Phosphatase 1 regulatory subunit 7-like

Overview
NamePhosphatase 1 regulatory subunit 7-like
Smed IDSMED30020598
Length (bp)1550
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphatase 1 regulatory subunit 7-like (SMED30020598) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphatase 1 regulatory subunit 7-like (SMED30020598) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphatase 1 regulatory subunit 7-like (SMED30020598) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphatase 1 regulatory subunit 7-like (SMED30020598) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020598

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30020598SMESG000066010.1 SmedASXL_007871SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Human
Match: PPP1R7 (protein phosphatase 1 regulatory subunit 7 [Source:HGNC Symbol;Acc:HGNC:9295])

HSP 1 Score: 88.1965 bits (217), Expect = 9.098e-19
Identity = 77/245 (31.43%), Postives = 125/245 (51.02%), Query Frame = 2
Query:  230 EIPSNFDSENLLTRRNESKPKDGYTLDLRCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEI-GTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQI-SIDQIKYL 958
            E+P + ++ NL         +D   +DL   ++  I      K  K L +  N +K + NL+ L  LREL ++DNQ++ I NLE L EL +L   +N ++ I G   L    +LK + L NN + KI N   SN   L  +++  N +++I  I  L N+E  +   NKI  +  L     L+ + + SN ++ I G+++L +L  L  SHN I  +  L   NK   L+++ N+I  I+ I +L
Sbjct:    5 ELPVDMETINL--------DRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKL---TRLKKLFLVNNKISKIEN--LSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHL 236          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Human
Match: PPP1R7 (protein phosphatase 1 regulatory subunit 7 [Source:HGNC Symbol;Acc:HGNC:9295])

HSP 1 Score: 88.1965 bits (217), Expect = 1.487e-18
Identity = 77/245 (31.43%), Postives = 125/245 (51.02%), Query Frame = 2
Query:  230 EIPSNFDSENLLTRRNESKPKDGYTLDLRCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEI-GTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQI-SIDQIKYL 958
            E+P + ++ NL         +D   +DL   ++  I      K  K L +  N +K + NL+ L  LREL ++DNQ++ I NLE L EL +L   +N ++ I G   L    +LK + L NN + KI N   SN   L  +++  N +++I  I  L N+E  +   NKI  +  L     L+ + + SN ++ I G+++L +L  L  SHN I  +  L   NK   L+++ N+I  I+ I +L
Sbjct:   21 ELPVDMETINL--------DRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKL---TRLKKLFLVNNKISKIEN--LSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHL 252          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Human
Match: PPP1R7 (protein phosphatase 1 regulatory subunit 7 [Source:HGNC Symbol;Acc:HGNC:9295])

HSP 1 Score: 85.5001 bits (210), Expect = 6.211e-18
Identity = 74/225 (32.89%), Postives = 116/225 (51.56%), Query Frame = 2
Query:  290 KDGYTLDLRCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEI-GTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQI-SIDQIKYL 958
            +D   +DL   ++  I      K  K L +  N +K + NL+ L  LREL ++DNQ++ I NLE L EL +L   +N ++ I G   L   KKL    L NN + KI N   SN   L  +++  N +++I  I  L N+E  +   NKI  +  L     L+ + + SN ++ I G+++L +L  L  SHN I  +  L   NK   L+++ N+I  I+ I +L
Sbjct:   60 RDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKL---FLVNNKISKIEN--LSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHL 279          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Human
Match: PPP1R7 (protein phosphatase 1 regulatory subunit 7 [Source:HGNC Symbol;Acc:HGNC:9295])

HSP 1 Score: 87.0409 bits (214), Expect = 6.260e-18
Identity = 73/225 (32.44%), Postives = 117/225 (52.00%), Query Frame = 2
Query:  290 KDGYTLDLRCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEI-GTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQI-SIDQIKYL 958
            +D   +DL   ++  I      K  K L +  N +K + NL+ L  LREL ++DNQ++ I NLE L EL +L   +N ++ I G   L    +LK + L NN + KI N   SN   L  +++  N +++I  I  L N+E  +   NKI  +  L     L+ + + SN ++ I G+++L +L  L  SHN I  +  L   NK   L+++ N+I  I+ I +L
Sbjct:   76 RDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKL---TRLKKLFLVNNKISKIEN--LSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHL 295          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Human
Match: PPP1R7 (protein phosphatase 1 regulatory subunit 7 [Source:HGNC Symbol;Acc:HGNC:9295])

HSP 1 Score: 87.0409 bits (214), Expect = 6.260e-18
Identity = 73/225 (32.44%), Postives = 117/225 (52.00%), Query Frame = 2
Query:  290 KDGYTLDLRCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEI-GTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQI-SIDQIKYL 958
            +D   +DL   ++  I      K  K L +  N +K + NL+ L  LREL ++DNQ++ I NLE L EL +L   +N ++ I G   L    +LK + L NN + KI N   SN   L  +++  N +++I  I  L N+E  +   NKI  +  L     L+ + + SN ++ I G+++L +L  L  SHN I  +  L   NK   L+++ N+I  I+ I +L
Sbjct:   76 RDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKL---TRLKKLFLVNNKISKIEN--LSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHL 295          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Celegans
Match: sds-22 (Protein phosphatase 1 regulatory subunit SDS22 homolog [Source:UniProtKB/Swiss-Prot;Acc:P45969])

HSP 1 Score: 69.707 bits (169), Expect = 9.150e-13
Identity = 83/304 (27.30%), Postives = 131/304 (43.09%), Query Frame = 2
Query:  293 DGYTLDLRCEKLDNIPILTNFKHHKVLDISSNN-VKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLS----------------------EIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDNEFPIFDETCQQYSSAMVT 1135
            D   +DL   + D+IP LT F   + L + +N  V I   +  L  L  L +++NQL  IS+LE+L  LV L   YN+I++I    L    KL+ + L +N + KI N        L  +++  N ++ I  I  L N++E +   NKI  +  +   +KLS                      E++LS   +  I GV  L +L  LD ++N I + S +  L        +DN++                         S+I    E LS L  L  +Y++ N F  F++T Q     M+T
Sbjct:   37 DSPEIDLTHTRADHIPDLTGFPKIEELRMRNNLLVSISPTISSLVTLTSLDLYENQLTEISHLESLVNLVSLDLSYNRIRQIN--GLDKLTKLETLYLVSNKIEKIEN--LEALTQLKLLELGDNRIKKIENIGHLVNLDELFIGKNKIRQLEGVETLQKLSVLSLPGNRIVKIENVEQLNNLKELYLSDQGLQDIHGVEPLTNLLLLDVANNEIKTFSGVERLESLNDFWANDNKVE----------------------SFSEI----EQLSKLKGLQTVYLERNPF-YFNDTNQYRRKVMMT 309          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Celegans
Match: K10D2.8 (pep chromosome:WBcel235:III:5188726:5190175:1 gene:WBGene00189952.1 transcript:K10D2.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K10D2.8)

HSP 1 Score: 67.781 bits (164), Expect = 4.098e-12
Identity = 60/211 (28.44%), Postives = 101/211 (47.87%), Query Frame = 2
Query:  371 LDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQI----SIDQIKYLKTTFINLEVLN 991
            L +  N +K +++ Q L+ L  L + DNQ+E + NLE L  LV L   YN+I +I    L     L+ + L +N +  IT         + Y++   N +Q +  ++ L N+E  +   N+I  I  L    +L E+ L  N +  I G+  L  L ++  + N I  +  L  L   + L+L+DN I    +++Q K + +  I    LN
Sbjct:   54 LSLRWNLLKKIDHFQCLTSLTRLNLNDNQIEKLENLETLVNLVFLDVSYNRITKI--EGLSELINLEELHLVHNKI--ITIEGLETNTAMKYLEFGDNRIQKMENLSHLVNLERLFLGANQIRKIEGLDGMAQLKELSLPGNALQIIEGLDTLSGLKSISLAQNGIRKIDGLSGLTNLKSLDLNDNIIEKLENVEQFKGISSLMIRKNKLN 260          

HSP 2 Score: 51.9878 bits (123), Expect = 5.066e-7
Identity = 63/241 (26.14%), Postives = 108/241 (44.81%), Query Frame = 2
Query:  479 ENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQI----SIDQIKYLKT---------------TFINLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDNEFPIFD--ETCQQYSSAMVTR 1138
            E++ EL +++ +  KI +           ++ + L  N L KI  + F    +LT ++++ N ++ +  +  L N+     S+N+I  I  LS    L E+HL  N I  I G+    ++  L+F  NRI  +  L  L   E L L  NQI     +D +  LK                T   L+ +++++NG+  I    + LS L+NL  L + DN     +  E  +  SS M+ +
Sbjct:   27 EDITELSLIRHRIQKIWQ-----FENTPGIRDLSLRWNLLKKI--DHFQCLTSLTRLNLNDNQIEKLENLETLVNLVFLDVSYNRITKIEGLSELINLEELHLVHNKIITIEGLETNTAMKYLEFGDNRIQKMENLSHLVNLERLFLGANQIRKIEGLDGMAQLKELSLPGNALQIIEGLDTLSGLKSISLAQNGIRKI----DGLSGLTNLKSLDLNDNIIEKLENVEQFKGISSLMIRK 256          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Celegans
Match: let-413 (pep chromosome:WBcel235:V:7972924:7977774:-1 gene:WBGene00002632.1 transcript:F26D11.11a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-413)

HSP 1 Score: 61.6178 bits (148), Expect = 7.856e-10
Identity = 83/339 (24.48%), Postives = 157/339 (46.31%), Query Frame = 2
Query:  353 FKHHKVLDISSNNVKILNNLQY-LSELRELKIFDNQLEII-SNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITN----------------------NDFSNCINLTYVDVSFNNLQSISF-ITCLPNIEEFYASHNKIEIIP-ELSRCKKLSEIHLSSNIISHI-GGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDNEFPIFDETCQQYSSAMVTRHLGNLLILDNVSVKYSDIDNVINTVSVPESSNVALPELSLKQVENQLTEI 1288
            F+  + L+++ NN+K L++  + L  LR L + DN+L ++ + + NL +L+ L    N I ++    ++ CK L  + L +N   ++                        ++  +  NL  ++   N L++I   I  L  +EE     N++E +P E+ +   L E ++  N ++ +   +   + L  LD S N+I  L +    N     NL+D  ISI++I  L ++F  L+ L + K   + +H L   +    +L ELY+  N      +T            +G+L  L  ++V  +++ ++ +T+   +S  V    LSL+Q  N LTE+
Sbjct:   35 FRKLEDLNLTMNNIKELDHRLFSLRHLRILDVSDNELAVLPAEIGNLTQLIELNLNRNSIAKL-PDTMQNCKLLTTLNLSSNPFTRLPETICECSSITILSLNETSLTLLPSNIGSLTNLRVLEARDNLLRTIPLSIVELRKLEELDLGQNELEALPAEIGKLTSLREFYVDINSLTSLPDSISGCRMLDQLDVSENQIIRLPE----NLGRMPNLTDLNISINEIIELPSSFGELKRLQMLKADRNSLHNLTSEIGKCQSLTELYLGQNFLTDLPDT------------IGDLRQLTTLNVDCNNLSDIPDTIGNCKSLTV----LSLRQ--NILTEL 350          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Celegans
Match: let-413 (pep chromosome:WBcel235:V:7972934:7977774:-1 gene:WBGene00002632.1 transcript:F26D11.11b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-413)

HSP 1 Score: 61.2326 bits (147), Expect = 1.178e-9
Identity = 83/339 (24.48%), Postives = 157/339 (46.31%), Query Frame = 2
Query:  353 FKHHKVLDISSNNVKILNNLQY-LSELRELKIFDNQLEII-SNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITN----------------------NDFSNCINLTYVDVSFNNLQSISF-ITCLPNIEEFYASHNKIEIIP-ELSRCKKLSEIHLSSNIISHI-GGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDNEFPIFDETCQQYSSAMVTRHLGNLLILDNVSVKYSDIDNVINTVSVPESSNVALPELSLKQVENQLTEI 1288
            F+  + L+++ NN+K L++  + L  LR L + DN+L ++ + + NL +L+ L    N I ++    ++ CK L  + L +N   ++                        ++  +  NL  ++   N L++I   I  L  +EE     N++E +P E+ +   L E ++  N ++ +   +   + L  LD S N+I  L +    N     NL+D  ISI++I  L ++F  L+ L + K   + +H L   +    +L ELY+  N      +T            +G+L  L  ++V  +++ ++ +T+   +S  V    LSL+Q  N LTE+
Sbjct:   35 FRKLEDLNLTMNNIKELDHRLFSLRHLRILDVSDNELAVLPAEIGNLTQLIELNLNRNSIAKL-PDTMQNCKLLTTLNLSSNPFTRLPETICECSSITILSLNETSLTLLPSNIGSLTNLRVLEARDNLLRTIPLSIVELRKLEELDLGQNELEALPAEIGKLTSLREFYVDINSLTSLPDSISGCRMLDQLDVSENQIIRLPE----NLGRMPNLTDLNISINEIIELPSSFGELKRLQMLKADRNSLHNLTSEIGKCQSLTELYLGQNFLTDLPDT------------IGDLRQLTTLNVDCNNLSDIPDTIGNCKSLTV----LSLRQ--NILTEL 350          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Celegans
Match: lron-15 (ELRR (Extracellular Leucine-Rich Repeat) ONly [Source:UniProtKB/TrEMBL;Acc:Q18902])

HSP 1 Score: 60.4622 bits (145), Expect = 2.800e-9
Identity = 69/243 (28.40%), Postives = 113/243 (46.50%), Query Frame = 2
Query:  242 NFDSENLLTRRNESKPKDGYTLDLRCEKLDNIPILTNFKHHKVLDISSNNVKILNN--LQYLSELRELKIFDNQLEIISNLENL------KELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSI--SFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHN--RITSLSKLGVLNKAEYLNLSDNQI 934
            +F+    ++ R   K K+  +L L+  +L + P L      + L + +N ++ ++N  L  L +L+ L +  NQL+II+  EN+       EL  L   +NKI  I + +      L+ +RL +N +  IT+  FSN  NL Y+D+S N +  I  S +  LP ++  +  HN +    E+ R                    R    L +L  SHN  R  S   LG +++   L+LS NQI
Sbjct:  494 SFNRIRFISPRVFEKLKNLESLFLQNNQLAHFPSLFRLDKLRHLMLDNNQIQKIDNFSLADLPKLQHLSLAGNQLDIIT--ENMFGSSSSSELKSLNLAHNKIHSISSRSFSDLDNLQQLRLSHNNIRTITSMTFSNLRNLRYLDLSHNRIIKILPSALYQLPALDVLHLDHNNLN---EIDR-----------------DAFRSFSDLQSLKLSHNAFRRFSCEFLGSISQVHQLDLSSNQI 714          

HSP 2 Score: 55.0694 bits (131), Expect = 1.112e-7
Identity = 55/229 (24.02%), Postives = 113/229 (49.34%), Query Frame = 2
Query:  371 LDISSNNVKILNNLQYLSELRELKIFDNQLEIISN--LENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLP-NIEEFYASHNKIEIIPELSRCKKLSEIHL----SSNI-ISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLN--KAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHKL 1027
            LD+SSN +  ++       +R+L +  N +E I+   L++  EL  +   +N I ++ + A   C+KL HI+L +N++  +    F    +L  +D+SFN++  +   T    NI + + ++NK+  IP  +    ++ +HL     +NI I     +    +L+ L F++N++ S+      N    + L+LS+N ++       +    ++  +N++  GL  + K 
Sbjct:  707 LDLSSNQINEIDIFCIARGIRKLSLASNSVEKINRKLLQDATELTSIDISHNGIIDVDSDAFCECRKLSHIKLSHNYIRNLWKGTFQYQESLHTLDISFNDILFLHQGTFGKNNILQLHVNNNKLSRIPLEALSSTMASLHLLDLAHNNIKIVDSSQLTSFGNLSILSFANNKVDSIEDGAFENLLSLKILDLSNNPVTSWSPTAFRDLSHSISSINMANTGLFSMPKF 935          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Fly
Match: sds22 (gene:FBgn0028992 transcript:FBtr0083436)

HSP 1 Score: 74.7146 bits (182), Expect = 2.442e-14
Identity = 70/217 (32.26%), Postives = 108/217 (49.77%), Query Frame = 2
Query:  293 DGYTLDL---RCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQI 934
            D Y LDL   R EKL+N   LT  +    L +  N +K + NL  L  L EL+++DNQ+  I NL++L  L VL   +N++ +I    L    KL+ +   +N + +I N D     NLT +++  N L+ I  I  L N+ + +   NKI  I  L     L  + L +N I  I  +  L +L  L  S N + ++  L    K E L+L+ N++
Sbjct:   40 DCYELDLNHRRIEKLENFEPLTRIER---LFLRWNLIKKIENLSSLKTLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKIEN--LDKLVKLEKVYFVSNRITQIENLDM--LTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQANRIVKIENLEKLANLRELYVSENGVETIENLSENTKLETLDLAKNRL 249          

HSP 2 Score: 62.003 bits (149), Expect = 4.202e-10
Identity = 60/199 (30.15%), Postives = 97/199 (48.74%), Query Frame = 2
Query:  314 RCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVL--NKA 904
            + E LD++P      H +VLDIS N +  + NL  L +L ++    N++  I NL+ L  L +L+   NK+++I    +     L+ + L  N + KI N D    +NL  + +  N +  I  +  L N+ E Y S N +E I  LS   KL  + L+ N +  I  +  L+ L  L  +HN +     + +L  NKA
Sbjct:   97 KIENLDDLP------HLEVLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIEN--IEMLVNLRQLFLGKNKIAKIENLD--TLVNLEILSLQANRIVKIENLEKLANLRELYVSENGVETIENLSENTKLETLDLAKNRLKGIANLEKLELLEELWLNHNGVDDWKDIELLKVNKA 285          

HSP 3 Score: 53.1434 bits (126), Expect = 2.584e-7
Identity = 60/201 (29.85%), Postives = 95/201 (47.26%), Query Frame = 2
Query:  434 ELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQI-SIDQIKYLKTTFINLEVLNISKNGLSDIHKLLE 1033
            EL +   ++E + N E L  +  L  ++N I++I    L   K L  + L +N + KI N D  +  +L  +D+SFN L  I  +  L  +E+ Y   N+I  I  L     L+ + L  N +  I  +  L +L  L    N+I  +  L  L   E L+L  N+I  I+ ++ L     NL  L +S+NG+  I  L E
Sbjct:   43 ELDLNHRRIEKLENFEPLTRIERLFLRWNLIKKIEN--LSSLKTLIELELYDNQITKIENLD--DLPHLEVLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQANRIVKIENLEKLA----NLRELYVSENGVETIENLSE 235          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Fly
Match: Toll-7 (gene:FBgn0034476 transcript:FBtr0086336)

HSP 1 Score: 69.3218 bits (168), Expect = 5.272e-12
Identity = 62/219 (28.31%), Postives = 103/219 (47.03%), Query Frame = 2
Query:  305 LDLRCEKLDNIP-ILTNFKHHKVLDISSNNVKILNNLQY--LSELRELKIFDNQLE--IISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKS---LTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQIS 937
            LDL   +L+ +P  L +    + LD+  N ++  +N  +  L +L  L++ DNQ+    +   ++L  L VL    N+IQ I  G+     +L+ IRLD NFL  I N  F+  ++L ++++S N+L    +     N+                    K  +IH   N I  +G    L+    + TLD SHNRIT +  + + N  E L +++N I 
Sbjct:  471 LDLSSNQLNEVPRALQDLAMLRTLDLGENQIRTFDNQSFKNLHQLTGLRLIDNQIGNITVGMFQDLPRLSVLNLAKNRIQSIERGSFDKNFELEAIRLDRNFLADI-NGVFATLVSLLWLNLSENHLVWFDYAFIPSNL--------------------KWLDIH--GNYIEALGNYYKLQEEIRVKTLDASHNRITEIGPMSIPNTIELLFINNNLIG 666          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Fly
Match: 18w (gene:FBgn0004364 transcript:FBtr0086309)

HSP 1 Score: 66.6254 bits (161), Expect = 4.154e-11
Identity = 72/249 (28.92%), Postives = 116/249 (46.59%), Query Frame = 2
Query:  305 LDLRCEKLDNIP-ILTNFKHHKVLDISSNNVKIL--NNLQYLSELRELKIFDNQLE--IISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKS---LTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFIN---LEVLNISKNGLSDI 1018
            LDL   +L  +P  + +    K LD+  N +     N  + L++L  L++ DN++    +   ++L  L VL    N+IQ I  GA     +++ IRLD NFL  I N  F+   +L ++++S N+L    +     N+                    K  +IH   N I  +G    L+    +TTLD SHNRIT +  + V N  E L +++N I   QI+    TF++   L  +++  N LS I
Sbjct:  434 LDLSSNQLTEVPEAVQDLSMLKTLDLGENQISEFKNNTFRNLNQLTGLRLIDNRIGNITVGMFQDLPRLSVLNLAKNRIQSIERGAFDKNTEIEAIRLDKNFLTDI-NGIFATLASLLWLNLSENHLVWFDYAFIPSNL--------------------KWLDIH--GNYIEALGNYYKLQEEIRVTTLDASHNRITEIGAMSVPNSIELLFINNNIIG--QIQ--ANTFVDKTRLARVDLYANVLSKI 655          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Fly
Match: Tollo (gene:FBgn0029114 transcript:FBtr0075607)

HSP 1 Score: 63.1586 bits (152), Expect = 4.429e-10
Identity = 73/267 (27.34%), Postives = 124/267 (46.44%), Query Frame = 2
Query:  323 KLDNIP-ILTNFKHHKVLDISSNNVKILNN--LQYLSELRELKIFDNQLEIISN--LENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKS---LTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQIS-IDQIKYLKTTFINLEVLNISKNGLSDIHKLLEYLSNLS---NLCELYIQDNEF 1087
            KL  +P  L + +  K LD+  N +  + N  +  L  L  L++ +N L  I     + +  L +L    NK++ I  G+L+   +L+ IRLD N L  I    F+   NL ++++S N L            E+F  SH  I           L  + + +N I+ +G   +++S   L+T D S+N +T ++   + N  E L L+DNQIS I    + K    NL  +++ +N L+ +      LS ++    + E YI  N +
Sbjct:  439 KLQAVPEALAHVQLLKTLDVGENMISQIENTSITQLESLYGLRMTENSLTHIRRGVFDRMSSLQILNLSQNKLKSIEAGSLQRNSQLQAIRLDGNQLKSIAGL-FTELPNLVWLNISGNRL------------EKFDYSHIPI----------GLQWLDVRANRITQLGNYFEIESELSLSTFDASYNLLTEITASSIPNSVEVLYLNDNQISKIQPYTFFKKP--NLTRVDLVRNRLTTLEPNALRLSPIAEDREIPEFYIGHNAY 680          

HSP 2 Score: 49.2914 bits (116), Expect = 8.192e-6
Identity = 71/283 (25.09%), Postives = 123/283 (43.46%), Query Frame = 2
Query:  302 TLDLRCEKLD----NIPILTNFKHHKVLDISSNNVKILNN--LQYLSELRELKIFDNQLE-----IISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPE-LSRCKKLSEIHLSSNIISHI--GGVRDLKSLTTLDFSHNRITSLSKLGVLNKA---EYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDNEFPIFD 1099
             LDL   +L+    N       K   +LD+S+N +  L     + L+ L+ LK+ DN ++     I ++L NL  L++ +   N+I  I    L+  K L  + LD N + ++      NC  L                      ++ + + NK++ +PE L+  + L  + +  N+IS I    +  L+SL  L  + N +T + + GV ++    + LNLS N++   +   L+     L+ + +  N L  I  L    + L NL  L I  N    FD
Sbjct:  310 VLDLASNELNSQWINAATFVGLKRLMMLDLSANKISRLEAHIFRPLASLQILKLEDNYIDQLPGGIFADLTNLHTLILSR---NRISVIEQRTLQGLKNLLVLSLDFNRISRMDQRSLVNCSQL----------------------QDLHLNDNKLQAVPEALAHVQLLKTLDVGENMISQIENTSITQLESLYGLRMTENSLTHIRR-GVFDRMSSLQILNLSQNKLKSIEAGSLQRN-SQLQAIRLDGNQLKSIAGL---FTELPNLVWLNISGNRLEKFD 562          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Fly
Match: Toll-6 (gene:FBgn0036494 transcript:FBtr0075614)

HSP 1 Score: 62.003 bits (149), Expect = 1.120e-9
Identity = 77/281 (27.40%), Postives = 131/281 (46.62%), Query Frame = 2
Query:  272 RNESKPKDGYTLDLRCEKLDNIPI-LTNFKHHKVLDISSNNVKILNNLQY--LSELRELKIFDNQLEIIS--NLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQI-SIDQIKYLKTTFINLEVLNISKNGLSDIH-KLLEYLSNLSN--LCELYIQDNEF 1087
            RN S  +D   L+L   +L  +P+ L N +H + +D+  N + ++ +  +  L  L  L++  N LE I+     +L  L +L    N+I  +  GA      ++ +RLD N L+ I N  FSN  +L ++++S N L+S  +             H     +P   +   L +  LSS  +S+  G+     L TLD S N++  +    + N  E L L+DN I ++D   ++  T  NL  +++  N ++ +  K L  L    +  L E YI  N F
Sbjct:  493 RNCSALQD---LNLNGNQLKTVPLALRNMRHLRTVDLGENMITVMEDSAFKGLGNLYGLRLIGNYLENITMHTFRDLPNLQILNLARNRIAVVEPGAFEMTSSIQAVRLDGNELNDI-NGLFSNMPSLLWLNISDNRLESFDY------------GH-----VPSTLQWLDLHKNRLSS--LSNRFGLDSELKLQTLDVSFNQLQRIGPSSIPNSIELLFLNDNLITTVDPDTFMHKT--NLTRVDLYANQITTLDIKSLRILPVWEHRALPEFYIGGNPF 748          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Zebrafish
Match: ppp1r7 (protein phosphatase 1, regulatory (inhibitor) subunit 7 [Source:NCBI gene;Acc:560323])

HSP 1 Score: 65.0846 bits (157), Expect = 4.721e-11
Identity = 62/240 (25.83%), Postives = 104/240 (43.33%), Query Frame = 2
Query:  314 RCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEI-GTGALRYCKK-------------------LKHIRLDNNFLHKITN--------------------NDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYL 913
            R  K++ + +L      K + +  N +K + NL+ L  LREL ++DNQ+  + NL+ L EL  L   +N +++I G  +L   KK                   L+ + L +N +  I N                     +     NLT + +  N +  +  +  L N+ E Y SHN IE++  L   KKLS + +++N I  I  +  L  L     + N+I + + L  L  A+ L
Sbjct:   72 RIGKIEGLEVLL---KAKTISLRQNLIKRIENLESLVSLRELDLYDNQIRKLENLQALTELEQLDVSFNLLRKIEGLDSLTKVKKLFLLHNKIASIANLDHLTSLQMLELGSNRIRVIENLDSLSSLESLFLGTNKITQLQNLDGLHNLTVLSIQSNRITKLEGLQNLVNLRELYLSHNGIEVMEGLENNKKLSTLDIAANRIKKIENISHLTDLKEFWMNDNQIENWADLDELKNAKGL 308          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Zebrafish
Match: lrrc40 (leucine rich repeat containing 40 [Source:NCBI gene;Acc:334130])

HSP 1 Score: 64.3142 bits (155), Expect = 1.862e-10
Identity = 69/270 (25.56%), Postives = 124/270 (45.93%), Query Frame = 2
Query:  377 ISSNNVK-ILNNLQYLSELRELKIFDNQL----EIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNN----------------------DFSNCINLTYVDVSFNNLQSIS----------FITC--------------LPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGG--VRDLKSLTTLDFSHNRITSLS-KLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHK 1024
            +SSN ++ I ++++ L  L  L I DNQL    + I +LE L++L++    +NK+ E+ +G  R    L+ + L  N + +I  +                        +N  NL  +D+S N L+S+            + C              + ++E+ Y  HNK+  +PEL  CK L E+H  +N I  +    ++ L +L+ L+   N++ SL  ++ +L   E L+L++N IS   +     T   L+ L++  N L  I +
Sbjct:   87 LSSNKLQSIPDDVKLLPALVVLDIHDNQLSSLPDSIGDLEQLQKLIL---SHNKLTELPSGVWRLTN-LRCLHLQQNLIEQIPRDLGQLVNLDDLDLSNNHLIDIPESLANLQNLVKLDLSCNKLKSLPPAISQMKNLRMLDCSRNQMESIPPVLAQMESLEQLYLRHNKLRFLPELPCCKTLKELHCGNNQIEVLEAEHLKHLNALSLLELRDNKVKSLPEEITLLQGLERLDLTNNDIS--SLPCGLGTLPKLKSLSLEGNPLRAIRR 350          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Zebrafish
Match: lgr4 (Danio rerio leucine-rich repeat containing G protein-coupled receptor 4 (lgr4), mRNA. [Source:RefSeq mRNA;Acc:NM_001353862])

HSP 1 Score: 64.6994 bits (156), Expect = 1.959e-10
Identity = 96/363 (26.45%), Postives = 149/363 (41.05%), Query Frame = 2
Query:  290 KDGYTLDLRCEKLDNIPI-LTNFKHHKVLDISSNNVK-----ILNNLQYLSELR------------------ELKIF---DNQLEII--SNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHK------------------------ITNNDFSNCINLTYVDVSFNNLQSIS-FITCLPNIEEFYASHNKIEIIPELSRCKK--LSEIHLSSNIISHIG----------------------------GVRDLKSLT---------------------TLDFSHNRITSLSKLGVLNKAEYLNLSDNQI-SIDQIKYLKTTFINLEVLNISKNGLSDIHK-LLEYLSNLSNL 1057
            +DG   D     L ++P  L+ F ++  LDIS NN+      +  NL YL ELR                  +LK+    +NQL+ +  + L+NL  L  L+   N I  +   +    ++L+H+ LD+N L +                        I +N F+N  +L  +D++FNNL+     I  LP ++E     N I  IPE + C+   L  IHL  N +S +G                            G  +L+SLT                     T+D S+N I  L       + + +NL  NQI  ID+  +   T  +L VL++S+N +  IH+     LS L+NL
Sbjct:   40 EDGGA-DCSGRGLTSVPTGLSAFTYY--LDISMNNITELPANVFRNLPYLEELRLAGNDLAFIHPEALSGLHQLKVLMLQNNQLKTVPSAALKNLNALQSLRLDANHITSVPEDSFEGLQQLRHLWLDDNSLTEVPISPLQHQSNLQALTLALNRITHIPDNAFANLSSLVVLDLNFNNLKIFPEAIQMLPKLKELGFHSNNIASIPEGAFCRNSLLRTIHLFDNPLSFVGTTAFQNLSDLHSLMLRGASMMQDFPSLTGTINLESLTLTGTKIRSIPADLCEDLTVLRTVDLSYNDIEDLPSFQGCVRLQDINLQHNQIKQIDRGTFQGMT--SLRVLDLSRNQIKFIHRDAFLSLSALTNL 397          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Zebrafish
Match: lrrc8aa (leucine rich repeat containing 8 VRAC subunit Aa [Source:ZFIN;Acc:ZDB-GENE-030131-5853])

HSP 1 Score: 63.929 bits (154), Expect = 2.820e-10
Identity = 60/172 (34.88%), Postives = 93/172 (54.07%), Query Frame = 2
Query:  395 KILNNLQYLSELRELKIFDNQL----EIISNLENLKELVVLQAQYNKIQ----EIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISF-ITCLPNIEEFYASHNKIEIIP-ELSRCKKLSEIHLSSNIISHIGG-VRDLKSLTTLDFSHNRITSL 877
            +I +++  L  L+E+ + DN L    EIIS  ++L  LV L+  YN+I     +IGT        L+ + L+ N + KI    F  C  L Y+D+S NNL SI   I  L N++ F  + N+IE +P EL +CKKL  ++L +N ++ +     +L  LT L+   NR+  L
Sbjct:  590 RIPHSIFSLHNLQEIDLKDNNLKTIEEIIS-FQHLHRLVCLKLWYNQIAYIPIQIGT-----LTNLERLYLNRNKIEKIPAQLFF-CRKLRYLDLSHNNLTSIPADIGFLQNLQYFAVTANRIETLPPELFQCKKLRTLNLGNNCLTALPSRFGELSGLTQLELRGNRLEGL 754          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Zebrafish
Match: lrrc9 (leucine rich repeat containing 9 [Source:ZFIN;Acc:ZDB-GENE-080917-56])

HSP 1 Score: 60.8474 bits (146), Expect = 2.052e-9
Identity = 78/294 (26.53%), Postives = 132/294 (44.90%), Query Frame = 2
Query:  308 DLRCEKLDNIPILTNFKHHKVLDISSNNVKI--LNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIE--IIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDNEFPIFDETCQQYSSAMVTRHLGNLLILDNVSV 1177
            D+  EKL +    TN++    L++ S+++++  L        LR + +  N L   S L  L  + VL   YN ++ I    L   K   H+       HK++++ +    +    +   +NL+ +     + ++E  +  HN I   I  ++SR   L  + L  N IS + G+  L+ L  L    NRI SLS+     +A  L+L   +  I ++ +L+     L  L +  N + DI + LE L  L +L EL +  N  P+   T +      V  HL  L +LD V+V
Sbjct:   46 DMVAEKLGH----TNYRDLSELNLHSSSIRMVDLTPADLFGNLRSINLEHNNLTSFSGLIFLPNIKVLSLNYNHVESI----LPRQKVQSHMSNKQILYHKVSSSGYGQQNSRPSREGLTDNLEPL-----MSSLEVLHLGHNGISNLINLQISRLTNLRALFLQGNDISQVDGLDGLQKLRELVLDRNRIKSLSENSFCGQAVLLDLHLRENRIRELNHLQ-PLTGLRRLFLDMNKIQDISE-LEKLETLPSLLELSVMGN--PV---TRRSLHRPPVILHLSTLQVLDGVTV 319          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Xenopus
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:448394])

HSP 1 Score: 76.2554 bits (186), Expect = 1.875e-14
Identity = 66/219 (30.14%), Postives = 110/219 (50.23%), Query Frame = 2
Query:  305 LDLRCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQIS-IDQIKYL 958
            +DL   K+  I      K  K L +  N +K++ NL+ L  L EL ++DNQ+  I NLE L++L +L   +N ++ I    L     L+ + L NN + +I N  F     L  +++  N L+ I  +  L  ++  +   NKI  +  L     L+ + + SN ++ I G+++L +L  L  S N I  +  L   NK   L+L+ N+I  I+ IK+L
Sbjct:   88 VDLNHFKIGKIQGFEVLKKVKTLCLRQNLIKLIENLEQLVTLTELDLYDNQIRKIGNLETLRDLQILDLSFNLLRRI--EGLESLSHLQRLYLVNNKISRIEN--FGTLTQLRLLELGSNRLRVIENLDSLRELDSLFLGKNKITKLQNLETLTNLTVLSVQSNRLTKIEGLQNLVNLRELYLSDNGIQVIEGLENNNKLTTLDLASNRIKRIENIKHL 302          

HSP 2 Score: 63.929 bits (154), Expect = 2.295e-10
Identity = 63/202 (31.19%), Postives = 95/202 (47.03%), Query Frame = 2
Query:  371 LDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQY---NKIQ--------------EIGTGALRYCKKLKHIR-LDNNFL--HKITN-NDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYL 913
            LD+  N ++ + NL+    LR+L+I D    ++  +E L+ L  LQ  Y   NKI               E+G+  LR  + L  +R LD+ FL  +KIT   +     NLT + V  N L  I  +  L N+ E Y S N I++I  L    KL+ + L+SN I  I  ++ L  L     + N + + S L  L+ A  L
Sbjct:  132 LDLYDNQIRKIGNLET---LRDLQILDLSFNLLRRIEGLESLSHLQRLYLVNNKISRIENFGTLTQLRLLELGSNRLRVIENLDSLRELDSLFLGKNKITKLQNLETLTNLTVLSVQSNRLTKIEGLQNLVNLRELYLSDNGIQVIEGLENNNKLTTLDLASNRIKRIENIKHLSELQEFWMNDNLVENWSDLEELSGAPGL 330          

HSP 3 Score: 57.7658 bits (138), Expect = 2.037e-8
Identity = 65/244 (26.64%), Postives = 103/244 (42.21%), Query Frame = 2
Query:  374 DISSNNVKI--LNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDNEFPIFD 1099
            D+  N+ KI  +   + L +++ L +  N +++I NLE L  L  L    N+I++IG         L+ +R                  +L  +D+SFN L+ I  +  L +++  Y  +NKI  I       +L  + L SN +  I  +  L+ L +L    N+IT L  L                          T  NL VL++  N L+ I    E L NL NL ELY+ DN   + +
Sbjct:   87 DVDLNHFKIGKIQGFEVLKKVKTLCLRQNLIKLIENLEQLVTLTELDLYDNQIRKIGN--------LETLR------------------DLQILDLSFNLLRRIEGLESLSHLQRLYLVNNKISRIENFGTLTQLRLLELGSNRLRVIENLDSLRELDSLFLGKNKITKLQNL-------------------------ETLTNLTVLSVQSNRLTKI----EGLQNLVNLRELYLSDNGIQVIE 275          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Xenopus
Match: dck.2 (deoxycytidine kinase, gene 2 [Source:Xenbase;Acc:XB-GENE-5727742])

HSP 1 Score: 63.929 bits (154), Expect = 2.992e-10
Identity = 57/188 (30.32%), Postives = 95/188 (50.53%), Query Frame = 2
Query:  401 LNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQI-SIDQIKYLK 961
            L+ + +++ L EL   +N+L    +    K L+V+   YN++  +    L   K L  + L+NN + +I+  D   C +LT+++++ N + +IS    LP                       L E++L+SN I +I G+ DLKSL  LD S N+I++L  L  L     LNL DN+I  I +I Y++
Sbjct:   34 LSCVSFMTYLTELNASNNRLSTFFDFAPPKNLMVVDLSYNQLTHMAD--LSAHKALTKLILNNNNIGEISGLD--KCSSLTHLNLAHNRINNISVFGKLP-----------------------LKELYLNSNYIKNISGLEDLKSLQILDLSCNQISNLEGLEGLTYLLSLNLEDNEICQISEITYIE 194          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Xenopus
Match: LRIG3 (leucine-rich repeats and immunoglobulin like domains 3 [Source:NCBI gene;Acc:100151727])

HSP 1 Score: 64.3142 bits (155), Expect = 3.256e-10
Identity = 70/236 (29.66%), Postives = 110/236 (46.61%), Query Frame = 2
Query:  344 LTNFKHHKVLDISSNNVK-ILN-NLQYLSELRELKIFDNQLEII--SNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSI--SFITCLPNIEEFYASHNKIEIIPE--LSRCKKLSEIHLSSNIISHI-----GGVRDLKSLTTLDFSHNRITSLSK--LGVLNKAEYLNLSDNQI------SIDQIKYLKTTFINLEVL 988
            L+N +H   L+++ N +K IL    Q L  L+ L+I  N +  +       L  + +LQ  +N++ EI  G L     L+ + L  N +  IT + +  C  L+ +D++FN L  +  S    L  +   Y  +NKI  I +        L+ + L SN IS       G    L+ L  L    NRITS++K     L+  EYL+LSDN I      +  Q+K L+  ++N   L
Sbjct:  210 LSNLQH---LELNRNRIKEILGLTFQGLDSLKSLRIQRNLITRLMDGAFWGLSTMEILQLDHNRLTEITKGWLYGLLMLQKLHLSQNAISSITPDAWEFCQKLSELDLAFNQLTRLEESSFAGLGLLGGLYIGNNKINFIADGAFRGLSSLNSLDLKSNEISWTIEDMNGTFSGLERLKRLILQDNRITSITKKAFSWLDALEYLDLSDNAITSMQTNAFSQMKSLQQLYLNTTSL 442          

HSP 2 Score: 53.5286 bits (127), Expect = 7.473e-7
Identity = 73/267 (27.34%), Postives = 127/267 (47.57%), Query Frame = 2
Query:  296 GYTLDLRCEKLDNIPILTNFKHHKV-LDISSNNVKILN--NLQYLSELRELKIFDNQLEIISNLENLKE-LVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFN---NLQSISFITCLPNIEEFYASHNKIEIIP-ELSRCKKLSEIHLSSNIISHIGGV--RDLKSLTTLDFSHNRITSL--SKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHK-LLEYLSNLSNL 1057
            G  LD    KL  +P   N     V LD+S N +  +N  ++ +L  LREL++ +N+L+I+ +L  L   + +     NKI+ I    L+  + L+ + L NN + ++    F   + L Y+ ++ N    +QS +F      ++    + N+I  IP ++ +   L  + L+ N I  I G+  + L SL +L    N IT L       L+  E L L  N+++     +L    + L+ L++S+N +S I     E+   LS L
Sbjct:   50 GDLLDCSRRKLAVVP--ANLPEWVVQLDLSHNKLSSINPSSMNHLHNLRELRLNNNELQIVPDLGPLSANITLFSLTNNKIEVILPEHLKPYQSLETLDLSNNLITELRAGSFPT-LQLKYLYINNNRISTMQSGAFDNLSATLQVLKLNKNRISYIPSKMFKLSNLQHLELNRNRIKEILGLTFQGLDSLKSLRIQRNLITRLMDGAFWGLSTMEILQLDHNRLTEITKGWLYGLLM-LQKLHLSQNAISSITPDAWEFCQKLSEL 312          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Xenopus
Match: pparg (peroxisome proliferator activated receptor gamma [Source:Xenbase;Acc:XB-GENE-483136])

HSP 1 Score: 62.3882 bits (150), Expect = 1.090e-9
Identity = 74/269 (27.51%), Postives = 136/269 (50.56%), Query Frame = 2
Query:  344 LTNFKHHKVLDISSNNVKIL-NNLQYLSELRELKIFDNQLE----IISNLENLKELVV----LQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSI-SFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGG--VRDLKSLTTLDFSHNRITSLS-KLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHK---------LLEYLSNLSNLCELYIQDNE 1084
            LTN +    L+IS N +K L   LQ+L  L+ L +  NQLE     I +L  L+EL V    L++  + + ++ TG +++        L +N L  +   +     NL  +D + N L+++ + +  + ++E+ Y   NK+  +PEL    KL E+H+ +N I  +G   +++L SL+ L+  +N++  L  ++ +LN  E L+LS+N +    +     +  NL+ L +  N L  I +         LL+YL     + ++  Q++E
Sbjct:  127 LTNLQK---LNISHNKIKQLPKELQHLQNLKSLLLQHNQLEELPDSIGHLSILEELDVSNNCLRSISSSVGQL-TGLVKF-------NLSSNKLTALPT-EIGKMKNLKQLDCTSNLLENVPASVAGMESLEQLYLRQNKLTYLPELPFLTKLKELHVGNNQIQTLGPEHLQNLSSLSVLELRYNKLKVLPEEISLLNGLERLDLSNNDLG--SLPCTLGSLPNLKSLQLEGNPLRGIRRDILNKGTQELLKYLKGRVQVPDVKTQEDE 381          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Xenopus
Match: lrrc4b (leucine rich repeat containing 4B [Source:NCBI gene;Acc:100124949])

HSP 1 Score: 62.3882 bits (150), Expect = 1.247e-9
Identity = 62/207 (29.95%), Postives = 100/207 (48.31%), Query Frame = 2
Query:  350 NFKHHKVLDISSNNVKIL--NNLQYLSELRELKIFDNQLEIISN--LENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHK---ITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPE-----LSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSK--LGVLNKAEYLNLSDN 928
            + +H ++L +S N ++ +       L  L  L++FDN+L  +     E L +L  L  + N I+ I + A      L+  RLD   L K   I+   F   +NL Y+++   NL+ I  +T L  +EE   S N++E+I       L+  +KL  +H    II       DLKSL  L+ SHN + SL       L++ E ++L+ N
Sbjct:   93 HLRHLEILQLSKNLIRKIEVGAFNGLPNLSTLELFDNRLTTVPTQAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLR--RLDLGELKKLEYISEAAFEGLVNLRYLNLGMCNLKDIPNLTALVRLEELELSGNRLEMIRPGSFQGLTSLRKLWLMHAHVTIIER-NAFDDLKSLEELNLSHNNLMSLPHDLFTPLHRLERVHLNHN 296          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Mouse
Match: Ppp1r7 (protein phosphatase 1, regulatory subunit 7 [Source:MGI Symbol;Acc:MGI:1913635])

HSP 1 Score: 84.7297 bits (208), Expect = 2.644e-17
Identity = 72/224 (32.14%), Postives = 117/224 (52.23%), Query Frame = 2
Query:  290 KDGYTLDLRCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQI-SIDQIKYL 958
            +D   +DL   ++  I  L   K  K L +  N +K + NL+ L  LREL ++DNQ++ I NLE L EL VL   +N ++ I    +    +LK + L NN ++KI N   SN   L  +++  N +++I  I  L N+E  +   NKI  +  L     L+ + + SN ++ I G++ L +L  L  S+N I  +  L   NK   L+++ N+I  I+ I +L
Sbjct:   77 RDAEDVDLTHYRIGKIEGLEVLKKVKSLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEVLDISFNMLRNI--EGIDKLTQLKKLFLVNNKINKIEN--ISNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSVQSNRLAKIEGLQSLVNLRELYLSNNGIEVIEGLENNNKLTMLDIASNRIKKIENISHL 296          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Mouse
Match: Lrig1 (leucine-rich repeats and immunoglobulin-like domains 1 [Source:MGI Symbol;Acc:MGI:107935])

HSP 1 Score: 65.0846 bits (157), Expect = 1.607e-10
Identity = 74/251 (29.48%), Postives = 116/251 (46.22%), Query Frame = 2
Query:  371 LDISSNNVKILNNL--QYLSELRELKIFDNQLEIISN--LENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHI--GGVRDLKSLTTLDFSHNRI------TSLSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDNEF 1087
            LD++ N ++++  L  Q L  L  L++  N +  +++     L ++ VL  +YN + E+ +G+L     L  + L NN + +I  + +S C  L  + +SFNNL  +         EE  A         ELS    L   H   N ISHI  G  + LKSL  LD  HN I      TS +  G+ N ++ L L  N+I     K   +   +LE LN+ +N +  +    +  + + NL ELYI    F
Sbjct:  218 LDLNRNRIRLIEGLTFQGLDSLEVLRLQRNNISRLTDGAFWGLSKMHVLHLEYNSLVEVNSGSLYGLTALHQLHLSNNSISRIQRDGWSFCQKLHELILSFNNLTRLD--------EESLA---------ELSSLSILRLSH---NAISHIAEGAFKGLKSLRVLDLDHNEISGTIEDTSGAFTGLDNLSK-LTLFGNKIK-SVAKRAFSGLESLEHLNLGENAIRSVQ--FDAFAKMKNLKELYISSESF 444          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Mouse
Match: Lrig1 (leucine-rich repeats and immunoglobulin-like domains 1 [Source:MGI Symbol;Acc:MGI:107935])

HSP 1 Score: 65.0846 bits (157), Expect = 1.607e-10
Identity = 74/251 (29.48%), Postives = 116/251 (46.22%), Query Frame = 2
Query:  371 LDISSNNVKILNNL--QYLSELRELKIFDNQLEIISN--LENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHI--GGVRDLKSLTTLDFSHNRI------TSLSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDNEF 1087
            LD++ N ++++  L  Q L  L  L++  N +  +++     L ++ VL  +YN + E+ +G+L     L  + L NN + +I  + +S C  L  + +SFNNL  +         EE  A         ELS    L   H   N ISHI  G  + LKSL  LD  HN I      TS +  G+ N ++ L L  N+I     K   +   +LE LN+ +N +  +    +  + + NL ELYI    F
Sbjct:  218 LDLNRNRIRLIEGLTFQGLDSLEVLRLQRNNISRLTDGAFWGLSKMHVLHLEYNSLVEVNSGSLYGLTALHQLHLSNNSISRIQRDGWSFCQKLHELILSFNNLTRLD--------EESLA---------ELSSLSILRLSH---NAISHIAEGAFKGLKSLRVLDLDHNEISGTIEDTSGAFTGLDNLSK-LTLFGNKIK-SVAKRAFSGLESLEHLNLGENAIRSVQ--FDAFAKMKNLKELYISSESF 444          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Mouse
Match: Lrig1 (leucine-rich repeats and immunoglobulin-like domains 1 [Source:MGI Symbol;Acc:MGI:107935])

HSP 1 Score: 65.0846 bits (157), Expect = 1.607e-10
Identity = 74/251 (29.48%), Postives = 116/251 (46.22%), Query Frame = 2
Query:  371 LDISSNNVKILNNL--QYLSELRELKIFDNQLEIISN--LENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHI--GGVRDLKSLTTLDFSHNRI------TSLSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDNEF 1087
            LD++ N ++++  L  Q L  L  L++  N +  +++     L ++ VL  +YN + E+ +G+L     L  + L NN + +I  + +S C  L  + +SFNNL  +         EE  A         ELS    L   H   N ISHI  G  + LKSL  LD  HN I      TS +  G+ N ++ L L  N+I     K   +   +LE LN+ +N +  +    +  + + NL ELYI    F
Sbjct:  218 LDLNRNRIRLIEGLTFQGLDSLEVLRLQRNNISRLTDGAFWGLSKMHVLHLEYNSLVEVNSGSLYGLTALHQLHLSNNSISRIQRDGWSFCQKLHELILSFNNLTRLD--------EESLA---------ELSSLSILRLSH---NAISHIAEGAFKGLKSLRVLDLDHNEISGTIEDTSGAFTGLDNLSK-LTLFGNKIK-SVAKRAFSGLESLEHLNLGENAIRSVQ--FDAFAKMKNLKELYISSESF 444          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Mouse
Match: Lrrc23 (leucine rich repeat containing 23 [Source:MGI Symbol;Acc:MGI:1315192])

HSP 1 Score: 63.1586 bits (152), Expect = 2.458e-10
Identity = 62/229 (27.07%), Postives = 112/229 (48.91%), Query Frame = 2
Query:  305 LDLRCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGV-RDLKSLTTLDFSHNRITSLSKLGVLN---KAEYLNLSDNQISIDQIKYLKTTFINL 979
            L+ +   L +I +L ++ H + +DIS N++  ++ L  L+ L  LK   NQL   + +  L  L +    YN+I  I T  + +  +L  + L  N +H++T  D     +L  +++  N L+S   I  LP ++  Y + N ++ +  L     L+ +HL  N I  + G  +++KSL  L+   N I+ L++L  L    K   L L DN  + D+  Y +   + +
Sbjct:   71 LEAKDRDLTDISLLRSYIHLRYVDISENHITDISPLNSLTHLLWLKADGNQLR-SARMNELPYLQIASFSYNQI--IDTEGI-FHPRLGSLDLKGNRIHQVTGLDPERLSSLHTLELRGNQLESTKGI-YLPKLKNLYLAQNLLKKVEGLENLSNLTTLHLRDNQIETLNGFSQEMKSLQYLNLRSNMISDLAELAKLRDLPKLRALVLLDNPCA-DETDYRQEALVQM 293          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. UniProt/SwissProt
Match: sp|Q15435|PP1R7_HUMAN (Protein phosphatase 1 regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PPP1R7 PE=1 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 3.006e-17
Identity = 73/225 (32.44%), Postives = 117/225 (52.00%), Query Frame = 2
Query:  290 KDGYTLDLRCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEI-GTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQI-SIDQIKYL 958
            +D   +DL   ++  I      K  K L +  N +K + NL+ L  LREL ++DNQ++ I NLE L EL +L   +N ++ I G   L    +LK + L NN + KI N   SN   L  +++  N +++I  I  L N+E  +   NKI  +  L     L+ + + SN ++ I G+++L +L  L  SHN I  +  L   NK   L+++ N+I  I+ I +L
Sbjct:   76 RDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKL---TRLKKLFLVNNKISKIEN--LSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHL 295          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. UniProt/SwissProt
Match: sp|Q5RFS7|PP1R7_PONAB (Protein phosphatase 1 regulatory subunit 7 OS=Pongo abelii OX=9601 GN=PPP1R7 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 3.550e-17
Identity = 71/224 (31.70%), Postives = 116/224 (51.79%), Query Frame = 2
Query:  290 KDGYTLDLRCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQI-SIDQIKYL 958
            +D   +DL   ++  I      K  K L +  N +K + NL+ L  LREL ++DNQ++ I NLE L EL +L   +N ++ I    +    +LK + L NN + KI N   SN   L  +++  N +++I  I  L N+E  +   NKI  +  L     L+ + + SN ++ I G+++L +L  L  SHN I  +  L   NK   L+++ N+I  I+ I +L
Sbjct:   76 RDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNI--EGVDKVTQLKKLFLVNNKISKIEN--LSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLQELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHL 295          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. UniProt/SwissProt
Match: sp|Q3UM45|PP1R7_MOUSE (Protein phosphatase 1 regulatory subunit 7 OS=Mus musculus OX=10090 GN=Ppp1r7 PE=1 SV=2)

HSP 1 Score: 84.7297 bits (208), Expect = 1.849e-16
Identity = 72/224 (32.14%), Postives = 117/224 (52.23%), Query Frame = 2
Query:  290 KDGYTLDLRCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQI-SIDQIKYL 958
            +D   +DL   ++  I  L   K  K L +  N +K + NL+ L  LREL ++DNQ++ I NLE L EL VL   +N ++ I    +    +LK + L NN ++KI N   SN   L  +++  N +++I  I  L N+E  +   NKI  +  L     L+ + + SN ++ I G++ L +L  L  S+N I  +  L   NK   L+++ N+I  I+ I +L
Sbjct:   77 RDAEDVDLTHYRIGKIEGLEVLKKVKSLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEVLDISFNMLRNI--EGIDKLTQLKKLFLVNNKINKIEN--ISNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSVQSNRLAKIEGLQSLVNLRELYLSNNGIEVIEGLENNNKLTMLDIASNRIKKIENISHL 296          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. UniProt/SwissProt
Match: sp|Q5HZV9|PP1R7_RAT (Protein phosphatase 1 regulatory subunit 7 OS=Rattus norvegicus OX=10116 GN=Ppp1r7 PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 4.077e-16
Identity = 72/227 (31.72%), Postives = 116/227 (51.10%), Query Frame = 2
Query:  281 SKPKDGYTLDLRCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQI-SIDQIKYL 958
            S  +D   +DL   ++  I      K  K L +  N +K + NL  L  LREL ++DNQ++ I NLE L EL VL   +N ++ I    +    +LK + L NN ++KI N   S    L  +++  N +++I  I  L N+E  +   NKI  +  L     L+ + + SN ++ I G+++L +L  L  SHN I  +  L   NK   L+++ N+I  I+ I +L
Sbjct:   73 SLDRDAEDVDLNHYRIGKIEGFEVLKKVKSLCLRQNLIKCIENLDELQSLRELDLYDNQIKKIENLEALTELEVLDISFNLLRNI--EGIDKLTQLKKLFLVNNKINKIEN--ISTLQQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALSNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHL 295          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. UniProt/SwissProt
Match: sp|Q723K6|INLA_LISMF (Internalin A OS=Listeria monocytogenes serotype 4b (strain F2365) OX=265669 GN=inlA PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 6.101e-16
Identity = 82/238 (34.45%), Postives = 123/238 (51.68%), Query Frame = 2
Query:  365 KVLDISSNNVKI--LNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITN-NDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQIS-IDQIKYLKTTFINLEVLNISKNGLSDIHKLLEYLSNLSNLCEL 1066
            K++DI  NN +I  +  L  LS L  L +F+NQ+  I  L+NL  L  L+   N I +I   AL     L+ +     F +++T+    +N   L  +D+S N +  IS +  L N+E   A++N+I  I  L     L E+ L+ N +  IG +  L +LT LD ++N+I++L+ L  L K   L L  NQIS I  +  L T   NLE   +++N L DI      +SNL NL  L
Sbjct:  121 KLVDILMNNNQIADITPLANLSNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDIS--ALSGLTSLQQLS----FGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGL-TALTNLE---LNENQLEDISP----ISNLKNLTYL 344          

HSP 2 Score: 62.7734 bits (151), Expect = 4.657e-9
Identity = 61/198 (30.81%), Postives = 94/198 (47.47%), Query Frame = 2
Query:  344 LTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQIS 937
            L N    + LDISSN V  ++ L  L+ L  L   +NQ+  I+ L  L  L  L    N++++IGT  L     L  + L NN +  +     S    LT + +  N + +IS +  L  +     + N++E I  +S  K L+ + L  N IS I  V  L  L  L F +N+++ +S L  L    +L+   NQIS
Sbjct:  203 LANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGT--LASLTNLTDLDLANNQISNLA--PLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGHNQIS 396          

HSP 3 Score: 59.3066 bits (142), Expect = 7.053e-8
Identity = 57/221 (25.79%), Postives = 101/221 (45.70%), Query Frame = 2
Query:  341 ILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKN 1003
            ILTN      L ++ N +K +  L  L+ L +L + +NQ+  ++ L  L +L  L+   N+I  I    L     L ++ L+ N L  I+    SN  NLTY+ + FNN+  IS ++ L  ++  +  +NK                      +S +  + +L ++  L   HN+I+ L+ L  L +   L L+D + +   + Y     +N+ + N  KN
Sbjct:  249 ILTNLDE---LSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNIS--PLAGLTALTNLELNENQLEDIS--PISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNK----------------------VSDVSSLANLTNINWLSAGHNQISDLTPLANLTRITQLGLNDQEWTNPPVNYK----VNVSIPNTVKN 436          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. TrEMBL
Match: A0A3S0ZW09 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_004847 PE=4 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 3.041e-51
Identity = 125/357 (35.01%), Postives = 205/357 (57.42%), Query Frame = 2
Query:  242 NFDSENLLTRRNESKPKDGYTLDLRCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDNEFPIFDETCQQYSSAMVTRHLGNLLILDNVSVKYSDIDNVINTVSVPESSNVALPELSLKQVENQLTEIIKAANEFH 1312
            N   +++L    E++P   Y +DL  E L + P L  F+  +VL++S N++K +  L +  +LRELK++DN++  I  L NLKEL  LQ Q+N+I +IG G L   KKL+ +RLDNN L KI   +  +C ++T +D+S N L++++ +  LPN+EE  AS N+++   +LS+C+KL E+ LS N ++ + G+ +L +L  LD SHN ITSL  +G L   E LNL+ N+IS  ++    + F  L++L +  N + D +++   L  L +L EL +  N F + D     Y +A V+  L  L ++D   +K +        +  P S   A   +S++Q+++QL        +FH
Sbjct:  207 NLTVQDILDISQETEPYKVYDVDLHGEGLTSAPDLEKFRKLRVLNLSGNHIKNITGLDFNWDLRELKLYDNEIASIEGLTNLKELSHLQLQHNQISKIGRG-LGSLKKLQTLRLDNNKLTKIETPELLSCSHITTLDLSSNRLETLAPLNYLPNLEELLASGNRLKSTGDLSKCRKLQELDLSWNQLADLAGIANLPNLQILDLSHNNITSLKPVGRLRSVEELNLNANRIS--ELSSFSSVFPKLQILFVCDNMIKDWNEICS-LEGLRDLVELSVTANPFTMEDGDMPAYMTA-VSVALPCLEVIDGAQIKRAGNKPGKAPLMRPMS---AASVISVRQIDSQLKAAANEQEDFH 555          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. TrEMBL
Match: A0A1S3J111 (protein phosphatase 1 regulatory subunit 7 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106169259 PE=4 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 8.394e-49
Identity = 126/371 (33.96%), Postives = 205/371 (55.26%), Query Frame = 2
Query:  242 NFDSENLLTRRNESKPKDGYTLDLRCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDNEFPIFDETCQQYSSAMVTRHLGNLLILDNVSVKYSDIDNVINTVSVPESSNVALPELSLKQVENQLTEIIKAANEFHLENTFRYNEIIKSF 1354
            +   E +L +  E+ P   Y + L   ++  I  L  F   +VLD+S N ++ + NL    +LRELK++DN +  I NLE+LKEL  LQ Q+NK++ IG G L   KKLK +RLD+N L K+ + + +    LT +D+S N L S++ + CLPN+EE +A++NK+  + +L RCKKL EI LSSN ++ + G+R L  L TL  + N+  +L  LG       L +S+N+++  +++ L   F  LE LN+  N +    +++  L  L NL E+++Q N F       + + SA + R +  L I+D   VK S   +    V  P S+      +S +QV+ Q++ ++   + F        N +++SF
Sbjct:  127 DISPEEILAQSQENDPGHVYEILLHAARIGKIQGLETFTKVRVLDLSCNFIQDIENLDKNQDLRELKLYDNYITEIKNLESLKELSHLQLQHNKLKSIGKG-LSCQKKLKILRLDSNKLSKLDSRELAPLSQLTSLDISGNGLDSLAALNCLPNLEELFATNNKLRTVTDLGRCKKLQEIDLSSNQLTDVSGLRGLAQLNTLHLTKNQFATLKSLGKSKSLHELVVSNNRLT--ELQSLVEQFPGLEHLNVCDNHIEQWEQVVS-LQKLQNLMEVFLQRNPF-CSPRGPKPHYSAELQRLMPALEIIDGAHVKRS--TSTTAPVMRPMSAASGNTLISTRQVDAQMSSLLNEMSTFE-------NNVMQSF 483          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. TrEMBL
Match: V4BDP1 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_230176 PE=4 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 2.138e-48
Identity = 136/395 (34.43%), Postives = 223/395 (56.46%), Query Frame = 2
Query:  320 EKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDNEFPIFDETCQQYSSAMVTRHLGNLLILDNVSVKYSDIDNVINTVSVPESSNVALPELSLKQVENQLTEIIKAANEFHLENTFRYNEIIKSFSENDCQSTDCQLQRSS------------PLLTNRTTKKSRLLDALSFASA 1468
            E++ +I  L  FK  K+LD+S N ++ + NL    ++RELK++DN++++I NL++LKEL  LQ Q+NKI+ IG G L   KK+K +RLD+N L K+  +DF +C+ LT +D+SFN L ++S ++ LPN+EE  AS N++  + ELSRCK L E+ LS+N ++ + G  +L  L  L  S+N+IT+L+  G L   E L++S N+I   ++  L T   NL++LNIS N +S   ++L  LS L +L EL+I  N F   +     Y + + +  +  L ILD   VK   I      +  P S++     +S++Q++NQL  + +   E     + R+  +      + C S   +   SS            P     ++ +SR++ A  +A++
Sbjct:  180 EEITDISNLQQFKKVKILDLSCNFIEKIQNLNDNLDIRELKLYDNRIKVIENLDHLKELSCLQLQHNKIRAIGKG-LSQLKKIKTLRLDSNLLLKLETSDFISCVQLTSLDLSFNMLDNLSALSYLPNLEELSASGNRLRKVNELSRCKGLVELDLSNNRLTDLSGFTNLTHLQILRLSNNQITTLNMSGKLKSLEELDVSANKIK--ELSPLLTAVPNLQILNISDNNISIWDQVLS-LSKLGDLVELFISGNPFSEENGEKPGYFTELQS-VIPQLEILDGALVKKL-IGKATAPLMRPMSASTV---VSVRQMDNQLKAVNQELAELQTSISKRFESL-----RSTCSSLPAEAPPSSARSIPVPSPSEEPEFRPCSSSRSRIMMAQQYAAS 560          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. TrEMBL
Match: A0A1S3I7Q8 (protein phosphatase 1 regulatory subunit 7 OS=Lingula unguis OX=7574 GN=LOC106161817 PE=4 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 3.155e-48
Identity = 134/427 (31.38%), Postives = 227/427 (53.16%), Query Frame = 2
Query:  242 NFDSENLLTRRNESKPKDGYTLDLRCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDNEFPIFDETCQQYSSAMVTRHLGNLLILDNVSVKYSDIDNVINTVSVPESSNVALPELSLKQVENQLTEIIKAANEFHLENTFRYNEIIKSFSE----------NDCQSTDCQLQRSSPLLTN------RTTKKSRLLDALSFASANY 1474
            +   E +L +  E+ P   Y + L   ++  I  L  F   +VLD+S N ++ + NL    +LRELK++DN +  I NLE+LKEL  LQ Q+NK++ IG G L   KKLK +RLD+N L K+ + + +    LT +D+S N L S++ + CLPN+EE +A++NK+  + +L RCKKL EI LSSN ++ + G+R L  L TL  + N+  +L  LG       L +S+N+++  +++ L   F  LE LN+  N +    +++  L  L N+ E+++Q N F       + + SA + R +  L I+D   VK S   +    V  P S   A   +S +QV+ Q++ ++   + F        N +++SF               +++     RS P          +++++SR+ +A +FA+ ++
Sbjct:  127 DISPEEILAQSQENDPGHVYEILLHAARIGKIQGLETFTKVRVLDLSCNFIQDIENLDKNQDLRELKLYDNYITEIKNLESLKELSHLQLQHNKLKSIGKG-LSCQKKLKILRLDSNKLSKLDSRELAPLSQLTSLDISGNGLDSLAALNCLPNLEELFATNNKLRTVTDLGRCKKLQEIDLSSNQLTDVSGLRGLAQLNTLHLTKNQFATLKSLGKSKSLHELVVSNNRLT--ELQSLVEQFPGLEHLNVCDNHIEQWEQVVS-LQKLQNIMEVFLQRNPF-CSPRGPKPHYSAELQRLMPALEIIDGAHVKRS--TSTTAPVMRPMS---AASVISTRQVDAQMSSLLNEMSTFE-------NNVMQSFKSLRATFDTLPVEPPKTSRLATVRSLPSTAGSDRPASKSSRRSRITEARNFAAQHF 536          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. TrEMBL
Match: A0A1S3J1I4 (protein phosphatase 1 regulatory subunit 7 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106169259 PE=4 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 3.639e-48
Identity = 127/371 (34.23%), Postives = 205/371 (55.26%), Query Frame = 2
Query:  242 NFDSENLLTRRNESKPKDGYTLDLRCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDNEFPIFDETCQQYSSAMVTRHLGNLLILDNVSVKYSDIDNVINTVSVPESSNVALPELSLKQVENQLTEIIKAANEFHLENTFRYNEIIKSF 1354
            +   E +L +  E+ P   Y + L   ++  I  L  F   +VLD+S N ++ + NL    +LRELK++DN +  I NLE+LKEL  LQ Q+NK++ IG G L   KKLK +RLD+N L K+ + + +    LT +D+S N L S++ + CLPN+EE +A++NK+  + +L RCKKL EI LSSN ++ + G+R L  L TL  + N+  +L  LG       L +S+N+++  +++ L   F  LE LN+  N +    +++  L  L NL E+++Q N F       + + SA + R +  L I+D   VK S   +    V  P S   A   +S +QV+ Q++ ++   + F        N +++SF
Sbjct:  127 DISPEEILAQSQENDPGHVYEILLHAARIGKIQGLETFTKVRVLDLSCNFIQDIENLDKNQDLRELKLYDNYITEIKNLESLKELSHLQLQHNKLKSIGKG-LSCQKKLKILRLDSNKLSKLDSRELAPLSQLTSLDISGNGLDSLAALNCLPNLEELFATNNKLRTVTDLGRCKKLQEIDLSSNQLTDVSGLRGLAQLNTLHLTKNQFATLKSLGKSKSLHELVVSNNRLT--ELQSLVEQFPGLEHLNVCDNHIEQWEQVVS-LQKLQNLMEVFLQRNPF-CSPRGPKPHYSAELQRLMPALEIIDGAHVKRS--TSTTAPVMRPMS---AASVISTRQVDAQMSSLLNEMSTFE-------NNVMQSF 480          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Cavefish
Match: lrrc23 (leucine rich repeat containing 23 [Source:NCBI gene;Acc:103047179])

HSP 1 Score: 72.7886 bits (177), Expect = 1.128e-13
Identity = 61/215 (28.37%), Postives = 106/215 (49.30%), Query Frame = 2
Query:  308 DLRCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVR-DLKSLTTLDFSHNRITSL----SKLGVLNKAEYLNLSDNQIS 937
            DL+   L +I +L++F H + LDISSN +   + L  L++L  LK   NQL    + + L +L  LQ        +G         L+ + L  N + +++  ++    NL  +++  N+L++   I  LPN+   Y + NKI+ +  L + ++L+ +HL  N +  + G+   +KSL  L+   N I S     S LGV    + + L+ N  S
Sbjct:   67 DLKERSLTDIALLSSFVHLRFLDISSNFLTDFSPLAALTQLLWLKADGNQLPGFRD-QPLGQLAYLQWLSLAANRLGDTEGLGGPALESLNLTGNGIQRVSGLEYHRLTNLVTLELRGNSLETTDGI-YLPNLRNLYLAQNKIKQLEGLEKLERLTTLHLRGNQLETLDGLSPSMKSLQYLNIRDNLIASRKALQSLLGVAQTLQAIVLTGNPFS 279          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Cavefish
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:111191999])

HSP 1 Score: 72.4034 bits (176), Expect = 1.774e-13
Identity = 72/258 (27.91%), Postives = 124/258 (48.06%), Query Frame = 2
Query:  314 RCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPEL-------------SRCKKLS---------EIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQIS----IDQIKYLKTTFINLEVLNISKNGL 1009
            R  K++ + +L   +  K L +  N +K + NL+ LS LREL ++DNQ+  + NL+ L EL  L   +N +++I    L    K+K + L +N +  I N    +  +L  +++  N ++ I  +  L +++  +   NKI  +  L             +R  KL          E++LS N I  I G+ + K LTTLD + NRI  +  +  L   +   ++DNQI     +D++K  K     LE + + +N L
Sbjct:   73 RIGKIEGLEVL---QKAKTLSLRQNLIKKIENLESLSSLRELDLYDNQIRKLENLQALTELEQLDVSFNLLRKI--EGLERLTKVKKLFLLHNKISSIAN--LEHLTSLHMLELGSNRIRIIENLDALTSLDSLFLGTNKITKLQNLDGLHNLTVLSIQSNRITKLEGLQNMVNLRELYLSHNGIEVIEGLENNKKLTTLDIAANRIKKIENISHLTDLQEFWMNDNQIENWSDLDELKNAK----GLETVYLERNPL 319          

HSP 2 Score: 70.4774 bits (171), Expect = 8.936e-13
Identity = 68/225 (30.22%), Postives = 110/225 (48.89%), Query Frame = 2
Query:  302 TLDLR---CEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQ--------------EIGTGALRYCKKLKHI-RLDNNFL--HKITN-NDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYL 913
            TL LR    +K++N+  L++ +    LD+  N ++ L NLQ L+EL +L +  N L  I  LE L ++  L   +NKI               E+G+  +R  + L  +  LD+ FL  +KIT   +     NLT + +  N +  +  +  + N+ E Y SHN IE+I  L   KKL+ + +++N I  I  +  L  L     + N+I + S L  L  A+ L
Sbjct:   88 TLSLRQNLIKKIENLESLSSLRE---LDLYDNQIRKLENLQALTELEQLDVSFNLLRKIEGLERLTKVKKLFLLHNKISSIANLEHLTSLHMLELGSNRIRIIENLDALTSLDSLFLGTNKITKLQNLDGLHNLTVLSIQSNRITKLEGLQNMVNLRELYLSHNGIEVIEGLENNKKLTTLDIAANRIKKIENISHLTDLQEFWMNDNQIENWSDLDELKNAKGL 309          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Cavefish
Match: lgr4 (Danio rerio leucine-rich repeat containing G protein-coupled receptor 4 (lgr4), mRNA. [Source:RefSeq mRNA;Acc:NM_001353862])

HSP 1 Score: 67.3958 bits (163), Expect = 2.199e-11
Identity = 87/331 (26.28%), Postives = 146/331 (44.11%), Query Frame = 2
Query:  344 LTNFKHHKVLDISSNNVKIL--NNLQYLSELRELKIFDNQLEIIS--NLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLT----------YVDVSFNNLQSIS-FITCLPNIEEFYASHNKIEIIPE-------------------------LSRCKKLSEIHLSSNIISHIGG--VRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQI-SIDQIKYLKTTFINLEVLNISKNGLSDIHK-LLEYLSNLSNLCELYIQDNEF------PIFDETCQQYSSAMVTRHLGNLLILDNVSVKYS 1186
            L+     KVL + +N +K +  + L+ L+ L+ L++  N + ++   + E L++L  L    N + E+  G L++   L+ + L  N +  I ++ F+N  +L           + D++FN+LQS    I  LP ++E     N I+ IPE                         L+    L  + L+   I  I      DL  L TLD S+N I  L       + + + L  N I  ID+  +   T  NL VL++S+N +  IH+     LS+L+NLC  +I   EF       IF  +C  +  A V      + +  ++SV Y+
Sbjct:  107 LSGLHQLKVLMLQNNQLKTVPSDALKNLNALQSLRLDANHITVVPEDSFEGLQQLRHLWLDDNSLTEVPVGPLQHQGNLQALTLALNRITHIPDHAFANLSSLVLEYKIILFLLFRDLNFNSLQSFPEAIQTLPKLKELGFHTNSIDTIPEGAFQRNPLLRTIMLRGASMVQDFPSLAGTGNLESLTLTGTKIKAIPEDLCEDLSVLRTLDLSYNEIEELPSFQGCVRLQDITLQHNHIQQIDRDTFQGLT--NLRVLDLSRNQIKLIHRDAFLSLSSLTNLCFKFIFQPEFLCCSIVVIFTMSCVVFLPACVC-----VCVYRSISVPYA 430          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Cavefish
Match: lrig3 (leucine rich repeats and immunoglobulin like domains 3 [Source:NCBI gene;Acc:103037077])

HSP 1 Score: 65.855 bits (159), Expect = 6.667e-11
Identity = 75/298 (25.17%), Postives = 127/298 (42.62%), Query Frame = 2
Query:  323 KLDNIPI----LTNFKHHKVLDISSNNVKILNNLQY--LSELRELKIFDNQLEII--SNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSI---SFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSL-----SKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLE-----------VLNISKNGLSDIHKLLEYLSNLSNL---CEL-----YIQDNEF-PIFDETC 1108
            +L++IP     L+N +H   LD+S N V+ +  L +  L  LR LK+  N +  +       L  + +LQ +YN + E+  G L     L+ + L +N + +I  + +  C  L  +D++ N L  +   SF+  L  +E+    HN++  I +                    G  R L  L TLD  +N I+            LN    L L  N+I        K +F  L+           +++I  N  S + KL E L N S+L   C+L     ++ ++ F P+ + +C
Sbjct:  188 RLNSIPAKTFQLSNLQH---LDLSRNRVRRIEGLTFHGLHRLRSLKMQRNGITRLMDGAFWGLSNMEILQLEYNNLTEVSKGWLYGLLTLQQLHLAHNAISRIKPDAWEFCQKLAELDLNSNQLARLEEGSFMG-LSVLEQLSIGHNRVSFIAD--------------------GAFRGLSLLNTLDLKYNEISWTIEDMNGPFSALNNLRKLFLQGNRIR----SVTKKSFTGLDLLEQLDLSNNAIMSIQGNAFSQMKKLEELLLNTSSLLCDCQLKWFPQWVAEHAFQPLVNASC 457          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Cavefish
Match: lrrc8aa (leucine rich repeat containing 8 VRAC subunit A [Source:NCBI gene;Acc:103030504])

HSP 1 Score: 61.6178 bits (148), Expect = 1.250e-9
Identity = 58/172 (33.72%), Postives = 94/172 (54.65%), Query Frame = 2
Query:  395 KILNNLQYLSELRELKIFDNQL----EIISNLENLKELVVLQAQYNKIQ----EIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISF-ITCLPNIEEFYASHNKIEIIP-ELSRCKKLSEIHLSSNIISHIGG-VRDLKSLTTLDFSHNRITSL 877
            +I +++  L  L+E+ + DN L    EIIS  ++L  LV L+  YN+I     +IGT        ++ + L+ N + KI +  F  C  L ++D+S NNL SI   I  L N++ F  + N+IE +P EL +CKKL  ++L +N ++ +     +L  LT L+   NR+  L
Sbjct:  589 RIPHSIFSLHNLQEIDLKDNNLKTIEEIIS-FQHLHRLVCLKLWYNQIAYIPIQIGT-----LTNMERLYLNRNKIDKIPSQLFF-CRKLRFLDLSHNNLTSIHPDIGLLQNLQYFAVTANRIETLPPELFQCKKLRTLNLGNNCLTTLPSRFGELTGLTQLELRGNRLEGL 753          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Sea Lamprey
Match: ppp1r7 (protein phosphatase 1, regulatory (inhibitor) subunit 7 [Source:NCBI gene;Acc:560323])

HSP 1 Score: 79.337 bits (194), Expect = 1.792e-16
Identity = 74/240 (30.83%), Postives = 119/240 (49.58%), Query Frame = 2
Query:  314 RCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEI-GTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEI----------------------IPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQIS----IDQIK 952
            R  K++ + IL   K   VL +  N +  + NL+ L+ LREL ++DN L+ I NL+ L  L +L   +N +++I G   LR  +KL    L +N + KI N   ++   L  ++V+ N ++ I  I  L N++  +   NKI                        I  LS    L E++LS N I  I G+ + K LTTLD + NR+  +  +G L + +   ++DNQIS    +D++K
Sbjct:   67 RIGKIERLEILMKVK---VLCLRQNMIAQIENLESLTTLRELDLYDNVLKKIENLDTLVNLEMLDISFNVLRKIEGLDTLRKVRKLF---LVSNKITKIEN--LNSLTELRMLEVASNRIRVIENIETLKNLDSLFIGKNKITKLQNLDSLTNLTVLSIQSNRITKIEGLSSLVNLQELYLSHNGIEVIEGLENNKKLTTLDIAANRVRRIENVGHLTELQEFWMNDNQISNWNDVDELK 298          

HSP 2 Score: 67.0106 bits (162), Expect = 2.237e-12
Identity = 66/225 (29.33%), Postives = 109/225 (48.44%), Query Frame = 2
Query:  467 ISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHKL------------------LEYLSNLSNLCELYIQDNEF 1087
            I  LE L ++ VL  + N I +I    L     L+ + L +N L KI N D    +NL  +D+SFN L+ I  +  L  + + +   NKI  I  L+   +L  + ++SN I  I  +  LK+L +L    N+IT L  L  L     L++  N+I+  +I+ L ++ +NL+ L +S NG+  I  L                  +E + +L+ L E ++ DN+ 
Sbjct:   71 IERLEILMKVKVLCLRQNMIAQIEN--LESLTTLRELDLYDNVLKKIENLD--TLVNLEMLDISFNVLRKIEGLDTLRKVRKLFLVSNKITKIENLNSLTELRMLEVASNRIRVIENIETLKNLDSLFIGKNKITKLQNLDSLTNLTVLSIQSNRIT--KIEGL-SSLVNLQELYLSHNGIEVIEGLENNKKLTTLDIAANRVRRIENVGHLTELQEFWMNDNQI 288          

HSP 3 Score: 53.9138 bits (128), Expect = 3.637e-8
Identity = 44/161 (27.33%), Postives = 84/161 (52.17%), Query Frame = 2
Query:  323 KLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIE---IIPELSRCKKLSEIHLSSN 796
            K++N+  LT  +   +L+++SN ++++ N++ L  L  L I  N++  + NL++L  L VL  Q N+I +I    L     L+ + L +N +  I      N   LT +D++ N ++ I  +  L  ++EF+ + N+I     + EL   + L  ++L  N
Sbjct:  158 KIENLNSLTELR---MLEVASNRIRVIENIETLKNLDSLFIGKNKITKLQNLDSLTNLTVLSIQSNRITKI--EGLSSLVNLQELYLSHNGIEVIEG--LENNKKLTTLDIAANRVRRIENVGHLTELQEFWMNDNQISNWNDVDELKNARGLQTVYLERN 311          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Sea Lamprey
Match: lrrc40 (leucine rich repeat containing 40 [Source:NCBI gene;Acc:334130])

HSP 1 Score: 70.0922 bits (170), Expect = 5.694e-13
Identity = 59/218 (27.06%), Postives = 118/218 (54.13%), Query Frame = 2
Query:  305 LDLRCEKLDNIP-ILTNFKHHKVLDISSNNVKIL-NNLQYLSELRELKIFDNQLEIISN-LENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSI-SFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGG--VRDLKSLTTLDFSHNRITSLS-KLGVLNKAEYLNLSDNQIS 937
            LD+   +L  +P +L    + + L++S N ++ L  +L  +S L  L +  N+LE ISN + NL  L  L    N++  +  G L    ++  + +  N L ++   +  +   L  ++ + N L+S+ + +  + ++++ Y  HN+++ +PEL  C  L E+H+ +N IS +G   +R L +++ LD   N++  L  ++ +L+  E L+L++N IS
Sbjct:  112 LDVHDNQLTELPQVLGELVNLQKLNVSHNKLQTLPESLWAISSLLSLHVEHNELEGISNNIGNLARLEELDLSSNRLTAL-PGTLGKLTRVTKLNVAENKLRELPT-EIKSMKGLCQLEATHNLLESVPAALGGMASLQQLYLRHNRLKSLPELHNCAALKELHVGNNQISELGPEHLRPLGAISVLDLRDNKLKELPDEVTLLHGLERLDLTNNDIS 327          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Sea Lamprey
Match: lrguk (leucine-rich repeats and guanylate kinase domain containing [Source:ZFIN;Acc:ZDB-GENE-050419-232])

HSP 1 Score: 65.0846 bits (157), Expect = 1.742e-11
Identity = 57/194 (29.38%), Postives = 92/194 (47.42%), Query Frame = 2
Query:  305 LDLRCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKL 886
            L L    L +I IL+ + H + LD+S N +K L+ L  +  L ELK+  NQL  +     L+ L      YN I E+    +   K L  + LDNN + +I       C +L Y+ ++ N ++ +  +  LP +       N +  I  L +  KL ++ LS N I  + G+     L  LD   N+IT L+++
Sbjct:   28 LALPGYGLKDIGILSGYVHIQKLDLSHNKIKELSVLGNMPYLVELKVSHNQLTKLFEFSILRFLKEADFSYNTISEMKD--MSVYKSLTKLVLDNNNISEIIG--LEECGSLAYLSLAHNRIRRLDGLGSLP-LRYLCLRGNHLRKITGLEKLWKLEKVDLSGNKIRSLKGLEGHYRLQELDMEGNQITELAEV 216          

HSP 2 Score: 48.1358 bits (113), Expect = 3.708e-6
Identity = 39/138 (28.26%), Postives = 69/138 (50.00%), Query Frame = 2
Query:  620 FSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQI-SIDQIKYLKTTFINLEVLNISK-NGLSDIHKL 1027
             S  +++  +D+S N ++ +S +  +P + E   SHN++  + E S  + L E   S N IS +  +   KSLT L   +N I+ +  L       YL+L+ N+I  +D +  L   ++ L   ++ K  GL  + KL
Sbjct:   41 LSGYVHIQKLDLSHNKIKELSVLGNMPYLVELKVSHNQLTKLFEFSILRFLKEADFSYNTISEMKDMSVYKSLTKLVLDNNNISEIIGLEECGSLAYLSLAHNRIRRLDGLGSLPLRYLCLRGNHLRKITGLEKLWKL 178          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Sea Lamprey
Match: lrig3 (leucine-rich repeats and immunoglobulin-like domains 3 [Source:NCBI gene;Acc:564554])

HSP 1 Score: 62.3882 bits (150), Expect = 1.187e-10
Identity = 64/222 (28.83%), Postives = 98/222 (44.14%), Query Frame = 2
Query:  371 LDISSNNVKILNNLQYLSELRELKIFDNQLEIISNL-----ENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHI--GGVRDLKSLTTLDFSHNRIT--------SLSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLN 991
            LD+S N ++ +  L + SEL  L+    Q   IS+L       L  +  +Q Q+N++ E+ TG L   + L+H+ +  N +  + +  +  C NL  +D+S N L  +                N+   + EL   + LS  H   N ISHI  G  R L SL  LD   N+I+        + + L  L+K   L+L  NQI        K  F+ LE L 
Sbjct:   48 LDLSRNRLQRVEGLAF-SELASLEYLRLQRNRISSLMDGAFWGLHRIQKIQLQHNRLTEVSTGWLYGLQSLRHLHVSRNAITAMDSEAWKFCENLWELDLSHNGLTRL----------------NEAAFV-ELGALQSLSLAH---NAISHIVEGAFRGLSSLRILDLGGNQISWTVEDMQGAFTGLSALSK---LSLHGNQIK----SIAKKAFVGLERLG 241          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005086.1 (pep scaffold:Pmarinus_7.0:GL477410:204878:243212:-1 gene:ENSPMAG00000004613.1 transcript:ENSPMAT00000005086.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 7.487e-10
Identity = 57/188 (30.32%), Postives = 95/188 (50.53%), Query Frame = 2
Query:  620 FSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQIS-IDQIKYLKTTFINLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDNEF-PIFDETCQQYSSAMVTRHLGNLLILDNVSV 1177
             SN  NLT + +   +++ I  +     + E + + + + +I  L  C++L +++L SN I+ I G+  L  L  L  ++N I ++  L  L   + LNL+DNQI  I    +   + + LE LN+S N +S   K L +LS L  L EL +QD  + P        Y++ ++  HL  L  LD + V
Sbjct:   42 LSNFPNLTVLTLVNQDVRDIEGLHGCRLLRELWIAESHVTVIKGLEPCRELRKLYLYSNNIARIEGLESLPLLEVLWLNNNCIAAIENLHCLQHLKELNLADNQIEFIVSKGHSLDSNLELERLNLSGNKIS-CFKELTHLSRLPALTELSLQDPLYAPCSVSLLCNYATHLLY-HLPQLRRLDTIDV 227          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Yeast
Match: SDS22 (Regulatory subunit of the type 1 protein phosphatase (PP1) Glc7p; whether it functions as a positive or negative regulator of Glc7p is controversial; involved in the regulation of Glc7p nuclear localization and function [Source:SGD;Acc:S000001676])

HSP 1 Score: 57.3806 bits (137), Expect = 1.822e-9
Identity = 79/276 (28.62%), Postives = 128/276 (46.38%), Query Frame = 2
Query:  311 LRCEKLDNIPILTNFKHHKVLDIS--SNNVK-ILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDNEFPIFDETCQQYSSAM 1129
            LR   +++I  +    H K++D+    N +K I +N+  L++L  L +  N+++ I NLENL +L  L    N I +I    L   K LK++ L  N +H I  + F    NL  + +  N++  +  +  L N++      NK++ I  L     L E++LS N I+ I G+     LTTLD + N+ITSL  L  L+     NL+D   S ++I                         L E LS LS L  +Y++ N   + ++T  +    M
Sbjct:   73 LRQNLIESISEVEVLPHDKIVDLDFYDNKIKHISSNVNKLTKLTSLDLSFNKIKHIKNLENLTDLENLYFVQNSISKIEN--LSTLKSLKNLELGGNKVHSIEPDSFEGLSNLEEIWLGKNSIPRLINLHPLKNLKILSIQSNKLKKIENLEELTNLEELYLSHNFITKIEGLEKNLKLTTLDVTSNKITSLENLNHLS-----NLTDIWASFNKID-------------------QSFESLGENLSALSRLETIYLEGNPIQLENKTSYRRKLTM 322          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Yeast
Match: CYR1 (Adenylate cyclase; required for cAMP production and cAMP-dependent protein kinase signaling; the cAMP pathway controls a variety of cellular processes, including metabolism, cell cycle, stress response, stationary phase, and sporulation [Source:SGD;Acc:S000003542])

HSP 1 Score: 57.3806 bits (137), Expect = 3.995e-9
Identity = 89/333 (26.73%), Postives = 148/333 (44.44%), Query Frame = 2
Query:  305 LDLRCEKLDNIPILTNFKHHKV-LDISSNNVKIL-NNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRY----------------CKKLKHIRLDNNFLHKITNNDF--SNCINLTYVDVSFNN-----LQSISF----------ITCLPN-------IEEFYASHNKIEII-PELSRCKKLSEIHL-SSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLS---------------DNQISIDQIKYLKTTFINLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDNEFPIF-DETCQQYSS 1123
            LDL   K  + P + N+  + + +D+S N ++ L  + +YL +L ++ +  N+L  I +L  + +L  L  +YN+I  I T A                     KL+ + +  N +  I+  DF   N  +LT      ++     L  +SF          +T LP        +     + NK+E I PELS+ K L  + L S+NI   + G+ +L+ LT+L+ S N   + S    L  + Y N+S               DNQ   D +  L   F+NL+VLN+S N  SD+  +      L ++ ELY+  N+      +T  ++SS
Sbjct:  914 LDLSSNKFMHYPEVINYCTNLLQIDLSYNKIQSLPQSTKYLVKLAKMNLSHNKLNFIGDLSEMTDLRTLNLRYNRISSIKTNASNLQNLFLTDNRISNFEDTLPKLRALEIQENPITSISFKDFYPKNMTSLTLNKAQLSSIPGELLTKLSFLEKLELNQNNLTRLPQEISKLTKLVFLSVARNKLEYIPPELSQLKSLRTLDLHSNNIRDFVDGMENLE-LTSLNISSNAFGNSS----LENSFYHNMSYGSKLSKSLMFFIAADNQFD-DAMWPLFNCFVNLKVLNLSYNNFSDVSHM-----KLESITELYLSGNKLTTLSGDTVLKWSS 1235          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Nematostella
Match: EDO40059 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S882])

HSP 1 Score: 97.8265 bits (242), Expect = 7.630e-22
Identity = 99/355 (27.89%), Postives = 155/355 (43.66%), Query Frame = 2
Query:  299 YTLDLRCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELR-ELKIFDNQLEIISNLENLKELVVL-------------------QAQYNKIQEI-GTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDNEFPIFDETCQQYSSAMVTRHLGNLLILDNVSVKYSDIDNVINTVSVPESSNVALPELSLKQVENQLTEIIKAA 1300
            + ++L  +KL  +P +  F   ++LD+S N++  ++ L   +  R EL     Q     N EN                          +++   IQ + G   L   +K+K +RLD+N L  + + +   C  +T +D+S N L +IS +  L  +EE   S N+I  +P++SRCK L E+ LS N IS I G+RDL  L  L    N++T+LS LG     + L L  N+IS                              +E+  + S++ ELYI  N  P        Y   +  + + +L I+D VS+K          +    +S V    LS +QVE QL    KAA
Sbjct:  103 FEINLHAQKLTRVPDIHKFTKLRILDLSCNHISAVSGLDESTVKRTELSPSSPQ----QNKENWGTSQGGRGKSGGRGSRQFLEVERPGKSRRESIQAVLGGKGLAPVRKVKVLRLDSNLLTTLEHQEIGCCSQITILDISNNKLSNISAVNSLSALEELDLSTNRISKVPDISRCKHLQELDLSRNQISDISGLRDLSGLNILRLESNQLTTLSSLGKHKNLQELYLGHNRIST-----------------------------VEFPLSNSSVAELYIAGN--PCLSSESVGYHQEL-HKVIPSLEIVDGVSLKRPSSSRGKPLMRPLSASQV----LSSRQVEEQL----KAA 413          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Nematostella
Match: EDO44937 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU20])

HSP 1 Score: 73.9442 bits (180), Expect = 1.510e-14
Identity = 79/269 (29.37%), Postives = 125/269 (46.47%), Query Frame = 2
Query:  305 LDLRCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQIS-IDQIKYLKTTFINLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDNEFPIFDETC 1108
            +DL   ++D I      +  K L +  N +K L NL+ L+ L EL  +DNQ+  I NL+ L  L +L   +N I+ I    L    KL+ + L  N + +I      +   LT V++  N ++ +  +  L  +E  +   NKI  +  LS    L  + + SN I  + G+  L SL  L  SHN I  +  L  L K   L+L+ N+I  I  + +L    +NLE    + N L     L E L+    L  +Y++ N  P+  +T 
Sbjct:   32 VDLTHGRIDKIQNFERLRCVKSLCLRRNEIKKLENLETLTSLEELDFYDNQISKIENLDRLVNLRILDLSFNVIKVIEN--LNSLTKLEKLYLVQNKIGRIEG--LEHLTELTMVELGANKIRVLEGLEHLTKLESLFVGKNKITELQNLSGLCSLKVLSIQSNRIVELKGLEHLDSLEELYISHNGIEEIKGLESLTKLNTLDLASNRIKRISNVGHL----LNLEEFWFNDNQLEHWEDLDE-LAKCPKLHTVYLERN--PLSRDTA 289          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Nematostella
Match: EDO30347 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T121])

HSP 1 Score: 57.3806 bits (137), Expect = 9.505e-10
Identity = 49/160 (30.63%), Postives = 82/160 (51.25%), Query Frame = 2
Query:  377 ISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQA--------QYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEI---IPELSRCKKLSEIHLSSNIISHIGGVR 823
            +  N +K L NL+ L+ L EL  +DNQ   IS +ENL  LV L          Q N+I E+    L +   L+ + + +N + +I      +   L  +D++ N ++ IS +  L N+EEF+ + N++E    + EL++C KL  ++L  N +S     R
Sbjct:   10 LRRNEIKKLENLETLTSLEELDFYDNQ---ISKIENLDRLVNLSCHHVFLFVFQSNRIVEL--KGLEHLDSLEELYISHNGIEEIKG--LESLAKLNTLDLASNRIKRISNVGHLLNLEEFWFNDNQLEHWEDLDELAKCPKLHTVYLERNPLSRDTAYR 162          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Nematostella
Match: EDO45771 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSA0])

HSP 1 Score: 59.6918 bits (143), Expect = 1.645e-9
Identity = 56/175 (32.00%), Postives = 88/175 (50.29%), Query Frame = 2
Query:  293 DGYTLDLRCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELREL---KIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISH 808
            D   LD R  +L   PIL    + ++L+   N   ++ N+Q+L+ LR L    I+DNQ+E IS L +LK L VL    N+I++I    L    KL  + L  N + KI N   S+   L  ++++ N +  +  I+ + ++ E     NKI  + E+ R   L  + LS N IS 
Sbjct:   30 DRLNLDRR--RLTVCPILEGEDNLRLLNFQHN---LIRNIQHLANLRRLIFLDIYDNQIEEISGLSSLKSLRVLMLGKNRIRKINN--LEALTKLDVLDLHGNRISKIEN--LSHLTELRVLNLAGNEILKVCNISGMRSLAELNLRRNKICTVEEVDRLSNLQRLFLSFNCISR 195          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Nematostella
Match: EDO49856 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REV6])

HSP 1 Score: 57.7658 bits (138), Expect = 3.686e-9
Identity = 75/265 (28.30%), Postives = 124/265 (46.79%), Query Frame = 2
Query:  206 KPISNKINEIPSNFDSENLLTRRNESKPKDGYTLDLRCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRD-LKSLTTLDFSHNRITS---LSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVL 988
            KP  N + E     DS +LL +           LD+  ++L +I +L  F H + +DIS N++K L+ L  L+ L  LK   N L   + L+ L  L +     NKI  + T  + +   L+H+ L  N + +++  D      L  +++  N L + + +  L N+ E Y + N I  +  L R + L+++HL  N I  + G  + +K+L  L+   N I+S   + KL  L     L L +N +S D+  Y     I L  L
Sbjct:   28 KPPENPLTE-EMLADSLSLLCKTGNGLAHAYVRLDIHDKELTDISVLNCFIHLRYVDISGNSLKDLSPLNSLTHLLTLKADRNALS-SAKLDELPYLQIASFTQNKI--MDTEGINH-PLLEHLNLSMNEIVEVSGLDPGKLSRLAILELRGNKLMTTTGMN-LENLRELYLAANTIRKVEGLDRLEHLTKLHLRDNQIDSLEGFSENMKNLQYLNLRGNSISSNKEVQKLKCLPLLRALVLMENPVS-DEDDYRIEVLIALRRL 285          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Medaka
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:101158055])

HSP 1 Score: 78.1814 bits (191), Expect = 2.327e-15
Identity = 72/256 (28.12%), Postives = 122/256 (47.66%), Query Frame = 2
Query:  314 RCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEI--------------------GTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQIS----IDQIKYLKTTFINLEVLNISKNGL 1009
            R  K++ + +L   +  K L +  N +K + NL+ LS LREL ++DNQ+  + NL+NL EL  L   +N +++I                    G   L +   L+ + L +N +  I N D     +LT + +  N +  +  +  L N+       N+I  I  L     L E++LS N I  I G+ + K LTTLD + NR+  +  +  L + +   ++DNQI     +D++K  K+    LE + + +N L
Sbjct:   73 RIGKIEGLEVL---QKAKTLSLRQNLIKKIENLESLSSLRELDLYDNQIRKLENLDNLTELEQLDVSFNILRKIENLERLTQLKKLFLVHNKITGIANLEHFSFLEMLELGSNRIRVIENLD--GLTSLTSLFLGTNKINKLQNLDALHNLSVLSIQSNRITKIEGLQNLVNLKELYLSHNGIEVIEGLENNKKLTTLDIAANRVKKIENISHLTELQEFWMNDNQIENWSDLDELKNAKS----LETVYLERNPL 319          

HSP 2 Score: 63.929 bits (154), Expect = 1.158e-10
Identity = 67/225 (29.78%), Postives = 107/225 (47.56%), Query Frame = 2
Query:  467 ISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHKL------------------LEYLSNLSNLCELYIQDNEF 1087
            I  LE L++   L  + N I++I    L     L+ + L +N + K+ N D  N   L  +DVSFN L+ I  +  L  +++ +  HNKI  I  L     L  + L SN I  I  +  L SLT+L    N+I  L  L  L+    L++  N+I+  +I+ L+   +NL+ L +S NG+  I  L                  +E +S+L+ L E ++ DN+ 
Sbjct:   77 IEGLEVLQKAKTLSLRQNLIKKIEN--LESLSSLRELDLYDNQIRKLENLD--NLTELEQLDVSFNILRKIENLERLTQLKKLFLVHNKITGIANLEHFSFLEMLELGSNRIRVIENLDGLTSLTSLFLGTNKINKLQNLDALHNLSVLSIQSNRIT--KIEGLQ-NLVNLKELYLSHNGIEVIEGLENNKKLTTLDIAANRVKKIENISHLTELQEFWMNDNQI 294          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Medaka
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:101158055])

HSP 1 Score: 76.6406 bits (187), Expect = 1.039e-14
Identity = 72/256 (28.12%), Postives = 122/256 (47.66%), Query Frame = 2
Query:  314 RCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEI--------------------GTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQIS----IDQIKYLKTTFINLEVLNISKNGL 1009
            R  K++ + +L   +  K L +  N +K + NL+ LS LREL ++DNQ+  + NL+NL EL  L   +N +++I                    G   L +   L+ + L +N +  I N D     +LT + +  N +  +  +  L N+       N+I  I  L     L E++LS N I  I G+ + K LTTLD + NR+  +  +  L + +   ++DNQI     +D++K  K+    LE + + +N L
Sbjct:  112 RIGKIEGLEVL---QKAKTLSLRQNLIKKIENLESLSSLRELDLYDNQIRKLENLDNLTELEQLDVSFNILRKIENLERLTQLKKLFLVHNKITGIANLEHFSFLEMLELGSNRIRVIENLD--GLTSLTSLFLGTNKINKLQNLDALHNLSVLSIQSNRITKIEGLQNLVNLKELYLSHNGIEVIEGLENNKKLTTLDIAANRVKKIENISHLTELQEFWMNDNQIENWSDLDELKNAKS----LETVYLERNPL 358          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Medaka
Match: si:dkey-28o19.1 (leucine-rich repeat transmembrane neuronal protein 4 [Source:NCBI gene;Acc:101174444])

HSP 1 Score: 57.7658 bits (138), Expect = 1.700e-8
Identity = 60/212 (28.30%), Postives = 97/212 (45.75%), Query Frame = 2
Query:  410 LQYLSELRELKIFDNQLEIISN--LENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHI--GGVRDLKSLTTLDFSHNRITSLSKLGVLNKA--EYLNLSDNQIS-IDQIKYLKTTFINLEVLNISKNGLSDIHK 1024
             Q +  L+EL +  N++  + N     +  L  L   YNK+Q +  G  +  +KL  + + +N L  I    F +C NL ++D+ +N L+SI              S N        S   KL+E+HL  N  S I       L +L  L    NRI ++S+      A  + L+LS N+++ +D   Y    F NL+ LN+  N L+++ K
Sbjct:   87 FQGIRRLKELILSSNKITSLHNTTFHPVPNLRNLDLSYNKLQALQPGQFQGLRKLMSLHIRSNSLKGIPMRLFQDCRNLEFLDLGYNRLRSI--------------SRNA------FSGLVKLTELHLEHNQFSKINFSHFPRLYNLRALYLQWNRIRTMSQGLTWTWASIQKLDLSGNELTELDAEVY--QCFPNLQTLNLDANKLTNVSK 276          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Medaka
Match: si:dkey-28o19.1 (leucine-rich repeat transmembrane neuronal protein 4 [Source:NCBI gene;Acc:101174444])

HSP 1 Score: 57.7658 bits (138), Expect = 1.862e-8
Identity = 60/212 (28.30%), Postives = 97/212 (45.75%), Query Frame = 2
Query:  410 LQYLSELRELKIFDNQLEIISN--LENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHI--GGVRDLKSLTTLDFSHNRITSLSKLGVLNKA--EYLNLSDNQIS-IDQIKYLKTTFINLEVLNISKNGLSDIHK 1024
             Q +  L+EL +  N++  + N     +  L  L   YNK+Q +  G  +  +KL  + + +N L  I    F +C NL ++D+ +N L+SI              S N        S   KL+E+HL  N  S I       L +L  L    NRI ++S+      A  + L+LS N+++ +D   Y    F NL+ LN+  N L+++ K
Sbjct:  102 FQGIRRLKELILSSNKITSLHNTTFHPVPNLRNLDLSYNKLQALQPGQFQGLRKLMSLHIRSNSLKGIPMRLFQDCRNLEFLDLGYNRLRSI--------------SRNA------FSGLVKLTELHLEHNQFSKINFSHFPRLYNLRALYLQWNRIRTMSQGLTWTWASIQKLDLSGNELTELDAEVY--QCFPNLQTLNLDANKLTNVSK 291          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Medaka
Match: lrrc8aa (leucine rich repeat containing 8 VRAC subunit A [Source:NCBI gene;Acc:101165987])

HSP 1 Score: 57.7658 bits (138), Expect = 2.086e-8
Identity = 57/172 (33.14%), Postives = 92/172 (53.49%), Query Frame = 2
Query:  395 KILNNLQYLSELRELKIFDNQL----EIISNLENLKELVVLQAQYNKIQ----EIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISF-ITCLPNIEEFYASHNKIEIIP-ELSRCKKLSEIHLSSNIISHIGG-VRDLKSLTTLDFSHNRITSL 877
            +I +++  L  L+E+ + DN L    EIIS  ++L  LV L+  YN+I     +IGT        L+ + L+ N + KI +  F  C  L ++D+S NNL SI   +  L N++    + N+IE +P EL +CKKL  ++L +N +  +     +L  LT L+   NR+  L
Sbjct:  591 RIPHSIFSLHNLQEIDLKDNNLKTIEEIIS-FQHLHRLVCLKLWYNQIAYIPIQIGT-----LTNLERLYLNRNKIEKIPSQLFF-CRKLRFLDLSHNNLTSIHPDVGFLQNLQYLAVTANRIETLPPELFQCKKLRTLNLGNNCLQTLPSRFGELTGLTQLELRGNRLECL 755          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Planmine SMEST
Match: SMESG000066010.1 (SMESG000066010.1)

HSP 1 Score: 469.929 bits (1208), Expect = 6.338e-165
Identity = 242/253 (95.65%), Postives = 245/253 (96.84%), Query Frame = 2
Query:  731 KIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDNEFPIFDETCQQYSSAMVTRHLGNLLILDNVSVKYSDIDNVINTVSVPESSNVALPELSLKQVENQLTEIIKAANEFHLENTFRYNEIIKSFSENDCQSTDCQLQRSSPLLTNRTTKKSRLLDALSFASANYAEDKT 1489
            K++ IP L+    LSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDNEFPIFDETCQQYSSAMVTRHLGNLLILDNVSVK SDIDNVINTVSVPESSNVALPELSLKQVENQLTEIIKAANEFHLENTFRYNEIIKSFSEND QSTDCQLQRSSPLLTNRTTKKSRLLDALSFASANYAEDKT
Sbjct:   69 KLDNIPILTN---LSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDNEFPIFDETCQQYSSAMVTRHLGNLLILDNVSVKNSDIDNVINTVSVPESSNVALPELSLKQVENQLTEIIKAANEFHLENTFRYNEIIKSFSENDSQSTDCQLQRSSPLLTNRTTKKSRLLDALSFASANYAEDKT 318          

HSP 2 Score: 142.51 bits (358), Expect = 4.055e-38
Identity = 113/242 (46.69%), Postives = 140/242 (57.85%), Query Frame = 2
Query:  119 MKFQMYKIPLPDMXXXXXXXXXXXXXXXYKPISNKINEIPSNFDSENLLTRRNESKPKDGYTLDLRCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLH----KITNNDFSNCINLTYVDVSFNNLQSI----SFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGV 820
            MKFQMYKIPLPDMNTNKLSNTNNANLSKYKPISNKINEIPSNFDSENLLTRRNESKPKDGYTLDLRCEKLDNIPILTN                         L E+ +  N +  I  + +LK L  L   +N+I  +    L    K +++ L +N +     K     F   INL  +++S N L  I     +++ L N+ E Y   N+  I  E   C++ S    S+ +  H+G +
Sbjct:    1 MKFQMYKIPLPDMNTNKLSNTNNANLSKYKPISNKINEIPSNFDSENLLTRRNESKPKDGYTLDLRCEKLDNIPILTN-------------------------LSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSL--SKLGVLNKAEYLNLSDNQISIDQIKYLKTTF---INLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDNEFPIFDE--TCQQYS----SAMVTRHLGNL 206          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Planmine SMEST
Match: SMESG000066010.1 (SMESG000066010.1)

HSP 1 Score: 469.544 bits (1207), Expect = 8.043e-165
Identity = 242/253 (95.65%), Postives = 245/253 (96.84%), Query Frame = 2
Query:  731 KIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDNEFPIFDETCQQYSSAMVTRHLGNLLILDNVSVKYSDIDNVINTVSVPESSNVALPELSLKQVENQLTEIIKAANEFHLENTFRYNEIIKSFSENDCQSTDCQLQRSSPLLTNRTTKKSRLLDALSFASANYAEDKT 1489
            K++ IP L+    LSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDNEFPIFDETCQQYSSAMVTRHLGNLLILDNVSVK SDIDNVINTVSVPESSNVALPELSLKQVENQLTEIIKAANEFHLENTFRYNEIIKSFSEND QSTDCQLQRSSPLLTNRTTKKSRLLDALSFASANYAEDKT
Sbjct:   65 KLDNIPILTN---LSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDNEFPIFDETCQQYSSAMVTRHLGNLLILDNVSVKNSDIDNVINTVSVPESSNVALPELSLKQVENQLTEIIKAANEFHLENTFRYNEIIKSFSENDSQSTDCQLQRSSPLLTNRTTKKSRLLDALSFASANYAEDKT 314          

HSP 2 Score: 133.65 bits (335), Expect = 6.852e-35
Identity = 109/238 (45.80%), Postives = 136/238 (57.14%), Query Frame = 2
Query:  131 MYKIPLPDMXXXXXXXXXXXXXXXYKPISNKINEIPSNFDSENLLTRRNESKPKDGYTLDLRCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLH----KITNNDFSNCINLTYVDVSFNNLQSI----SFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGV 820
            MYKIPLPDMNTNKLSNTNNANLSKYKPISNKINEIPSNFDSENLLTRRNESKPKDGYTLDLRCEKLDNIPILTN                         L E+ +  N +  I  + +LK L  L   +N+I  +    L    K +++ L +N +     K     F   INL  +++S N L  I     +++ L N+ E Y   N+  I  E   C++ S    S+ +  H+G +
Sbjct:    1 MYKIPLPDMNTNKLSNTNNANLSKYKPISNKINEIPSNFDSENLLTRRNESKPKDGYTLDLRCEKLDNIPILTN-------------------------LSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSL--SKLGVLNKAEYLNLSDNQISIDQIKYLKTTF---INLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDNEFPIFDE--TCQQYS----SAMVTRHLGNL 202          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Planmine SMEST
Match: SMESG000066264.1 (SMESG000066264.1)

HSP 1 Score: 128.642 bits (322), Expect = 7.389e-36
Identity = 77/78 (98.72%), Postives = 78/78 (100.00%), Query Frame = 2
Query:  119 MKFQMYKIPLPDMXXXXXXXXXXXXXXXYKPISNKINEIPSNFDSENLLTRRNESKPKDGYTLDLRCEKLDNIPILTN 352
            MKFQMYKIPLPDMNTNKLSNTN+ANLSKYKPISNKINEIPSNFDSENLLTRRNESKPKDGYTLDLRCEKLDNIPILTN
Sbjct:    1 MKFQMYKIPLPDMNTNKLSNTNSANLSKYKPISNKINEIPSNFDSENLLTRRNESKPKDGYTLDLRCEKLDNIPILTN 78          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Planmine SMEST
Match: SMESG000026105.1 (SMESG000026105.1)

HSP 1 Score: 71.2478 bits (173), Expect = 2.877e-13
Identity = 63/202 (31.19%), Postives = 100/202 (49.50%), Query Frame = 2
Query:  308 DLRCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYL 913
            D +  K++N+  L N     +LD+S N +K++ N+  L +L +L   +N++  I NL +L  + +L+   N I+ I    L    KL  + L  N + K+ N DF    NLT + +  N +  I  +  L N+E+ Y SHN I  I  L    KL+ + LSSN IS +  +  LK L    F+ N +   + +  L   E L
Sbjct:   78 DNQITKIENLDKLVNLS---ILDLSFNRIKLIENIDKLIKLTKLYFVNNKIRTIENLNSLVNIEMLELGSNSIKRIEN--LDSLTKLDQLYLGKNKISKLENLDFMK--NLTVLSIQGNRITQIDGLDNLINLEQLYLSHNGISKIENLGNLTKLTTLDLSSNRISKVENLSHLKILEEFWFNDNNLADWNSIDELVNLEKL 272          

HSP 2 Score: 61.6178 bits (148), Expect = 3.980e-10
Identity = 75/264 (28.41%), Postives = 112/264 (42.42%), Query Frame = 2
Query:  293 DGYTLDLRCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSE-LRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRITSLSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDIHKLLEYLSNLSNLCELYIQDN 1081
            D   +D    +L+ I  L      K L + +N +K + NL+ +SE L EL ++DNQ   I+ +ENL +LV                                             NL+ +D+SFN ++ I  I  L  + + Y  +NKI  I  L+    +  + L SN I  I  +  L  L  L    N+I+ L  L  +     L++  N+I+  QI  L    INLE L +S NG+S I    E L NL+ L  L +  N
Sbjct:   25 DAEVIDFNHARLERIENLDQLTKAKSLCLRNNLIKKIENLETISETLEELDLYDNQ---ITKIENLDKLV---------------------------------------------NLSILDLSFNRIKLIENIDKLIKLTKLYFVNNKIRTIENLNSLVNIEMLELGSNSIKRIENLDSLTKLDQLYLGKNKISKLENLDFMKNLTVLSIQGNRIT--QIDGLD-NLINLEQLYLSHNGISKI----ENLGNLTKLTTLDLSSN 233          
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Planmine SMEST
Match: SMESG000011491.1 (SMESG000011491.1)

HSP 1 Score: 62.003 bits (149), Expect = 7.546e-10
Identity = 81/271 (29.89%), Postives = 131/271 (48.34%), Query Frame = 2
Query:  260 LLTRRNESKPKDGYTLDLRCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQYLSELREL---KIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKLKHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFYA------SHNKIEIIPEL--SRCKKLSEIHLSSNIISHIGGVR------DLKSLTTLDFSHNRITS--LSKLGVLNKAEYLNLSDN-QISIDQIKYLKTTFINLEVLNISKNGLS 1012
            ++ R+ E K K+   + L  + L + PIL N ++ ++L+   N    +N +Q+L +LR+L    ++DN++E IS LE LK L VL    N+I +I    L    +L  + L  N +  I N   ++  +L  ++++ N       ITCL N+   Y+        N +E + ++  + C  L  I LS N   H+G +       DL SL  L   +N I+S   S+  V+     LNL D  QI+ D     K     LE+ + S +GLS
Sbjct:   89 VVRRKQEDKQKNPDRISLDRQNLTSCPILENEENLRLLNYQYN---YINQIQHLDKLRKLILLDLYDNRIERISGLETLKSLRVLMLGRNRISKI--EGLESLTRLDVLDLHANSIQVIEN--INHLSDLRVLNLAGN------VITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFN---HLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKAKQIINRLELGSKSNSGLS 343          
The following BLAST results are available for this feature:
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP1R79.098e-1931.43protein phosphatase 1 regulatory subunit 7 [Source... [more]
PPP1R71.487e-1831.43protein phosphatase 1 regulatory subunit 7 [Source... [more]
PPP1R76.211e-1832.89protein phosphatase 1 regulatory subunit 7 [Source... [more]
PPP1R76.260e-1832.44protein phosphatase 1 regulatory subunit 7 [Source... [more]
PPP1R76.260e-1832.44protein phosphatase 1 regulatory subunit 7 [Source... [more]
back to top
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sds-229.150e-1327.30Protein phosphatase 1 regulatory subunit SDS22 hom... [more]
K10D2.84.098e-1228.44pep chromosome:WBcel235:III:5188726:5190175:1 gene... [more]
let-4137.856e-1024.48pep chromosome:WBcel235:V:7972924:7977774:-1 gene:... [more]
let-4131.178e-924.48pep chromosome:WBcel235:V:7972934:7977774:-1 gene:... [more]
lron-152.800e-928.40ELRR (Extracellular Leucine-Rich Repeat) ONly [So... [more]
back to top
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sds222.442e-1432.26gene:FBgn0028992 transcript:FBtr0083436[more]
Toll-75.272e-1228.31gene:FBgn0034476 transcript:FBtr0086336[more]
18w4.154e-1128.92gene:FBgn0004364 transcript:FBtr0086309[more]
Tollo4.429e-1027.34gene:FBgn0029114 transcript:FBtr0075607[more]
Toll-61.120e-927.40gene:FBgn0036494 transcript:FBtr0075614[more]
back to top
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1r74.721e-1125.83protein phosphatase 1, regulatory (inhibitor) subu... [more]
lrrc401.862e-1025.56leucine rich repeat containing 40 [Source:NCBI gen... [more]
lgr41.959e-1026.45Danio rerio leucine-rich repeat containing G prote... [more]
lrrc8aa2.820e-1034.88leucine rich repeat containing 8 VRAC subunit Aa [... [more]
lrrc92.052e-926.53leucine rich repeat containing 9 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1r71.875e-1430.14protein phosphatase 1 regulatory subunit 7 [Source... [more]
dck.22.992e-1030.32deoxycytidine kinase, gene 2 [Source:Xenbase;Acc:X... [more]
LRIG33.256e-1029.66leucine-rich repeats and immunoglobulin like domai... [more]
pparg1.090e-927.51peroxisome proliferator activated receptor gamma [... [more]
lrrc4b1.247e-929.95leucine rich repeat containing 4B [Source:NCBI gen... [more]
back to top
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppp1r72.644e-1732.14protein phosphatase 1, regulatory subunit 7 [Sourc... [more]
Lrig11.607e-1029.48leucine-rich repeats and immunoglobulin-like domai... [more]
Lrig11.607e-1029.48leucine-rich repeats and immunoglobulin-like domai... [more]
Lrig11.607e-1029.48leucine-rich repeats and immunoglobulin-like domai... [more]
Lrrc232.458e-1027.07leucine rich repeat containing 23 [Source:MGI Symb... [more]
back to top
BLAST of Phosphatase 1 regulatory subunit 7-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q15435|PP1R7_HUMAN3.006e-1732.44Protein phosphatase 1 regulatory subunit 7 OS=Homo... [more]
sp|Q5RFS7|PP1R7_PONAB3.550e-1731.70Protein phosphatase 1 regulatory subunit 7 OS=Pong... [more]
sp|Q3UM45|PP1R7_MOUSE1.849e-1632.14Protein phosphatase 1 regulatory subunit 7 OS=Mus ... [more]
sp|Q5HZV9|PP1R7_RAT4.077e-1631.72Protein phosphatase 1 regulatory subunit 7 OS=Ratt... [more]
sp|Q723K6|INLA_LISMF6.101e-1634.45Internalin A OS=Listeria monocytogenes serotype 4b... [more]
back to top
BLAST of Phosphatase 1 regulatory subunit 7-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S0ZW093.041e-5135.01Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A1S3J1118.394e-4933.96protein phosphatase 1 regulatory subunit 7 isoform... [more]
V4BDP12.138e-4834.43Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A1S3I7Q83.155e-4831.38protein phosphatase 1 regulatory subunit 7 OS=Ling... [more]
A0A1S3J1I43.639e-4834.23protein phosphatase 1 regulatory subunit 7 isoform... [more]
back to top
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc231.128e-1328.37leucine rich repeat containing 23 [Source:NCBI gen... [more]
ppp1r71.774e-1327.91protein phosphatase 1 regulatory subunit 7 [Source... [more]
lgr42.199e-1126.28Danio rerio leucine-rich repeat containing G prote... [more]
lrig36.667e-1125.17leucine rich repeats and immunoglobulin like domai... [more]
lrrc8aa1.250e-933.72leucine rich repeat containing 8 VRAC subunit A [S... [more]
back to top
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1r71.792e-1630.83protein phosphatase 1, regulatory (inhibitor) subu... [more]
lrrc405.694e-1327.06leucine rich repeat containing 40 [Source:NCBI gen... [more]
lrguk1.742e-1129.38leucine-rich repeats and guanylate kinase domain c... [more]
lrig31.187e-1028.83leucine-rich repeats and immunoglobulin-like domai... [more]
ENSPMAT00000005086.17.487e-1030.32pep scaffold:Pmarinus_7.0:GL477410:204878:243212:-... [more]
back to top
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SDS221.822e-928.62Regulatory subunit of the type 1 protein phosphata... [more]
CYR13.995e-926.73Adenylate cyclase; required for cAMP production an... [more]
back to top
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO400597.630e-2227.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449371.510e-1429.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303479.505e-1030.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457711.645e-932.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498563.686e-928.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1r72.327e-1528.13protein phosphatase 1 regulatory subunit 7 [Source... [more]
ppp1r71.039e-1428.13protein phosphatase 1 regulatory subunit 7 [Source... [more]
si:dkey-28o19.11.700e-828.30leucine-rich repeat transmembrane neuronal protein... [more]
si:dkey-28o19.11.862e-828.30leucine-rich repeat transmembrane neuronal protein... [more]
lrrc8aa2.086e-833.14leucine rich repeat containing 8 VRAC subunit A [S... [more]
back to top
BLAST of Phosphatase 1 regulatory subunit 7-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066010.16.338e-16595.65SMESG000066010.1[more]
SMESG000066010.18.043e-16595.65SMESG000066010.1[more]
SMESG000066264.17.389e-3698.72SMESG000066264.1[more]
SMESG000026105.12.877e-1331.19SMESG000026105.1[more]
SMESG000011491.17.546e-1029.89SMESG000011491.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020598 ID=SMED30020598|Name=Phosphatase 1 regulatory subunit 7-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1550bp
TATATCAATTGACTCTTTTCTATAGCAATAAGTATTTAATTTGTCTTATT
TTCTGATTTAACAGATAAAATATAGTATTAATGTTTTAAAATCGTATTAT
TATAAATTTGTAAAGTTAATGAAATTTCAAATGTATAAAATTCCGCTTCC
AGATATGAATACGAATAAACTTTCAAATACGAATAATGCAAATTTAAGTA
AATACAAACCTATTTCGAATAAAATAAACGAAATCCCTTCAAATTTCGAT
TCAGAAAATTTGTTGACGCGACGCAATGAGTCCAAACCAAAAGATGGTTA
TACATTAGACTTGAGATGTGAAAAATTAGACAATATCCCTATTTTGACGA
ATTTTAAACACCATAAAGTTTTGGATATTAGCTCAAATAACGTAAAAATT
TTGAATAATCTACAATATTTAAGTGAATTGAGAGAATTAAAGATTTTCGA
TAATCAGTTAGAGATCATTTCAAATTTAGAGAATTTAAAAGAATTGGTGG
TTCTTCAAGCACAATATAATAAAATCCAGGAAATTGGAACTGGTGCATTA
CGTTATTGTAAAAAGTTAAAACATATCAGATTAGACAACAATTTTCTACA
TAAAATAACCAATAATGACTTTTCTAATTGTATCAATCTGACATATGTCG
ACGTCAGTTTCAATAATTTACAGTCTATTTCTTTCATTACTTGCCTGCCA
AATATAGAAGAGTTCTATGCTTCGCATAATAAAATTGAAATTATTCCAGA
ACTTTCTCGTTGTAAAAAGTTATCAGAAATTCATTTAAGCAGTAACATCA
TTTCTCATATCGGAGGTGTTAGGGATCTCAAGTCATTGACTACTTTAGAT
TTTTCTCATAATAGAATAACAAGTTTATCCAAATTAGGCGTTCTGAATAA
AGCAGAATATCTCAATCTCTCTGATAATCAAATTTCAATTGATCAAATTA
AGTATCTAAAAACAACTTTTATCAATTTAGAAGTTTTGAATATTAGTAAA
AATGGTTTATCCGATATCCATAAATTACTGGAGTATTTGTCAAATTTGAG
TAATTTATGCGAATTATATATTCAAGACAACGAATTTCCAATTTTTGATG
AAACATGTCAACAGTATAGTTCAGCAATGGTTACTCGCCATTTAGGCAAC
CTTCTCATTCTTGATAATGTTTCCGTTAAATATTCTGATATTGATAATGT
TATAAACACTGTATCTGTACCTGAGTCTTCAAATGTAGCTTTGCCAGAGT
TGTCATTGAAGCAAGTTGAAAACCAATTAACAGAAATTATCAAGGCAGCA
AATGAGTTTCATTTGGAAAATACATTTCGTTACAACGAAATCATCAAGTC
ATTTTCAGAAAATGATTGCCAATCAACTGATTGTCAGCTTCAGCGCTCAT
CTCCTTTACTGACAAATAGAACTACAAAGAAATCCCGACTATTGGATGCG
CTGTCATTCGCCAGTGCCAATTATGCAGAAGATAAAACTTAACAAAACAC
ATTTATTTTCTTGTAACATACAACAATTTAATAATAAAATGTTTCAATCC
back to top

protein sequence of SMED30020598-orf-1

>SMED30020598-orf-1 ID=SMED30020598-orf-1|Name=SMED30020598-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=458bp
MKFQMYKIPLPDMNTNKLSNTNNANLSKYKPISNKINEIPSNFDSENLLT
RRNESKPKDGYTLDLRCEKLDNIPILTNFKHHKVLDISSNNVKILNNLQY
LSELRELKIFDNQLEIISNLENLKELVVLQAQYNKIQEIGTGALRYCKKL
KHIRLDNNFLHKITNNDFSNCINLTYVDVSFNNLQSISFITCLPNIEEFY
ASHNKIEIIPELSRCKKLSEIHLSSNIISHIGGVRDLKSLTTLDFSHNRI
TSLSKLGVLNKAEYLNLSDNQISIDQIKYLKTTFINLEVLNISKNGLSDI
HKLLEYLSNLSNLCELYIQDNEFPIFDETCQQYSSAMVTRHLGNLLILDN
VSVKYSDIDNVINTVSVPESSNVALPELSLKQVENQLTEIIKAANEFHLE
NTFRYNEIIKSFSENDCQSTDCQLQRSSPLLTNRTTKKSRLLDALSFASA
NYAEDKT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR003591Leu-rich_rpt_typical-subtyp
IPR001611Leu-rich_rpt
IPR032675LRR_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0019888protein phosphatase regulator activity
GO:0030234enzyme regulator activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005694chromosome
GO:0005737cytoplasm
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0007059chromosome segregation
GO:0008150biological_process
GO:0035307positive regulation of protein dephosphorylation
GO:0050790regulation of catalytic activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 380..400
NoneNo IPR availableSMARTSM00365LRR_sd22_2coord: 101..122
e-value: 31.0
score: 11.6
coord: 147..168
e-value: 630.0
score: 0.9
coord: 193..214
e-value: 26.0
score: 12.1
coord: 79..100
e-value: 710.0
score: 0.5
coord: 215..236
e-value: 230.0
score: 4.4
coord: 284..309
e-value: 660.0
score: 0.7
coord: 237..258
e-value: 0.58
score: 19.2
NoneNo IPR availableSMARTSM00364LRR_bac_2coord: 237..256
e-value: 14.0
score: 12.7
coord: 101..120
e-value: 210.0
score: 3.6
coord: 193..212
e-value: 24.0
score: 10.8
NoneNo IPR availablePANTHERPTHR46652FAMILY NOT NAMEDcoord: 60..213
coord: 146..432
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 58..344
IPR003591Leucine-rich repeat, typical subtypeSMARTSM00369LRR_typ_2coord: 193..215
e-value: 43.0
score: 8.1
coord: 123..146
e-value: 41.0
score: 8.3
coord: 310..332
e-value: 350.0
score: 0.6
coord: 237..261
e-value: 4.0
score: 16.4
coord: 284..307
e-value: 110.0
score: 4.7
coord: 147..170
e-value: 190.0
score: 2.9
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 230..373
e-value: 4.0E-20
score: 73.5
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 17..229
e-value: 1.1E-30
score: 108.1
IPR001611Leucine-rich repeatPFAMPF13855LRR_8coord: 126..184
e-value: 1.5E-7
score: 31.1
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 286..307
score: 7.827
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 217..238
score: 7.358
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 239..260
score: 9.19
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 81..102
score: 5.987
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 149..170
score: 6.464
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 173..194
score: 7.473
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 261..281
score: 6.672
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 195..216
score: 7.003
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 103..124
score: 7.55
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 125..146
score: 5.04