFYGQGMN GFED L+F EI+ + N  L     E+T  R  D   I DLA YNY+EMR  V+SK F+ RK  DNL++F  P   VPLY+MV+FTR  Y+  +     Q++++T    + GF+  A 
Sbjct:   40 FDVEVYESREDIRQAKVVKGRSINLALSHRGRQALKHVGMEDKIISKGIPMHARMIHNVNGKRSPIPYGKKGQYILSVDRANLNKELLTAAEAYPNTRLNFNHKLHDWSPKTGTMTFIGSDGQ-KTETQADLIVGCDGAFSAVRKQFLRQSRFNYSQTYIPHGYMELTMPP-KDGDFAMEPNYLHIWPRNTFMMIALPNLDRTFTCTLFMPFEDFEKIRTGDELLRFFHKYFPDSVPLIGVEALKQDFFRLPAQAMVSVKCCPYHLFEKCVLMGDAAHAVVPFYGQGMNAGFEDCLVFDEIMDQFNENLVAVLQEYTRVRVPDDHAIADLAMYNYIEMRAHVNSKYFIFRKYLDNLLHFFMPKTIVPLYTMVTFTRTRYNDAVNRWHWQNKVITRGLWLCGFVSAAG 444          
BLAST of Kynurenine 3-monooxygenase vs. UniProt/SwissProt
Match: sp|Q6DIZ8|KMO_XENTR (Kynurenine 3-monooxygenase OS=Xenopus tropicalis OX=8364 GN=kmo PE=2 SV=1)

HSP 1 Score: 374.785 bits (961), Expect = 1.995e-124
Identity = 199/422 (47.16%), Postives = 269/422 (63.74%), Query Frame = 2
Query:  146 FFSKTDQFDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKF-SNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILTI-------FGFIGRAALAISLL 1387
            FF+K   F V L E R DIR      GRSINL+LSHRG +AL+AVGL+E I    I M ARMIH   G    IPYG+ +++  +VDR  LN+ LL+ AE   NVT+ F  KL D ++      F +N + I E + DL+VG DGA+S VR+   +  RF++S  +IPHGYKEL  PP   + F M+ N LHIWPRN FM+I LPN   SFT TLFMPF+ F+K+ T D++L FF  YFPD++EL+G+  L + +F     +M+++KC+ +  +  CVIMGDAAHA+VPFYGQGMN GFED L+F E++++    L     EF+  R  DA  I DLA YNY EMR  V+SK F+ RK+ DN++N + P+ ++PLY+MV+F+RI Y   +   K Q +I+ +        G +G A L I  L
Sbjct:   26 FFAKKG-FQVELYEAREDIRYARMVSGRSINLALSHRGLQALKAVGLDEKIAAMGIPMRARMIHSVKGRKSSIPYGKQHQYILSVDRANLNKELLSAAEKYSNVTMHFEHKLRDCNVDSGTMTFLNNMENIIEKKADLIVGCDGAFSVVRKQFMRKSRFNYSHVYIPHGYKELTIPPRKGE-FAMEPNYLHIWPRNTFMMIALPNLDKSFTCTLFMPFEDFEKLTTGDQVLDFFKTYFPDSIELIGEKKLTEDFFLLPPQAMISVKCSSFCIDHKCVIMGDAAHAVVPFYGQGMNAGFEDCLVFSELMEQYQNNLRICLHEFSRLRVPDAHAISDLAMYNYKEMRAHVNSKWFIFRKQVDNILNAIMPTTFIPLYTMVTFSRIRYHEVILRWKWQKKIINVGLFTVGTTGSVGAAYLVIKYL 445          
BLAST of Kynurenine 3-monooxygenase vs. UniProt/SwissProt
Match: sp|Q86PM2|KMO_AEDAE (Kynurenine 3-monooxygenase OS=Aedes aegypti OX=7159 GN=kh PE=1 SV=2)

HSP 1 Score: 372.859 bits (956), Expect = 1.043e-123
Identity = 196/415 (47.23%), Postives = 259/415 (62.41%), Query Frame = 2
Query:  173 VLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPY-GRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKFSNGKFIE--EIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILT-IFGFIGRAALAISLLIGYQFA 1405
            V L E R DIR     +GRSINL+LS RGR+AL  VGLE+ +L+  I M  RM+HD  GN K +PY    N+   +V RK LNE+LL  AE   N+ + F  KL   +L +    F +    E    + DL+VG DGAYS VR+ + K   +D+SQ +I HGY EL  PP  D  F M  N LHIWPR +FM+I LPN   ++T TLFMPF  F+ IK   +LL FF  YFPDA++L+G+  L K +F     S+V IKC PYN     VI+GDAAHAMVPFYGQGMN GFED  +  E+  ++   ++   +EF++ R  DA +ICDLA YNYVEMR  V+ +S+L RKK D L+ ++ P+ WVPLY+ VSF+ + YS C+  RK QD+ILT +       A+A +   GY++ 
Sbjct:   43 VDLYEYREDIRTAELVIGRSINLALSARGRKALAEVGLEDALLQHGIPMKGRMLHDLKGNRKIVPYDANTNQCIYSVGRKHLNEVLLDAAEKYPNIHLYFNKKLQSANLDEGEMSFIDPTTKESTHTKADLIVGCDGAYSAVRKEIVKRPGYDYSQTYIEHGYLELCIPPTKDGDFAMPHNYLHIWPRGKFMMIALPNQDRTWTVTLFMPFTNFNSIKCDGDLLKFFRTYFPDAIDLIGRERLVKDFFKTRPQSLVMIKCKPYNVGGKAVIIGDAAHAMVPFYGQGMNAGFEDCTVLTELFNQHGSDVDRILAEFSDTRWEDAHSICDLAMYNYVEMRDLVTKRSYLFRKKLDELLYWMLPNTWVPLYNSVSFSHMRYSKCIANRKWQDKILTRVLYCCSITAVAAAGYFGYKYG 457          
BLAST of Kynurenine 3-monooxygenase vs. UniProt/SwissProt
Match: sp|Q7Q6A7|KMO_ANOGA (Kynurenine 3-monooxygenase OS=Anopheles gambiae OX=7165 GN=kh PE=3 SV=2)

HSP 1 Score: 370.163 bits (949), Expect = 1.820e-122
Identity = 190/394 (48.22%), Postives = 248/394 (62.94%), Query Frame = 2
Query:  170 DVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPY-GRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKFSN--GKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILT 1342
            +V L E R DIR     +GRSINL+LS RGR AL  VGLE+ +L   I M  RM+HD +G  K +PY    N+   +V RK LNE+LL  AE   N+ + F  KLV  +L +      +   K ++  + DL+VG DGAYS VR+ + K  R+DFSQ +I HGY EL  PP A   F M  N LHIWPR +FM+I LPN   ++T TLFMPF  F  I  +  LL FF ++FPDA+EL+G+  L K +F   A  +V IKC PY+     +I+GDAAHAMVPFYGQGMN GFED  +  E+  +    L     EF+E+R  DA  ICDLA YNY+EMR  V+ +S+L+RKK D L+ ++ P+ WVPLY+ VSF+ + YS C+  R  QD+ILT
Sbjct:   46 EVNLYEYREDIRTAELVIGRSINLALSARGRRALAEVGLEDALLNHGIPMSGRMLHDVNGKCKIVPYDANTNQCIYSVGRKHLNEVLLNAAEKYPNIHLHFNHKLVSANLDEGNLSMVDPVTKDVKSARADLIVGCDGAYSAVRKEIVKRPRYDFSQTYIEHGYLELCIPPTAGGEFAMPHNYLHIWPRGQFMMIALPNQDRTWTVTLFMPFTQFHSITDQGLLLDFFRQHFPDAIELIGRERLVKDFFKTKAQPLVMIKCRPYHIGAKALIIGDAAHAMVPFYGQGMNAGFEDCSVLTELFNQYGTDLARILPEFSEKRWEDAHAICDLAMYNYIEMRDLVTKRSYLLRKKLDELLFWMMPNTWVPLYNSVSFSHMRYSKCIANRAWQDKILT 439          
BLAST of Kynurenine 3-monooxygenase vs. UniProt/SwissProt
Match: sp|Q91WN4|KMO_MOUSE (Kynurenine 3-monooxygenase OS=Mus musculus OX=10090 GN=Kmo PE=1 SV=1)

HSP 1 Score: 363.229 bits (931), Expect = 6.254e-120
Identity = 183/413 (44.31%), Postives = 264/413 (63.92%), Query Frame = 2
Query:  146 FFSKTDQFDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVD-VDLQKRIAKFSNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILTIFGFIGRAALAIS 1381
            F +K + F V + E R DIR+     GRSINL+LS+RGR+AL+A+GLE+ I+   + M ARMIH   G    IPYG  +++  ++ R+ LN+ LLT  ES  N  + FG KL   +  +  +      K   ++  DL+VG DGAYSTVR  + K  RFD++Q++IPHGY EL  PP  +  + M+ NCLHIWPRN +M+I LPN   SFT TLFMPF+ F+++ T+ ++L FF K FPDA+ LMG+  L + +F   A  M+++KC+P++ +  CV+MGDAAHA+VPF+GQGMN GFED L+F E++ + N  L     EF+  R  D   I DL+ YNY+EMR  V+S+ FL +K  D  ++ + PS ++PLY+MV+FTRI Y   +     Q +++    F+  + +AI 
Sbjct:   26 FLAKRN-FQVDVYEAREDIRVAKSARGRSINLALSYRGRQALKAIGLEDQIVSKGVPMKARMIHSLSGKKSAIPYGNKSQYILSISRENLNKDLLTAVESYANAKVHFGHKLSKCIPEEGVLTVLGPDKVPRDVTCDLVVGCDGAYSTVRAHLMKKPRFDYTQQYIPHGYMELTIPP-KNGEYAMEPNCLHIWPRNAYMMIALPNMDKSFTCTLFMPFEEFERLPTRSDVLDFFQKNFPDAIPLMGEQALMRDFFLLPAQPMISVKCSPFHLKSHCVLMGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFNNNLSMCLPEFSRFRIPDDHAISDLSMYNYIEMRAHVNSRWFLFQKLLDKFLHAIMPSTFIPLYTMVAFTRIRYHEAVLRWHWQKKVINRGLFVLGSLIAIG 436          
BLAST of Kynurenine 3-monooxygenase vs. TrEMBL
Match: A0A1S3JIN9 (Kynurenine 3-monooxygenase OS=Lingula unguis OX=7574 GN=LOC106173625 PE=3 SV=1)

HSP 1 Score: 439.113 bits (1128), Expect = 3.636e-147
Identity = 224/419 (53.46%), Postives = 295/419 (70.41%), Query Frame = 2
Query:  146 FFSKTDQFDVLLCEKRSDIRMDTEHV-GRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLV--DVDLQKRIAKFSNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILTIFGFIGRAALAISLLIG 1393
            +FS+   F+V L E+R DIR   EHV GRSINL+LS RGREAL+ VG+EE +  + I MYARMIH+T G  K I YG+ +++  +VDR+ LNE LLTEAE +  V + F  KLV  +VD  +   K ++GK +   + DL+VG DGAYS VRQ M K +RFDFSQE+IPHGY EL+ PP A+    M+ N LHIWPRN +M+I LPN  GSFT T+FMPF++F+ I+T+++L+ FF + FPD+L L+G+  L++ +F+  A  MV++KC PY+ ++  VIMGDAAHAMVPFYGQGMNCGFED LIF++IL + N        +FT  RN DA+ +CDLA YNY+EMR SV+SK FL+RKK DN +++L P  W+PLY+MVSFTR  Y  C+  RKKQD IL     +    L  SL +G
Sbjct:   23 YFSQRG-FEVDLYERRPDIRT-LEHVRGRSINLALSCRGREALKGVGMEEMVTATGIPMYARMIHNTDGTRKPILYGKKDQYIMSVDRRKLNEDLLTEAEKHPGVRLHFSHKLVSCNVDTGEMHFKDASGKDLH-TRSDLIVGCDGAYSAVRQQMMKSMRFDFSQEYIPHGYMELHMPPSANGKHAMETNYLHIWPRNAYMMIALPNQDGSFTVTMFMPFEVFEAIQTEEDLMRFFKEKFPDSLPLLGEQALKETFFNNKALPMVSVKCGPYHHKDKLVIMGDAAHAMVPFYGQGMNCGFEDCLIFNDILDQTNNDFGEALKKFTAYRNVDARAMCDLAMYNYIEMRASVNSKLFLLRKKVDNFLHWLLPDRWIPLYTMVSFTRTRYHKCINGRKKQDMILERGAVL--LVLGSSLFVG 436          
BLAST of Kynurenine 3-monooxygenase vs. TrEMBL
Match: A0A267GLA5 (Kynurenine 3-monooxygenase OS=Macrostomum lignano OX=282301 GN=KMO PE=3 SV=1)

HSP 1 Score: 422.55 bits (1085), Expect = 9.782e-141
Identity = 201/391 (51.41%), Postives = 263/391 (67.26%), Query Frame = 2
Query:  167 FDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKFSNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRIL 1339
            ++V L E R D R D   +GRSINL+LSHRG EAL  VGL E + KS I M+ARMIH   G  + IPYGR  +F  +VDR  LN +LLTEAES  N+TI FG KLV  D       FS      +  YDL+VG DGA+S VR+ M +  RFD+ Q +I HGY E+ FPP       M  N LHIWPRN+FMLI LPN  GSFTGT+FMPF++FD++K+ + ++ F+   FPDALEL+G+  +     S  A  +V+I+C PY+  +  +I+GDAAHAMVPFYGQGMNCGFED +I  +++++  +        FT  R  DA  I DLA YNY+EMR+SV+S +FL+RKK DN +N+L P+ WVPLY+MV+F+R PYS  + +R+ QDR+L
Sbjct:   29 YNVDLFEMRQDFRADATVLGRSINLALSHRGLEALERVGLREKVTKSGIPMHARMIHSLDGKTRPIPYGRTGQFIMSVDRMGLNGVLLTEAESQPNITIHFGHKLVSCDPTTGETVFSTDDSTVKRTYDLIVGCDGAFSAVRKSMMRHCRFDYEQRYIEHGYMEIAFPPSESGGHCMATNYLHIWPRNQFMLIALPNLDGSFTGTMFMPFELFDQLKSPEAVVKFYRDTFPDALELLGEKTVVDTILSLKALPLVSIRCQPYHLNDKMLIIGDAAHAMVPFYGQGMNCGFEDCIILDDLMQQFGHDFGKVLPAFTNSRVEDAHAIVDLALYNYIEMRQSVNSVTFLLRKKLDNALNWLLPNHWVPLYTMVTFSRTPYSRAITDRRWQDRVL 419          
BLAST of Kynurenine 3-monooxygenase vs. TrEMBL
Match: B1B6U6 (Kynurenine 3-monooxygenase OS=Haemaphysalis longicornis OX=44386 GN=HlK3H PE=2 SV=1)

HSP 1 Score: 422.165 bits (1084), Expect = 1.054e-140
Identity = 214/421 (50.83%), Postives = 285/421 (67.70%), Query Frame = 2
Query:  167 FDVLLCEKRSDIRMDTEHV-GRSINLSLSHRGREALRAVGLEENIL-KSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKFSNGKFIE-EIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILTIFGFIGRAALAISLLIG-YQFAMKYR 1417
            F V L E R DIR + EHV GRSINL+LS RGR AL  VGLEE ++ + +I M+ R+IH+T G  K IPYGR  +   +V R+ LNE+LL+  ESN NV + F  KL   DL +    F      E ++Q+  + G DGAYS VR+ M +   F++SQ +IPHGY EL  PP AD  F M++N LHIWPR +FMLI LPN   ++T TLFMPF +FD +  +D+LLTFF +YFPDA+ L+GK +L K +F+  AS MV IKCNPYN  +  +I+GDAAHAMVPFYGQGMN GFED  +  E++  + + L    SEFTE RN+D + ICDLA YNYVEMR  V+S SFL+RKKFD  +N++ PSFW+PLY+ V+F+RI Y  C+K R  QD++L+        ++A++ + G +Q+   +R
Sbjct:   29 FQVDLYESRDDIR-EQEHVTGRSINLALSVRGRAALALVGLEEEVIQRHAIPMHGRLIHNTDGTRKPIPYGRKGQSIFSVGRRFLNEVLLSACESNPNVRLHFRHKLQSADLDEAQLSFRGPDGQELKVQHRAVFGCDGAYSAVRRQMLRRPMFNYSQTYIPHGYLELCIPPTADGQFAMEVNYLHIWPRGQFMLIALPNQDRTYTATLFMPFAVFDSLTDRDKLLTFFDRYFPDAVPLIGKDHLVKSFFAVDASPMVMIKCNPYNVSDKSLILGDAAHAMVPFYGQGMNAGFEDCSVLSELMDVHGHNLSAIFSEFTELRNKDVEAICDLALYNYVEMRDLVNSTSFLVRKKFDLFLNWIAPSFWIPLYTTVTFSRIRYHECVKNRAWQDKVLSRLMNGALISMAVAGVAGAFQYLQPHR 448          
BLAST of Kynurenine 3-monooxygenase vs. TrEMBL
Match: A0A267G5R9 (Kynurenine 3-monooxygenase OS=Macrostomum lignano OX=282301 GN=KMO PE=3 SV=1)

HSP 1 Score: 420.624 bits (1080), Expect = 4.478e-140
Identity = 200/391 (51.15%), Postives = 262/391 (67.01%), Query Frame = 2
Query:  167 FDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKFSNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRIL 1339
            ++V L E R D R D   +GRSINL+LSHRG EAL  VGL E + KS I M+ARMIH   G  + IPYGR  +F  +VDR  LN +LLTE ES  N+TI FG KLV  D       FS      +  YDL+VG DGA+S VR+ M +  RFD+ Q +I HGY E+ FPP       M  N LHIWPRN+FMLI LPN  GSFTGT+FMPF++FD++K+ + ++ F+   FPDALEL+G+  +     S  A  +V+I+C PY+  +  +I+GDAAHAMVPFYGQGMNCGFED +I  +++++  +        FT  R  DA  I DLA YNY+EMR+SV+S +FL+RKK DN +N+L P+ WVPLY+MV+F+R PYS  + +R+ QDR+L
Sbjct:   29 YNVDLFEMRQDFRADATVLGRSINLALSHRGLEALERVGLREKVTKSGIPMHARMIHSLDGKTRPIPYGRTGQFIMSVDRMGLNGVLLTEVESQPNITIHFGHKLVSCDPTTGETVFSTDDSTVKRTYDLIVGCDGAFSAVRKSMMRHCRFDYEQRYIEHGYMEIAFPPSESGGHCMATNYLHIWPRNQFMLIALPNLDGSFTGTMFMPFELFDQLKSPEAVVKFYRDTFPDALELLGEKTVVDTILSLKALPLVSIRCQPYHLNDKMLIIGDAAHAMVPFYGQGMNCGFEDCIILDDLMQQFGHDFGKVLPAFTNSRVEDAHAIVDLALYNYIEMRQSVNSVTFLLRKKLDNALNWLLPNHWVPLYTMVTFSRTPYSRAITDRRWQDRVL 419          
BLAST of Kynurenine 3-monooxygenase vs. TrEMBL
Match: A0A1I8G4J7 (Kynurenine 3-monooxygenase OS=Macrostomum lignano OX=282301 GN=KMO PE=3 SV=1)

HSP 1 Score: 419.853 bits (1078), Expect = 1.154e-139
Identity = 201/391 (51.41%), Postives = 261/391 (66.75%), Query Frame = 2
Query:  167 FDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKFSNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRIL 1339
            + V L E R D R D    GRSINL+LSHRG EAL  VGL E + KS I M+ARMIH   G  + IPYGR  +F  +VDR  LN +LLTEAES  N+TI FG KLV  D       FS      +  YDL+VG DGA+S VR+ M +  RFD+ Q +I HGY E+ FPP       M  N LHIWPRN+FMLI LPN  GSFTGT+FMPF++FD++K+ + ++ F+   FPDALEL+G+  +     S  A  +V+I+C PY+  +  +I+GDAAHAMVPFYGQGMNCGFED +I  +++++  +        FT  R  DA  I DLA YNY+EMR+SV+S +FL+RKK DN +N+L P+ WVPLY+MV+F+R PYS  + +R+ QDR+L
Sbjct:   29 YKVDLFEMRQDFRADATVHGRSINLALSHRGLEALERVGLREKVTKSGIPMHARMIHSLDGKTRPIPYGRTGQFIMSVDRMGLNGVLLTEAESQPNITIHFGHKLVSCDPTTGETVFSTDDSTVKRTYDLIVGCDGAFSAVRKSMMRHCRFDYEQRYIEHGYMEIAFPPSESGGHCMATNYLHIWPRNQFMLIALPNLDGSFTGTMFMPFELFDQLKSPEAVVKFYRDTFPDALELLGEKTVVDTILSLKALPLVSIRCQPYHLNDKMLIIGDAAHAMVPFYGQGMNCGFEDCIILDDLMQQFGHDFGKVLPAFTNSRVEDAHAIVDLALYNYIEMRQSVNSVTFLLRKKLDNALNWLLPNHWVPLYTMVTFSRTPYSRAITDRRWQDRVL 419          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Cavefish
Match: kmo (kynurenine 3-monooxygenase [Source:NCBI gene;Acc:103038724])

HSP 1 Score: 377.481 bits (968), Expect = 2.423e-126
Identity = 199/431 (46.17%), Postives = 269/431 (62.41%), Query Frame = 2
Query:  146 FFSKTDQFDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKFSNGKFIE-EIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILT----IFGFIGRAALAISLLIGYQFAMKYRIK 1423
            FF+K   FDV L E R DIR      GRSINL+LSHRGR+AL+ +G+EE I+   I M ARMIH   G    IPYGR  ++  +V R  LN+ LL+  E+  N  + F  KL+D   +     F      E + + DL+VG DGA+ST R+   +  RFD+SQ +IPHGY EL  PP   D F M+ N LHIWPRN FM+I LPN   +FT TLFMPF+ F+KI T DEL+ FF K+FPD++ L+G   L++ +F   A ++V +KC+PY+  + CV+MGDAAHAMVPFYGQGMN GFED L+F+EI+ + N        EF+  R  D   +C+LA YNY+EMR  V+S+ FL RK  D  +N++ P   +PLY+M++FTR  Y   + + + Q++++T    IFG        +S+  G    MKYR K
Sbjct:   36 FFAKRG-FDVALFEYREDIRCAKVVKGRSINLALSHRGRQALKHIGIEEKIVSMGIPMRARMIHSLSGKCSPIPYGRKGQYILSVGRANLNKELLSVVETYPNTELNFSHKLLDWSPETGTMTFHGPDGAERDFEADLIVGCDGAFSTTRKQFLRRSRFDYSQTYIPHGYIELTMPPRNGD-FAMEPNFLHIWPRNTFMMIALPNVDKTFTCTLFMPFEDFEKITTGDELIAFFQKHFPDSIPLIGVEALKRDFFLLPAQALVWVKCSPYHMLDRCVLMGDAAHAMVPFYGQGMNAGFEDCLVFNEIMDQFNEDFAAVLPEFSRVRAPDDHAMCELAMYNYIEMRSHVNSRYFLFRKYLDGALNYIMPKTIIPLYTMITFTRTRYHEAVIQWQWQNKVITRGLWIFG-------TMSVAGGAYLLMKYRPK 457          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Cavefish
Match: kmo (kynurenine 3-monooxygenase [Source:NCBI gene;Acc:103038724])

HSP 1 Score: 362.073 bits (928), Expect = 7.564e-121
Identity = 194/429 (45.22%), Postives = 261/429 (60.84%), Query Frame = 2
Query:  167 FDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNN-----AVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKFSNGKFIE-EIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILT----IFGFIGRAALAISLLIGYQFAMKYRIK 1423
            FDV L E R DIR      GRSINL+LSHRGR+AL+ +G+EE I+   I M ARMIH   G    IPYGR  +        A   +VL  L + E  +  N  + F  KL+D   +     F      E + + DL+VG DGA+ST R+   +  RFD+SQ +IPHGY EL  PP   D F M+ N LHIWPRN FM+I LPN   +FT TLFMPF+ F+KI T DEL+ FF K+FPD++ L+G   L++ +F   A ++V +KC+PY+  + CV+MGDAAHAMVPFYGQGMN GFED L+F+EI+ + N        EF+  R  D   +C+LA YNY+EMR  V+S+ FL RK  D  +N++ P   +PLY+M++FTR  Y   + + + Q++++T    IFG        +S+  G    MKYR K
Sbjct:    2 FDVALFEYREDIRCAKVVKGRSINLALSHRGRQALKHIGIEEKIVSMGIPMRARMIHSLSGKCSPIPYGRKGQVKPLFVKLANPYQVLGALKMVE--TYPNTELNFSHKLLDWSPETGTMTFHGPDGAERDFEADLIVGCDGAFSTTRKQFLRRSRFDYSQTYIPHGYIELTMPPRNGD-FAMEPNFLHIWPRNTFMMIALPNVDKTFTCTLFMPFEDFEKITTGDELIAFFQKHFPDSIPLIGVEALKRDFFLLPAQALVWVKCSPYHMLDRCVLMGDAAHAMVPFYGQGMNAGFEDCLVFNEIMDQFNEDFAAVLPEFSRVRAPDDHAMCELAMYNYIEMRSHVNSRYFLFRKYLDGALNYIMPKTIIPLYTMITFTRTRYHEAVIQWQWQNKVITRGLWIFG-------TMSVAGGAYLLMKYRPK 420          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Sea Lamprey
Match: KMO (kynurenine 3-monooxygenase [Source:HGNC Symbol;Acc:HGNC:6381])

HSP 1 Score: 241.891 bits (616), Expect = 1.464e-77
Identity = 121/243 (49.79%), Postives = 163/243 (67.08%), Query Frame = 2
Query:  689 FLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILTIFGFIGRAALAISLLIGYQFAMKYR 1417
            F M+ N LHIWPRN FM+I LPN   SFT TLFMPF+ F+ I   + +L FFS+YFPDA+ L+G + L++ +F   A ++V+IKC+PY+     VIMGDAAHAMVPFYGQGMN GFED L+F E+++E N  L     EF+  R  D + I DLA YNY+EMR  V+S+ FL RK+ DNL+  L P  +VPLY+MV+FTRI Y   +K+ K Q++++     +G   L++ L  G   A + R
Sbjct:    1 FAMEKNYLHIWPRNTFMMIALPNNDHSFTCTLFMPFEEFECITEPEHVLDFFSRYFPDAIPLIGAAELQRDFFLLPAQALVSIKCSPYHVGRRVVIMGDAAHAMVPFYGQGMNAGFEDCLVFDELMEEFNCDLGRVLPEFSRLRTPDDQAIVDLAMYNYIEMRAHVNSRWFLFRKRVDNLLYLLMPGTFVPLYTMVTFTRIRYHEVVKKCKLQNKVVNS-ALLGIGVLSV-LSAGAWVATRIR 241          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Yeast
Match: BNA4 (Kynurenine 3-monooxygenase; required for the de novo biosynthesis of NAD from tryptophan via kynurenine; expression regulated by Hst1p; putative therapeutic target for Huntington disease [Source:SGD;Acc:S000000194])

HSP 1 Score: 282.722 bits (722), Expect = 1.126e-90
Identity = 172/441 (39.00%), Postives = 253/441 (57.37%), Query Frame = 2
Query:  149 FSKTDQFDVLLCEKRSDIRMDTEHVG--RSINLSLSHRGREALRAVGLE--ENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDL--QKRIAKFSNGKFIEEI---QYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGAD------DTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLF-MPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEES-CVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSF-TRIPYSLCLKERKKQDRILTIFGFIGRAALAISLLIGYQFAMKYR 1417
            FSK + ++V L + R D R+DT      +SINL++S RG +AL+++  +  E+IL+  I M  RMIHD  G  +   YG   E  N+++R VLN  LL E E +    +KFG KLV ++    K+I  F+ G+ ++     +YD ++G DGAYS  R  M + +  DFSQE++   Y ELY PP  +        F +  + LHIWPR++FMLI L N  GSFT T F    +I D I +K  +  F  + FPD + +M   +  K + +    S+V + C PY+      +++GDAAHAMVPFYGQGMNCGFED+ I   +LK+++       +E+T+ R++D  +I +LA  NY EM   V+SK FL+RKK D L + +    W+PLY+M+SF + I YS  L+   KQ RIL     +    L+I     ++F  + R
Sbjct:   21 FSK-EGYNVTLYDFRQDPRLDTTKNKNLKSINLAISARGIDALKSIDPDACEHILQDMIPMKGRMIHDLKGRQESQLYGLHGEAINSINRSVLNNSLLDELEKS-TTELKFGHKLVKIEWTDDKQICHFAIGEDLKTPHTEKYDFVIGCDGAYSATRSQMQRKVEMDFSQEYMNLRYIELYIPPTEEFKPNYGGNFAIAPDHLHIWPRHKFMLIALANSDGSFTSTFFGSKDQISDLITSKSRVREFLIENFPDIINIMDLDDAVKRFITYPKESLVCVNCKPYDVPGGKAILLGDAAHAMVPFYGQGMNCGFEDVRILMALLKKHSGDRSRAFTEYTQTRHKDLVSITELAKRNYKEMSHDVTSKRFLLRKKLDALFSIIMKDKWIPLYTMISFRSDISYSRALERAGKQTRILKFLESLTLGMLSIGGYKLFKFLTRER 459          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Nematostella
Match: EDO45190 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTD3])

HSP 1 Score: 400.593 bits (1028), Expect = 8.924e-137
Identity = 202/399 (50.63%), Postives = 272/399 (68.17%), Query Frame = 2
Query:  146 FFSKTDQFDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKR--IAKFSNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRI 1336
            FF+K   + V L E R D R       RSINL+LS RG  AL AVG E  +++S I M+ARMIH   G+   IPYG+  ++  +V+R+ +NE LLT AES+ NVT+ FG KL  VD++K     K S+   + ++  DLLVG DGAYS VR+ + +  RFD+SQE+IPHGYKE+  PP A+   +M++N LHIWPRN FM+I LPN  G+FT TLF PF  FDKIKT D++L FF+K FPD + L+G+  L   +F+    SMV++KC PY+  +  VI+GDAAHAMVPFYGQGMNCGFED L+ +EIL ++N  L     E++  RN DA+ +CDLA YNY+EMR SV+S  FL++K F + +++L P   +PLY+MV+F+RIPY   +K  K QD +
Sbjct:    8 FFAKRG-YKVDLYESRQDPRKLQFVSLRSINLALSVRGISALAAVGCERPMVESGIPMHARMIHTLKGSKYAIPYGKKGQYIMSVERRKMNEHLLTVAESHPNVTLHFGHKLKKVDVEKAHMTYKTSSAGEVVDVDADLLVGCDGAYSAVRKEIMRRPRFDYSQEYIPHGYKEICLPPDANGKHIMELNYLHIWPRNTFMMIALPNQDGTFTCTLFAPFDTFDKIKTNDDVLNFFNKEFPDFIPLIGEEKLLSDWFTNPVGSMVSVKCKPYHVADKVVILGDAAHAMVPFYGQGMNCGFEDCLVLNEILDKHNDNLGAALEEYSMLRNPDAEAMCDLAMYNYIEMRSSVNSTLFLVKKYFFSFLHWLMPKTIIPLYTMVTFSRIPYHTVIKRSKLQDNV 405          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Nematostella
Match: EDO43899 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX40])

HSP 1 Score: 330.102 bits (845), Expect = 1.957e-108
Identity = 176/416 (42.31%), Postives = 247/416 (59.38%), Query Frame = 2
Query:  167 FDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKL--VDVDLQKRIAKFSNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILTIFGFIGRAALAISLLIGYQFAM 1408
            + V + E R D R+      RSINL+LSHRG  AL  VG +E +L+ S+ M AR IH  +     + YG   E   +V+R+ +NE LL  AES  NVT  F  KL   D+D    I    +G  +  +  DLLVG DGA+S +R+ M    RFD+SQ +IPH YKE+  PP  D    ++ + LHIWPR  FM+I   N   SFT TLF P++ F++I TK+++L FF+  FPD ++ + + N +          ++ + C+PY++++  VI+GDAAHAMVPFY QGMNCGFED L+  E+L ++   +    SE+T  RN D K ICDLA YNY EMR SV+SK F+ R+    L++  FP   +PLY+MV+F+RIPY   +   ++QDRI+ I      AA+  S      F +
Sbjct:   56 YRVDIYEARKDPRLVKTVSQRSINLALSHRGIAALAVVGCDEQLLEDSVAMSARYIHARNRQTYSMQYGTNGECIYSVERRKVNEFLLNVAESYMNVTFHFEHKLRSADLDCASFICTSPDGSALR-VNADLLVGCDGAFSALRREMMARTRFDYSQAYIPHWYKEISLPPRPDGEPHIEPSYLHIWPRTSFMMIAQANKDNSFTCTLFAPYEHFERINTKEDVLGFFNSEFPDFMDHLEEVNSDHSSNHFCHLGLILLPCSPYHYKDKAVILGDAAHAMVPFYAQGMNCGFEDCLVLDELLVKHKKDIGAALSEYTSVRNPDGKAICDLAMYNYTEMRSSVTSKIFIWRRTLYLLLHKCFPRLLLPLYTMVTFSRIPYHEVIIRTRRQDRIVNILMLSLLAAVTFSFATSTWFLL 470          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Nematostella
Match: EDO45186 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTC7])

HSP 1 Score: 296.59 bits (758), Expect = 3.924e-97
Identity = 157/343 (45.77%), Postives = 207/343 (60.35%), Query Frame = 2
Query:  146 FFSKTDQFDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKFSNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEM 1174
            FF+K   + V L E R D R       RSINL+LS RG  AL AVG E  +++S I M+ARMIH   G+   IPYG+  + +                            ++VDVD                   DLLVG DGAYS VR+ + +  RFD+SQE+IPHGYKE+  PP A+   +M++N LHIWPRN FM+I LPN  G+FT TLF PF  FD+IKT D++L FF+K FPD + L+G+  L   +F+    +MV++KC PY+  +  VI+GDAAHAMVPFYGQGMNCGFED L+ +EIL ++N  L     E++  RN DA+ +CDLA YNY+E+
Sbjct:   29 FFAKRG-YKVDLYESRQDPRKLQFVSLRSINLALSVRGISALAAVGCERPMVESGIPMHARMIHTLKGSKYAIPYGKKGQISAG--------------------------EVVDVDA------------------DLLVGCDGAYSAVRKEIMRRPRFDYSQEYIPHGYKEICLPPDANGKHIMELNYLHIWPRNTFMMIALPNQDGTFTCTLFAPFDTFDEIKTNDDVLNFFNKEFPDFIPLIGEEKLLSDWFTNPVGAMVSVKCKPYHVADKVVILGDAAHAMVPFYGQGMNCGFEDCLVLNEILDKHNDNLGAALEEYSMVRNPDAEAMCDLAMYNYIEV 326          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Nematostella
Match: EDO26830 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAY7])

HSP 1 Score: 248.44 bits (633), Expect = 9.735e-78
Identity = 142/358 (39.66%), Postives = 210/358 (58.66%), Query Frame = 2
Query:  317 MYARMIHDTHGNLKRIPY-GRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKFSNGKFIEE--IQYDLLVGNDGAYSTVRQ--LMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKI----FDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYK-------LENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTR-IPYSLCLKERKKQDRIL 1339
            MY R+IHD   N     Y GR NE+ N++ R  LN +LLTEAE +KNVTI F  K   VD++  IA F N K  EE  I  D++ G DGA S +R+   + K   F +SQ+++ HGYKEL  P  A+    +  + LHIWPR ++MLI LPN  GSFT TLF+  +     F ++ +++++  FF K FPDAL L+   N+   + +    ++ T+KC+P+ ++ + +IMGDAAHA+VPFYGQGMN  FED+++F EIL  N+++        E     + + R  +A  I DLA  NY EMR  V++  F  ++  +  +   FP+ +   YSMV+F   + Y   + + + QD+ L
Sbjct:    1 MYGRLIHDLEENTFASNYSGRANEYINSISRGDLNGILLTEAEKHKNVTIHFNTKCSSVDIENTIAHFKNDKTNEEFAIDADVIFGTDGAGSVLRKSYYLEKKFLFSYSQDYLTHGYKELEIPADANGNHQLSKDHLHIWPRGDYMLIALPNMDGSFTVTLFLGHEEGTYNFKELDSEEKIKNFFKKQFPDALILI--PNIADEFVNNPTGALGTVKCSPWYYKSNTMIMGDAAHAVVPFYGQGMNASFEDVVVFDEIL--NHFERSPEINSWETVFKAYEKARKANADAIGDLAVENYYEMRDHVANPLFKQKRMLEMELEKNFPTAYFSKYSMVTFNEDMGYHEAMVKGRAQDKAL 354          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Medaka
Match: kmo (kynurenine 3-monooxygenase [Source:NCBI gene;Acc:101158471])

HSP 1 Score: 384.415 bits (986), Expect = 3.579e-129
Identity = 197/412 (47.82%), Postives = 265/412 (64.32%), Query Frame = 2
Query:  146 FFSKTDQFDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKFSNGKFI-EEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILTIFGFIGRAALAI 1378
            FF+K   F+V + E R DIR      GRSINL+LSHRGR+AL+ VG+E+ I+   I M+ARMIH   G    IPYGR  ++  +VDR  LN+ LL+EAE+  N T+ F  KL D      +  FS      ++I  DL+VG DGA+S  R+   +  RF++SQ +IPHGY EL  PP  +  F M  N LHIWPRN FM+I LPN   +FT TLFMPF+ F+KI T DE++ FF  YFPD + L+G   L+K YF   A +MV++KC+PY+  + CV+MGDAAHA+VPFYGQGMN GFED ++F E++++ N        E+T  R  D   I DLA YNYVEMR  V+SK FL RK  DN+++F  P   +PLY+MV+FTRIPY   ++    Q++++  +G +  A  A+
Sbjct:   29 FFAKRG-FNVHVFESREDIRKAKIVKGRSINLALSHRGRQALKHVGMEDKIISKGIPMHARMIHSLSGKQSPIPYGRKGQYILSVDRANLNKELLSEAETYPNTTLNFEHKLQDWSADTGLMTFSRSDGSKDQIHADLIVGCDGAFSATRKQFLRRSRFNYSQTYIPHGYMELTMPP-VNGEFAMKPNYLHIWPRNTFMMIALPNLDKTFTCTLFMPFEDFEKITTGDEVIQFFQSYFPDTIPLIGVEALKKDYFRLPAQAMVSVKCSPYHIGDKCVLMGDAAHAVVPFYGQGMNAGFEDCIVFDELMEQFNEDFCAVLPEYTRVRVPDDHAIADLAMYNYVEMRAHVNSKWFLFRKYVDNVLHFFLPKTIIPLYTMVTFTRIPYHHAVERWHWQNKVIN-YGLLLSAVGAV 437          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Medaka
Match: kmo (kynurenine 3-monooxygenase [Source:NCBI gene;Acc:101158471])

HSP 1 Score: 384.415 bits (986), Expect = 8.600e-129
Identity = 197/412 (47.82%), Postives = 265/412 (64.32%), Query Frame = 2
Query:  146 FFSKTDQFDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKFSNGKFI-EEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILTIFGFIGRAALAI 1378
            FF+K   F+V + E R DIR      GRSINL+LSHRGR+AL+ VG+E+ I+   I M+ARMIH   G    IPYGR  ++  +VDR  LN+ LL+EAE+  N T+ F  KL D      +  FS      ++I  DL+VG DGA+S  R+   +  RF++SQ +IPHGY EL  PP  +  F M  N LHIWPRN FM+I LPN   +FT TLFMPF+ F+KI T DE++ FF  YFPD + L+G   L+K YF   A +MV++KC+PY+  + CV+MGDAAHA+VPFYGQGMN GFED ++F E++++ N        E+T  R  D   I DLA YNYVEMR  V+SK FL RK  DN+++F  P   +PLY+MV+FTRIPY   ++    Q++++  +G +  A  A+
Sbjct:   24 FFAKRG-FNVHVFESREDIRKAKIVKGRSINLALSHRGRQALKHVGMEDKIISKGIPMHARMIHSLSGKQSPIPYGRKGQYILSVDRANLNKELLSEAETYPNTTLNFEHKLQDWSADTGLMTFSRSDGSKDQIHADLIVGCDGAFSATRKQFLRRSRFNYSQTYIPHGYMELTMPP-VNGEFAMKPNYLHIWPRNTFMMIALPNLDKTFTCTLFMPFEDFEKITTGDEVIQFFQSYFPDTIPLIGVEALKKDYFRLPAQAMVSVKCSPYHIGDKCVLMGDAAHAVVPFYGQGMNAGFEDCIVFDELMEQFNEDFCAVLPEYTRVRVPDDHAIADLAMYNYVEMRAHVNSKWFLFRKYVDNVLHFFLPKTIIPLYTMVTFTRIPYHHAVERWHWQNKVIN-YGLLLSAVGAV 432          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Medaka
Match: kmo (kynurenine 3-monooxygenase [Source:NCBI gene;Acc:101158471])

HSP 1 Score: 366.311 bits (939), Expect = 2.640e-122
Identity = 191/411 (46.47%), Postives = 258/411 (62.77%), Query Frame = 2
Query:  146 FFSKTDQFDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKFSNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILTIFGFIGRAALAI 1378
            FF+K   F+V + E R DIR      GRSINL+LSHRGR+AL+ VG+E+ I+   I M+ARMIH   G    IPYGR  ++  +VDR  LN+ LL+     K+            DL  R +  S     ++I  DL+VG DGA+S  R+   +  RF++SQ +IPHGY EL  PP  +  F M  N LHIWPRN FM+I LPN   +FT TLFMPF+ F+KI T DE++ FF  YFPD + L+G   L+K YF   A +MV++KC+PY+  + CV+MGDAAHA+VPFYGQGMN GFED ++F E++++ N        E+T  R  D   I DLA YNYVEMR  V+SK FL RK  DN+++F  P   +PLY+MV+FTRIPY   ++    Q++++  +G +  A  A+
Sbjct:   29 FFAKRG-FNVHVFESREDIRKAKIVKGRSINLALSHRGRQALKHVGMEDKIISKGIPMHARMIHSLSGKQSPIPYGRKGQYILSVDRANLNKELLSGKRRQKDAE----------DLNDRRSDGSK----DQIHADLIVGCDGAFSATRKQFLRRSRFNYSQTYIPHGYMELTMPP-VNGEFAMKPNYLHIWPRNTFMMIALPNLDKTFTCTLFMPFEDFEKITTGDEVIQFFQSYFPDTIPLIGVEALKKDYFRLPAQAMVSVKCSPYHIGDKCVLMGDAAHAVVPFYGQGMNAGFEDCIVFDELMEQFNEDFCAVLPEYTRVRVPDDHAIADLAMYNYVEMRAHVNSKWFLFRKYVDNVLHFFLPKTIIPLYTMVTFTRIPYHHAVERWHWQNKVIN-YGLLLSAVGAV 422          
BLAST of Kynurenine 3-monooxygenase vs. Planmine SMEST
Match: SMESG000055694.1 (SMESG000055694.1)

HSP 1 Score: 899.042 bits (2322), Expect = 0.000e+0
Identity = 450/454 (99.12%), Postives = 453/454 (99.78%), Query Frame = 2
Query:   71 MMSESNKRPKXXXXXXXXXXXXXXXFFSKTDQFDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKFSNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILTIFGFIGRAALAISLLIGYQFAMKYRIKFVY 1432
            MMSESNKRPKVV+VGGGLVGALNAVFFSKTDQFDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKFSNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFI HGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPF+IF+KIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILTIFGFIGRAALAISLLIGYQFAMKYRIKFVY
Sbjct:    1 MMSESNKRPKVVIVGGGLVGALNAVFFSKTDQFDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKFSNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFISHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFEIFNKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILTIFGFIGRAALAISLLIGYQFAMKYRIKFVY 454          
BLAST of Kynurenine 3-monooxygenase vs. Planmine SMEST
Match: SMESG000055694.1 (SMESG000055694.1)

HSP 1 Score: 897.501 bits (2318), Expect = 0.000e+0
Identity = 449/453 (99.12%), Postives = 452/453 (99.78%), Query Frame = 2
Query:   74 MSESNKRPKXXXXXXXXXXXXXXXFFSKTDQFDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKFSNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILTIFGFIGRAALAISLLIGYQFAMKYRIKFVY 1432
            MSESNKRPKVV+VGGGLVGALNAVFFSKTDQFDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKFSNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFI HGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPF+IF+KIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILTIFGFIGRAALAISLLIGYQFAMKYRIKFVY
Sbjct:    1 MSESNKRPKVVIVGGGLVGALNAVFFSKTDQFDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKFSNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFISHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFEIFNKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILTIFGFIGRAALAISLLIGYQFAMKYRIKFVY 453          
BLAST of Kynurenine 3-monooxygenase vs. Planmine SMEST
Match: SMESG000055918.1 (SMESG000055918.1)

HSP 1 Score: 532.332 bits (1370), Expect = 0.000e+0
Identity = 263/423 (62.17%), Postives = 342/423 (80.85%), Query Frame = 2
Query:   74 MSESNKRPKXXXXXXXXXXXXXXXFFSKTDQFDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKFSNGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILT 1342
            M+  NKRPKV++VGGGLVGALNA+FF++T ++D+++CEK SDIR     +GRSINLSLSHRG  AL+ VGL+E IL +SI MYARM+H  + +LKR PYG  N+  +A+DRK++NE+LLT+ E+N+N+ + F  KLVDVD +K+IAKF + K   EI +D L+GNDGA+STVRQ MSK +R +FS+E+IPHGY EL+FPPGAD+  +MD  CLHIWPR+EFMLIGLPN  GSF+G LFMPF+ +D+I++ + L  FF+  FPDA  L+GKSNL +++F+   + MVTI+CNPYNF   C+IMGDAAHAMVPFYGQGMN GFED++IFHEILK ++Y L+ TC EFT+ RN DAK +CDLAF+NY E+R +V+  SF +RK  DNLMN+LFPSFW+PLY+MV FTRIPY+ CL+E++KQD+ILT
Sbjct:    1 MTSENKRPKVLIVGGGLVGALNALFFARTQKYDIIVCEKTSDIRGTNRTIGRSINLSLSHRGLTALKIVGLDEEILAASIPMYARMVHGVNEDLKRFPYGLSNQCISAIDRKLMNEILLTKVENNENIQLFFNMKLVDVDFRKKIAKFLSEKEYHEIAFDFLIGNDGAHSTVRQFMSKNMRMNFSEEYIPHGYIELHFPPGADNKHVMDKKCLHIWPRSEFMLIGLPNLDGSFSGILFMPFEYYDEIESNENLFKFFNFNFPDAFRLIGKSNLARMFFATKPAKMVTIRCNPYNFGGLCIIMGDAAHAMVPFYGQGMNSGFEDVIIFHEILKNHDYDLDKTCVEFTKNRNFDAKAMCDLAFFNYDELRINVTLLSFRLRKIIDNLMNYLFPSFWIPLYTMVCFTRIPYTKCLEEKEKQDKILT 423          
BLAST of Kynurenine 3-monooxygenase vs. Planmine SMEST
Match: SMESG000055705.1 (SMESG000055705.1)

HSP 1 Score: 491.115 bits (1263), Expect = 2.006e-171
Identity = 237/418 (56.70%), Postives = 313/418 (74.88%), Query Frame = 2
Query:  146 FFSKTDQFDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKFSNGKFIEEIQ--YDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILTIFGFIGRAALAISLLIG 1393
            FF++ D+F+V + EK  D R   + VGR+INLSLS+RG  AL+ V LEE +LK  I MYARMIH+  G LKR  YG+ ++   A++R+VL  +LL +AE +K++ I F  KL DV+  ++IAKF N K +E+I+  +DLLVGNDGAYS VR +M+K LR DFSQE+IPHGY E+ FPP   +   MD NCLHIWPRNE+ML  LPN  GSF+GTLFMPFK+F+ I +K +LL  F K FPDALE++GK +L  ++     S MVTI+CNPYN  E CVIMGDAAHAMVPFYGQGMN GFED+ IFHEIL++N++ L  TC++F+E+RN DAK +C+LA YNY+E+RK+V+  SF +RK FDNLMN LFPS+W+PLY+MV F+RIPY  C++E++KQD+IL+    +    +  S++IG
Sbjct:   25 FFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMPFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLNGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNDFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMFDNLMNSLFPSYWIPLYTMVCFSRIPYMKCVEEKQKQDKILSRIQSLSIGVMLGSIIIG 442          
The following BLAST results are available for this feature:
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
KMO3.570e-11844.69kynurenine 3-monooxygenase [Source:HGNC Symbol;Acc... [more]
KMO6.520e-11143.48kynurenine 3-monooxygenase [Source:HGNC Symbol;Acc... [more]
KMO4.667e-10247.18kynurenine 3-monooxygenase [Source:HGNC Symbol;Acc... [more]
KMO1.494e-1836.43kynurenine 3-monooxygenase [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
kmo-11.320e-11643.32Kynurenine 3-monooxygenase [Source:UniProtKB/Swis... [more]
kmo-23.777e-5228.35Kynurenine 3-MonoOxygenase [Source:UniProtKB/TrEM... [more]
kmo-21.856e-5128.27Kynurenine 3-MonoOxygenase [Source:UniProtKB/TrEM... [more]
kmo-21.856e-5128.27Kynurenine 3-MonoOxygenase [Source:UniProtKB/TrEM... [more]
back to top
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cn1.012e-10946.55gene:FBgn0000337 transcript:FBtr0344723[more]
back to top
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
kmo2.162e-13049.39kynurenine 3-monooxygenase [Source:NCBI gene;Acc:3... [more]
back to top
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
bend33.766e-12547.16BEN domain containing 3 [Source:Xenbase;Acc:XB-GEN... [more]
bend34.086e-12348.36BEN domain containing 3 [Source:Xenbase;Acc:XB-GEN... [more]
bend31.049e-11043.43BEN domain containing 3 [Source:Xenbase;Acc:XB-GEN... [more]
bend37.139e-10344.91BEN domain containing 3 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Kmo8.941e-12144.31kynurenine 3-monooxygenase (kynurenine 3-hydroxyla... [more]
Kmo2.684e-10446.22kynurenine 3-monooxygenase (kynurenine 3-hydroxyla... [more]
Kmo9.666e-4143.01kynurenine 3-monooxygenase (kynurenine 3-hydroxyla... [more]
back to top
BLAST of Kynurenine 3-monooxygenase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q1RLY6|KMO_DANRE3.485e-12949.39Kynurenine 3-monooxygenase OS=Danio rerio OX=7955 ... [more]
sp|Q6DIZ8|KMO_XENTR1.995e-12447.16Kynurenine 3-monooxygenase OS=Xenopus tropicalis O... [more]
sp|Q86PM2|KMO_AEDAE1.043e-12347.23Kynurenine 3-monooxygenase OS=Aedes aegypti OX=715... [more]
sp|Q7Q6A7|KMO_ANOGA1.820e-12248.22Kynurenine 3-monooxygenase OS=Anopheles gambiae OX... [more]
sp|Q91WN4|KMO_MOUSE6.254e-12044.31Kynurenine 3-monooxygenase OS=Mus musculus OX=1009... [more]
back to top
BLAST of Kynurenine 3-monooxygenase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JIN93.636e-14753.46Kynurenine 3-monooxygenase OS=Lingula unguis OX=75... [more]
A0A267GLA59.782e-14151.41Kynurenine 3-monooxygenase OS=Macrostomum lignano ... [more]
B1B6U61.054e-14050.83Kynurenine 3-monooxygenase OS=Haemaphysalis longic... [more]
A0A267G5R94.478e-14051.15Kynurenine 3-monooxygenase OS=Macrostomum lignano ... [more]
A0A1I8G4J71.154e-13951.41Kynurenine 3-monooxygenase OS=Macrostomum lignano ... [more]
back to top
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
kmo2.423e-12646.17kynurenine 3-monooxygenase [Source:NCBI gene;Acc:1... [more]
kmo7.564e-12145.22kynurenine 3-monooxygenase [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
KMO1.464e-7749.79kynurenine 3-monooxygenase [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
BNA41.126e-9039.00Kynurenine 3-monooxygenase; required for the de no... [more]
back to top
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO451908.924e-13750.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438991.957e-10842.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451863.924e-9745.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO268309.735e-7839.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
kmo3.579e-12947.82kynurenine 3-monooxygenase [Source:NCBI gene;Acc:1... [more]
kmo8.600e-12947.82kynurenine 3-monooxygenase [Source:NCBI gene;Acc:1... [more]
kmo2.640e-12246.47kynurenine 3-monooxygenase [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Kynurenine 3-monooxygenase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000055694.10.000e+099.12SMESG000055694.1[more]
SMESG000055694.10.000e+099.12SMESG000055694.1[more]
SMESG000055918.10.000e+062.17SMESG000055918.1[more]
SMESG000055705.12.006e-17156.70SMESG000055705.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020600 ID=SMED30020600|Name=Kynurenine 3-monooxygenase|organism=Schmidtea mediterranea sexual|type=transcript|length=1488bp
GTCCATTCCAAAGTTCATTTTTCGATAACAACAGGAGTTTATAAATCATA
AACTACATTCAGTACCATAAATGATGTCAGAAAGTAACAAACGGCCTAAA
GTGGTTGTTGTCGGAGGTGGCCTGGTCGGAGCACTAAATGCAGTATTCTT
TTCAAAGACTGATCAATTTGATGTGCTGCTGTGTGAGAAGAGATCTGACA
TTAGAATGGACACAGAACATGTCGGGAGAAGTATCAATCTGAGTTTGTCT
CACAGAGGACGAGAAGCATTGAGAGCTGTAGGACTGGAAGAAAATATATT
GAAATCGTCTATTCGCATGTACGCGAGAATGATACACGATACTCATGGAA
ATTTAAAGCGAATTCCTTATGGGAGACCAAATGAATTCAACAATGCTGTT
GACCGAAAAGTATTAAATGAATTGTTGTTGACCGAAGCAGAATCAAACAA
AAATGTCACAATCAAATTCGGATGCAAATTAGTTGATGTTGATCTTCAAA
AAAGAATTGCCAAATTCTCCAATGGGAAATTTATTGAAGAAATTCAATAT
GATTTGTTGGTTGGAAACGACGGAGCTTATTCAACAGTTCGTCAACTGAT
GTCGAAGGGGTTGCGATTTGATTTCTCTCAAGAATTCATACCCCATGGCT
ATAAGGAATTATATTTCCCTCCAGGAGCTGATGACACATTTCTGATGGAC
ATGAATTGTTTGCATATTTGGCCAAGAAACGAATTCATGCTTATTGGTCT
TCCCAATCCCGGAGGATCGTTTACTGGAACTCTGTTTATGCCATTTAAAA
TATTTGATAAAATTAAAACAAAAGACGAGTTACTAACATTTTTTTCAAAA
TATTTTCCCGATGCTTTGGAGCTTATGGGAAAATCAAATCTAGAAAAAGT
ATATTTCTCAAGAACAGCTTCCTCTATGGTTACAATAAAATGCAACCCAT
ATAACTTCGAAGAATCTTGTGTCATAATGGGAGATGCTGCGCACGCCATG
GTGCCATTTTATGGGCAAGGAATGAATTGTGGATTCGAAGATCTGTTAAT
CTTTCACGAAATTCTAAAAGAAAATAATTATAAATTAGAAAACACTTGCT
CGGAATTCACAGAACGCCGAAATAGAGACGCCAAAACAATATGCGACTTG
GCATTTTACAATTATGTCGAGATGAGAAAATCCGTTTCTTCGAAATCTTT
TTTGATAAGGAAAAAATTTGATAATTTAATGAATTTCCTTTTTCCTTCTT
TCTGGGTTCCTCTTTATTCAATGGTGAGTTTTACAAGAATTCCTTATAGT
TTGTGCTTGAAAGAAAGAAAAAAGCAAGATAGAATTTTGACAATTTTCGG
ATTTATTGGACGAGCTGCTTTGGCTATCAGTTTGTTGATTGGCTATCAAT
TTGCGATGAAATATCGAATCAAATTCGTTTATTAAATCTAGCAACTAAAT
AATGTTATATCTAAAAATATACATGAGACTTCTTAAAG
back to top

protein sequence of SMED30020600-orf-1

>SMED30020600-orf-1 ID=SMED30020600-orf-1|Name=SMED30020600-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=455bp
MMSESNKRPKVVVVGGGLVGALNAVFFSKTDQFDVLLCEKRSDIRMDTEH
VGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPY
GRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKFS
NGKFIEEIQYDLLVGNDGAYSTVRQLMSKGLRFDFSQEFIPHGYKELYFP
PGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFKIFDKIKT
KDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESC
VIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERR
NRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYS
MVSFTRIPYSLCLKERKKQDRILTIFGFIGRAALAISLLIGYQFAMKYRI
KFVY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000419prepharyngeal region
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036188FAD/NAD-bd_sf
IPR002938FAD-bd
IPR023753FAD/NAD-binding_dom
Vocabulary: molecular function
TermDefinition
GO:0071949FAD binding
GO:0016491oxidoreductase activity
GO:0004497monooxygenase activity
GO:0004502kynurenine 3-monooxygenase activity
GO:0050660flavin adenine dinucleotide binding
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006569tryptophan catabolic process
GO:0009435NAD biosynthetic process
GO:0019363pyridine nucleotide biosynthetic process
GO:0019805quinolinate biosynthetic process
GO:0034354'de novo' NAD biosynthetic process from tryptophan
GO:0043420anthranilate metabolic process
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00420RNGMNOXGNASEcoord: 312..328
score: 32.75
coord: 159..174
score: 41.04
coord: 297..312
score: 38.54
coord: 10..32
score: 32.46
NoneNo IPR availablePANTHERPTHR46028FAMILY NOT NAMEDcoord: 2..442
NoneNo IPR availablePANTHERPTHR46028:SF2KYNURENINE 3-MONOOXYGENASEcoord: 2..442
NoneNo IPR availableTMHMMTMhelixcoord: 385..407
NoneNo IPR availableTMHMMTMhelixcoord: 422..444
IPR002938FAD-binding domainPFAMPF01494FAD_binding_3coord: 10..325
e-value: 5.8E-16
score: 58.7
IPR036188FAD/NAD(P)-binding domain superfamilyGENE3DG3DSA:3.50.50.60coord: 9..385
e-value: 1.1E-123
score: 415.3
IPR036188FAD/NAD(P)-binding domain superfamilySUPERFAMILYSSF51905FAD/NAD(P)-binding domaincoord: 10..395