HATPase_c domain-containing protein

Overview
NameHATPase_c domain-containing protein
Smed IDSMED30020593
Length (bp)319
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of HATPase_c domain-containing protein (SMED30020593) t-SNE clustered cells

Violin plots show distribution of expression levels for HATPase_c domain-containing protein (SMED30020593) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of HATPase_c domain-containing protein (SMED30020593) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for HATPase_c domain-containing protein (SMED30020593) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020593

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30020593SMESG000054821.1 SMESG000054819.1 SMESG000028508.1 Contig15693newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30020593SMESG000054821.1 SMESG000054819.1 SMESG000028508.1 Contig15693uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testis primordiumSMED30020593SMESG000054819.1 Contig5941_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of HATPase_c domain-containing protein vs. Ensembl Human
Match: HSP90B1 (heat shock protein 90 beta family member 1 [Source:HGNC Symbol;Acc:HGNC:12028])

HSP 1 Score: 112.849 bits (281), Expect = 7.108e-30
Identity = 54/86 (62.79%), Postives = 64/86 (74.42%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEG 260
            +RF SSH     TSL  YV RMK  QDKI+F+AG S  + + SP VE LLKK YEV+YL EP+DEY  Q+LPEF+GK+FQNVAKEG
Sbjct:  510 LRFQSSHHPTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEG 595          
BLAST of HATPase_c domain-containing protein vs. Ensembl Human
Match: HSP90AB1 (heat shock protein 90 alpha family class B member 1 [Source:HGNC Symbol;Acc:HGNC:5258])

HSP 1 Score: 80.4925 bits (197), Expect = 1.663e-18
Identity = 40/84 (47.62%), Postives = 55/84 (65.48%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAK 254
            +R+ +S S +  TSL++YVSRMK TQ  I++I G S   V  S  VE + K+ +EV+Y+ EPIDEY  Q L EF+GK   +V K
Sbjct:  455 LRYHTSQSGDEMTSLSEYVSRMKETQKSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTK 538          
BLAST of HATPase_c domain-containing protein vs. Ensembl Human
Match: HSP90AB1 (heat shock protein 90 alpha family class B member 1 [Source:HGNC Symbol;Acc:HGNC:5258])

HSP 1 Score: 80.4925 bits (197), Expect = 1.663e-18
Identity = 40/84 (47.62%), Postives = 55/84 (65.48%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAK 254
            +R+ +S S +  TSL++YVSRMK TQ  I++I G S   V  S  VE + K+ +EV+Y+ EPIDEY  Q L EF+GK   +V K
Sbjct:  455 LRYHTSQSGDEMTSLSEYVSRMKETQKSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTK 538          
BLAST of HATPase_c domain-containing protein vs. Ensembl Human
Match: HSP90AB1 (heat shock protein 90 alpha family class B member 1 [Source:HGNC Symbol;Acc:HGNC:5258])

HSP 1 Score: 80.4925 bits (197), Expect = 1.663e-18
Identity = 40/84 (47.62%), Postives = 55/84 (65.48%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAK 254
            +R+ +S S +  TSL++YVSRMK TQ  I++I G S   V  S  VE + K+ +EV+Y+ EPIDEY  Q L EF+GK   +V K
Sbjct:  455 LRYHTSQSGDEMTSLSEYVSRMKETQKSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTK 538          
BLAST of HATPase_c domain-containing protein vs. Ensembl Human
Match: HSP90AB1 (heat shock protein 90 alpha family class B member 1 [Source:HGNC Symbol;Acc:HGNC:5258])

HSP 1 Score: 80.4925 bits (197), Expect = 1.663e-18
Identity = 40/84 (47.62%), Postives = 55/84 (65.48%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAK 254
            +R+ +S S +  TSL++YVSRMK TQ  I++I G S   V  S  VE + K+ +EV+Y+ EPIDEY  Q L EF+GK   +V K
Sbjct:  455 LRYHTSQSGDEMTSLSEYVSRMKETQKSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTK 538          
BLAST of HATPase_c domain-containing protein vs. Ensembl Celegans
Match: enpl-1 (Endoplasmin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q22235])

HSP 1 Score: 103.99 bits (258), Expect = 4.115e-27
Identity = 48/86 (55.81%), Postives = 63/86 (73.26%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEG 260
            +RF SS+  +  T+LA YV RMK  QD I+++AG S  +V+ SP VE L+ K YEVL+L E +DEY  Q++PE+E KKFQNVAKEG
Sbjct:  415 LRFQSSNDADKTTTLAAYVERMKEKQDAIYYMAGTSRKEVETSPFVERLIAKGYEVLFLTEAVDEYCIQAMPEYESKKFQNVAKEG 500          
BLAST of HATPase_c domain-containing protein vs. Ensembl Celegans
Match: enpl-1 (Endoplasmin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q22235])

HSP 1 Score: 103.99 bits (258), Expect = 4.115e-27
Identity = 48/86 (55.81%), Postives = 63/86 (73.26%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEG 260
            +RF SS+  +  T+LA YV RMK  QD I+++AG S  +V+ SP VE L+ K YEVL+L E +DEY  Q++PE+E KKFQNVAKEG
Sbjct:  415 LRFQSSNDADKTTTLAAYVERMKEKQDAIYYMAGTSRKEVETSPFVERLIAKGYEVLFLTEAVDEYCIQAMPEYESKKFQNVAKEG 500          
BLAST of HATPase_c domain-containing protein vs. Ensembl Celegans
Match: enpl-1 (Endoplasmin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q22235])

HSP 1 Score: 103.99 bits (258), Expect = 4.115e-27
Identity = 48/86 (55.81%), Postives = 63/86 (73.26%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEG 260
            +RF SS+  +  T+LA YV RMK  QD I+++AG S  +V+ SP VE L+ K YEVL+L E +DEY  Q++PE+E KKFQNVAKEG
Sbjct:  415 LRFQSSNDADKTTTLAAYVERMKEKQDAIYYMAGTSRKEVETSPFVERLIAKGYEVLFLTEAVDEYCIQAMPEYESKKFQNVAKEG 500          
BLAST of HATPase_c domain-containing protein vs. Ensembl Celegans
Match: enpl-1 (Endoplasmin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q22235])

HSP 1 Score: 103.99 bits (258), Expect = 4.115e-27
Identity = 48/86 (55.81%), Postives = 63/86 (73.26%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEG 260
            +RF SS+  +  T+LA YV RMK  QD I+++AG S  +V+ SP VE L+ K YEVL+L E +DEY  Q++PE+E KKFQNVAKEG
Sbjct:  415 LRFQSSNDADKTTTLAAYVERMKEKQDAIYYMAGTSRKEVETSPFVERLIAKGYEVLFLTEAVDEYCIQAMPEYESKKFQNVAKEG 500          
BLAST of HATPase_c domain-containing protein vs. Ensembl Celegans
Match: enpl-1 (Endoplasmin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q22235])

HSP 1 Score: 103.99 bits (258), Expect = 4.115e-27
Identity = 48/86 (55.81%), Postives = 63/86 (73.26%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEG 260
            +RF SS+  +  T+LA YV RMK  QD I+++AG S  +V+ SP VE L+ K YEVL+L E +DEY  Q++PE+E KKFQNVAKEG
Sbjct:  415 LRFQSSNDADKTTTLAAYVERMKEKQDAIYYMAGTSRKEVETSPFVERLIAKGYEVLFLTEAVDEYCIQAMPEYESKKFQNVAKEG 500          
BLAST of HATPase_c domain-containing protein vs. Ensembl Fly
Match: Gp93 (gene:FBgn0039562 transcript:FBtr0085254)

HSP 1 Score: 104.76 bits (260), Expect = 2.716e-27
Identity = 50/87 (57.47%), Postives = 66/87 (75.86%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGF 263
            +RF +S+ +   TSLA+Y  RMK  Q+ I++IAG + ++V+ SP VE LL K YEVLYL+E +DEY   +LPEF+GKKFQNVAKEGF
Sbjct:  508 LRFQTSNGK-GVTSLAEYKERMKAKQEHIYYIAGANRAEVEKSPFVERLLSKGYEVLYLVEAVDEYCISALPEFDGKKFQNVAKEGF 593          
BLAST of HATPase_c domain-containing protein vs. Ensembl Fly
Match: Hsp83 (gene:FBgn0001233 transcript:FBtr0332873)

HSP 1 Score: 82.0333 bits (201), Expect = 2.002e-19
Identity = 41/87 (47.13%), Postives = 55/87 (63.22%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGF 263
            +RF +S S +   SLADYVSRMK  Q  ++FI G S   V  S  VE +  + +EV+Y+ EPIDEY  Q L E++GK+  +V KEG 
Sbjct:  448 LRFHTSASGDDFCSLADYVSRMKDNQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPIDEYVIQHLKEYKGKQLVSVTKEGL 534          
BLAST of HATPase_c domain-containing protein vs. Ensembl Fly
Match: Hsp83 (gene:FBgn0001233 transcript:FBtr0073040)

HSP 1 Score: 82.0333 bits (201), Expect = 2.002e-19
Identity = 41/87 (47.13%), Postives = 55/87 (63.22%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGF 263
            +RF +S S +   SLADYVSRMK  Q  ++FI G S   V  S  VE +  + +EV+Y+ EPIDEY  Q L E++GK+  +V KEG 
Sbjct:  448 LRFHTSASGDDFCSLADYVSRMKDNQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPIDEYVIQHLKEYKGKQLVSVTKEGL 534          
BLAST of HATPase_c domain-containing protein vs. Ensembl Zebrafish
Match: hsp90b1 (heat shock protein 90, beta (grp94), member 1 [Source:ZFIN;Acc:ZDB-GENE-031002-1])

HSP 1 Score: 113.62 bits (283), Expect = 2.861e-30
Identity = 53/86 (61.63%), Postives = 65/86 (75.58%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEG 260
            +RF +SHS    +SL  YV RMK  QDKI+F+AG S  + + SP VE LLKK YEV+YL EP+DEY  Q+LPEF+GK+FQNVAKEG
Sbjct:  510 LRFQTSHSDTVLSSLEQYVERMKEKQDKIYFMAGTSRKEAESSPFVEKLLKKGYEVVYLTEPVDEYCIQALPEFDGKRFQNVAKEG 595          
BLAST of HATPase_c domain-containing protein vs. Ensembl Zebrafish
Match: hsp90b1 (heat shock protein 90, beta (grp94), member 1 [Source:ZFIN;Acc:ZDB-GENE-031002-1])

HSP 1 Score: 113.62 bits (283), Expect = 3.014e-30
Identity = 53/86 (61.63%), Postives = 65/86 (75.58%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEG 260
            +RF +SHS    +SL  YV RMK  QDKI+F+AG S  + + SP VE LLKK YEV+YL EP+DEY  Q+LPEF+GK+FQNVAKEG
Sbjct:  511 LRFQTSHSDTVLSSLEQYVERMKEKQDKIYFMAGTSRKEAESSPFVEKLLKKGYEVVYLTEPVDEYCIQALPEFDGKRFQNVAKEG 596          
BLAST of HATPase_c domain-containing protein vs. Ensembl Zebrafish
Match: hsp90aa1.1 (heat shock protein 90, alpha (cytosolic), class A member 1, tandem duplicate 1 [Source:NCBI gene;Acc:30591])

HSP 1 Score: 85.1149 bits (209), Expect = 2.483e-20
Identity = 42/87 (48.28%), Postives = 55/87 (63.22%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGF 263
            +R+++S S +   SL DYVSRMK TQ  I++I G +   V  S  VE L K   EV+Y+IEPIDEY  Q L E++GK   +V KEG 
Sbjct:  456 LRYYTSASGDEMVSLKDYVSRMKDTQKHIYYITGETKDQVANSAFVERLRKAGLEVIYMIEPIDEYCVQQLKEYDGKNLVSVTKEGL 542          
BLAST of HATPase_c domain-containing protein vs. Ensembl Zebrafish
Match: hsp90aa1.1 (heat shock protein 90, alpha (cytosolic), class A member 1, tandem duplicate 1 [Source:NCBI gene;Acc:30591])

HSP 1 Score: 85.1149 bits (209), Expect = 2.483e-20
Identity = 42/87 (48.28%), Postives = 55/87 (63.22%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGF 263
            +R+++S S +   SL DYVSRMK TQ  I++I G +   V  S  VE L K   EV+Y+IEPIDEY  Q L E++GK   +V KEG 
Sbjct:  456 LRYYTSASGDEMVSLKDYVSRMKDTQKHIYYITGETKDQVANSAFVERLRKAGLEVIYMIEPIDEYCVQQLKEYDGKNLVSVTKEGL 542          
BLAST of HATPase_c domain-containing protein vs. Ensembl Zebrafish
Match: hsp90ab1 (heat shock protein 90, alpha (cytosolic), class A member 1, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-031001-3])

HSP 1 Score: 85.1149 bits (209), Expect = 2.790e-20
Identity = 42/87 (48.28%), Postives = 55/87 (63.22%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGF 263
            +R+ SS S +  TSL +YVSRMK  Q  I++I G S   V  S  VE + K+ +EVLY+ EPIDEY  Q L +F+GK   +V KEG 
Sbjct:  454 LRYQSSQSGDEMTSLTEYVSRMKENQKSIYYITGESKDQVAHSAFVERVCKRGFEVLYMTEPIDEYCVQQLKDFDGKSLVSVTKEGL 540          
BLAST of HATPase_c domain-containing protein vs. Ensembl Xenopus
Match: hsp90b1 (heat shock protein 90kDa beta (Grp94), member 1 [Source:NCBI gene;Acc:734089])

HSP 1 Score: 119.013 bits (297), Expect = 5.275e-32
Identity = 56/87 (64.37%), Postives = 68/87 (78.16%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGF 263
            +RF SS+++   TSL  YV RMK  QDKI+FIAG S  +V+ SP VE LLKK YEVL+LIEP+DEY  Q+LPEF+GK+FQNVAKEG 
Sbjct:  482 LRFQSSNNKSETTSLEQYVERMKEKQDKIYFIAGASRKEVESSPFVERLLKKGYEVLFLIEPVDEYCIQALPEFDGKRFQNVAKEGL 568          
BLAST of HATPase_c domain-containing protein vs. Ensembl Xenopus
Match: hsp90b1 (heat shock protein 90kDa beta (Grp94), member 1 [Source:NCBI gene;Acc:734089])

HSP 1 Score: 118.627 bits (296), Expect = 5.983e-32
Identity = 56/87 (64.37%), Postives = 68/87 (78.16%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGF 263
            +RF SS+++   TSL  YV RMK  QDKI+FIAG S  +V+ SP VE LLKK YEVL+LIEP+DEY  Q+LPEF+GK+FQNVAKEG 
Sbjct:  480 LRFQSSNNKSETTSLEQYVERMKEKQDKIYFIAGASRKEVESSPFVERLLKKGYEVLFLIEPVDEYCIQALPEFDGKRFQNVAKEGL 566          
BLAST of HATPase_c domain-containing protein vs. Ensembl Xenopus
Match: hsp90b1 (heat shock protein 90kDa beta (Grp94), member 1 [Source:NCBI gene;Acc:734089])

HSP 1 Score: 118.627 bits (296), Expect = 6.766e-32
Identity = 56/87 (64.37%), Postives = 68/87 (78.16%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGF 263
            +RF SS+++   TSL  YV RMK  QDKI+FIAG S  +V+ SP VE LLKK YEVL+LIEP+DEY  Q+LPEF+GK+FQNVAKEG 
Sbjct:  509 LRFQSSNNKSETTSLEQYVERMKEKQDKIYFIAGASRKEVESSPFVERLLKKGYEVLFLIEPVDEYCIQALPEFDGKRFQNVAKEGL 595          
BLAST of HATPase_c domain-containing protein vs. Ensembl Xenopus
Match: hsp90b1 (heat shock protein 90kDa beta (Grp94), member 1 [Source:NCBI gene;Acc:734089])

HSP 1 Score: 118.627 bits (296), Expect = 7.165e-32
Identity = 56/87 (64.37%), Postives = 68/87 (78.16%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGF 263
            +RF SS+++   TSL  YV RMK  QDKI+FIAG S  +V+ SP VE LLKK YEVL+LIEP+DEY  Q+LPEF+GK+FQNVAKEG 
Sbjct:  502 LRFQSSNNKSETTSLEQYVERMKEKQDKIYFIAGASRKEVESSPFVERLLKKGYEVLFLIEPVDEYCIQALPEFDGKRFQNVAKEGL 588          
BLAST of HATPase_c domain-containing protein vs. Ensembl Xenopus
Match: hsp90b1 (heat shock protein 90kDa beta (Grp94), member 1 [Source:NCBI gene;Acc:734089])

HSP 1 Score: 118.242 bits (295), Expect = 8.443e-32
Identity = 56/87 (64.37%), Postives = 68/87 (78.16%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGF 263
            +RF SS+++   TSL  YV RMK  QDKI+FIAG S  +V+ SP VE LLKK YEVL+LIEP+DEY  Q+LPEF+GK+FQNVAKEG 
Sbjct:  511 LRFQSSNNKSETTSLEQYVERMKEKQDKIYFIAGASRKEVESSPFVERLLKKGYEVLFLIEPVDEYCIQALPEFDGKRFQNVAKEGL 597          
BLAST of HATPase_c domain-containing protein vs. Ensembl Mouse
Match: Hsp90b1 (heat shock protein 90, beta (Grp94), member 1 [Source:MGI Symbol;Acc:MGI:98817])

HSP 1 Score: 113.235 bits (282), Expect = 5.316e-31
Identity = 54/86 (62.79%), Postives = 64/86 (74.42%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEG 260
            +RF SSH     TSL  YV RMK  QDKI+F+AG S  + + SP VE LLKK YEV+YL EP+DEY  Q+LPEF+GK+FQNVAKEG
Sbjct:  186 LRFQSSHHSTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEG 271          
BLAST of HATPase_c domain-containing protein vs. Ensembl Mouse
Match: Hsp90b1 (heat shock protein 90, beta (Grp94), member 1 [Source:MGI Symbol;Acc:MGI:98817])

HSP 1 Score: 113.62 bits (283), Expect = 2.916e-30
Identity = 54/86 (62.79%), Postives = 64/86 (74.42%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEG 260
            +RF SSH     TSL  YV RMK  QDKI+F+AG S  + + SP VE LLKK YEV+YL EP+DEY  Q+LPEF+GK+FQNVAKEG
Sbjct:  510 LRFQSSHHSTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEG 595          
BLAST of HATPase_c domain-containing protein vs. Ensembl Mouse
Match: Hsp90ab1 (heat shock protein 90 alpha (cytosolic), class B member 1 [Source:MGI Symbol;Acc:MGI:96247])

HSP 1 Score: 80.4925 bits (197), Expect = 1.153e-18
Identity = 40/84 (47.62%), Postives = 55/84 (65.48%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAK 254
            +R+ +S S +  TSL++YVSRMK TQ  I++I G S   V  S  VE + K+ +EV+Y+ EPIDEY  Q L EF+GK   +V K
Sbjct:  455 LRYHTSQSGDEMTSLSEYVSRMKETQKSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTK 538          
BLAST of HATPase_c domain-containing protein vs. Ensembl Mouse
Match: Hsp90aa1 (heat shock protein 90, alpha (cytosolic), class A member 1 [Source:MGI Symbol;Acc:MGI:96250])

HSP 1 Score: 79.337 bits (194), Expect = 2.935e-18
Identity = 40/84 (47.62%), Postives = 51/84 (60.71%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAK 254
            +R+++S S +   SL DY +RMK  Q  I+FI G +   V  S  VE L K   EV+Y+IEPIDEY  Q L EFEGK   +V K
Sbjct:  464 LRYYTSASGDEMVSLKDYCTRMKENQKHIYFITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTK 547          
BLAST of HATPase_c domain-containing protein vs. Ensembl Mouse
Match: Hsp90aa1 (heat shock protein 90, alpha (cytosolic), class A member 1 [Source:MGI Symbol;Acc:MGI:96250])

HSP 1 Score: 79.337 bits (194), Expect = 2.935e-18
Identity = 40/84 (47.62%), Postives = 51/84 (60.71%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAK 254
            +R+++S S +   SL DY +RMK  Q  I+FI G +   V  S  VE L K   EV+Y+IEPIDEY  Q L EFEGK   +V K
Sbjct:  464 LRYYTSASGDEMVSLKDYCTRMKENQKHIYFITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTK 547          
BLAST of HATPase_c domain-containing protein vs. UniProt/SwissProt
Match: sp|P08110|ENPL_CHICK (Endoplasmin OS=Gallus gallus OX=9031 GN=HSP90B1 PE=1 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.849e-30
Identity = 54/86 (62.79%), Postives = 66/86 (76.74%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEG 260
            +RF SSH + + TSL  YV RMK  QDKI+F+AG S  + + SP VE LLKK YEV+YL EP+DEY  Q+LPEF+GK+FQNVAKEG
Sbjct:  509 LRFQSSHHESNLTSLDQYVERMKEKQDKIYFMAGASRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEG 594          
BLAST of HATPase_c domain-containing protein vs. UniProt/SwissProt
Match: sp|P08712|ENPL_MESAU (Endoplasmin (Fragment) OS=Mesocricetus auratus OX=10036 GN=HSP90B1 PE=1 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 2.725e-30
Identity = 54/86 (62.79%), Postives = 64/86 (74.42%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEG 260
            +RF SSH     TSL  YV RMK  QDKI+F+AG S  + + SP VE LLKK YEV+YL EP+DEY  Q+LPEF+GK+FQNVAKEG
Sbjct:  107 LRFQSSHHSTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEG 192          
BLAST of HATPase_c domain-containing protein vs. UniProt/SwissProt
Match: sp|Q95M18|ENPL_BOVIN (Endoplasmin OS=Bos taurus OX=9913 GN=HSP90B1 PE=2 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 5.941e-30
Identity = 54/86 (62.79%), Postives = 64/86 (74.42%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEG 260
            +RF SSH     TSL  YV RMK  QDKI+F+AG S  + + SP VE LLKK YEV+YL EP+DEY  Q+LPEF+GK+FQNVAKEG
Sbjct:  510 LRFQSSHHPSDMTSLDQYVERMKEKQDKIYFMAGASRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEG 595          
BLAST of HATPase_c domain-containing protein vs. UniProt/SwissProt
Match: sp|O18750|ENPL_RABIT (Endoplasmin (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=HSP90B1 PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 1.937e-29
Identity = 54/86 (62.79%), Postives = 64/86 (74.42%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEG 260
            +RF SSH     TSL  YV RMK  QDKI+F+AG S  + + SP VE LLKK YEV+YL EP+DEY  Q+LPEF+GK+FQNVAKEG
Sbjct:  429 LRFQSSHHPTDITSLDQYVERMKEKQDKIYFMAGASRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEG 514          
BLAST of HATPase_c domain-containing protein vs. UniProt/SwissProt
Match: sp|P08113|ENPL_MOUSE (Endoplasmin OS=Mus musculus OX=10090 GN=Hsp90b1 PE=1 SV=2)

HSP 1 Score: 113.62 bits (283), Expect = 2.040e-29
Identity = 54/86 (62.79%), Postives = 64/86 (74.42%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEG 260
            +RF SSH     TSL  YV RMK  QDKI+F+AG S  + + SP VE LLKK YEV+YL EP+DEY  Q+LPEF+GK+FQNVAKEG
Sbjct:  510 LRFQSSHHSTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEG 595          
BLAST of HATPase_c domain-containing protein vs. TrEMBL
Match: A0A2R4NBU5 (Heat shock protein 902 OS=Dugesia japonica OX=6161 GN=hsp902 PE=2 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 3.593e-44
Identity = 73/87 (83.91%), Postives = 82/87 (94.25%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGF 263
            ++FWSSHS+E+ TSL+DY+SRMKP QDKIFFIAGVSL+DVQLSPMVE LLK QYEVLYLIEP+DEYT QS+PEFEGKKFQNVAKEGF
Sbjct:  522 LKFWSSHSEENLTSLSDYISRMKPNQDKIFFIAGVSLADVQLSPMVETLLKDQYEVLYLIEPVDEYTLQSIPEFEGKKFQNVAKEGF 608          
BLAST of HATPase_c domain-containing protein vs. TrEMBL
Match: A0A3M6TBK7 (HATPase_c domain-containing protein OS=Pocillopora damicornis OX=46731 GN=pdam_00012456 PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.603e-31
Identity = 60/87 (68.97%), Postives = 71/87 (81.61%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGF 263
            +RF+SS+S++  TSLADY+ RMK  QD I+F+AG S  +V+ SP VE LLKK YEVLYLIEP+DEY  QSLPEFEGKKFQNVAKEG 
Sbjct:  566 LRFFSSNSEKDMTSLADYLERMKEKQDAIYFMAGTSRKEVESSPFVERLLKKGYEVLYLIEPVDEYCIQSLPEFEGKKFQNVAKEGL 652          
BLAST of HATPase_c domain-containing protein vs. TrEMBL
Match: T2MGW5 (Endoplasmin (Fragment) OS=Hydra vulgaris OX=6087 GN=HSP90B1 PE=2 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 2.375e-31
Identity = 61/87 (70.11%), Postives = 69/87 (79.31%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGF 263
            +RF SS+  E  TSLADY+ RMK  QD IFF+AG SL +V+ SP VE LL+K YEVLYLIEP+DEY  QSLPEFEGKKFQNVAKEG 
Sbjct:  545 LRFRSSNDPEKMTSLADYLGRMKDKQDVIFFMAGASLEEVKNSPFVERLLRKGYEVLYLIEPVDEYCIQSLPEFEGKKFQNVAKEGL 631          
BLAST of HATPase_c domain-containing protein vs. TrEMBL
Match: A5LGG7 (Glucose-regulated protein 94 OS=Crassostrea gigas OX=29159 GN=GRP94 PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 5.732e-31
Identity = 59/87 (67.82%), Postives = 70/87 (80.46%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGF 263
            +RF+SS+S   QTSL DYV RMK  Q+ I+F+AG S S+V+ SP VE LLKK YEVL+L+EP+DEY  QSLPEFEGKKFQNVAKEG 
Sbjct:  512 LRFYSSNSDTEQTSLPDYVERMKEKQEAIYFVAGTSRSEVEKSPFVERLLKKGYEVLFLVEPVDEYCIQSLPEFEGKKFQNVAKEGL 598          
BLAST of HATPase_c domain-containing protein vs. TrEMBL
Match: T1RTR8 (Tumor rejection antigen (Fragment) OS=Carassius auratus OX=7957 PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 8.873e-31
Identity = 53/86 (61.63%), Postives = 66/86 (76.74%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEG 260
            +RF +SHS  + +SL  YV RMK  QDKI+F+AG S  + + SP VE LLKK YEV+YL EP+DEY  Q+LPEF+GK+FQNVAKEG
Sbjct:   51 LRFQTSHSDTTPSSLEQYVERMKEKQDKIYFMAGTSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEG 136          
BLAST of HATPase_c domain-containing protein vs. Ensembl Cavefish
Match: hsp90b1 (heat shock protein 90, beta (grp94), member 1 [Source:ZFIN;Acc:ZDB-GENE-031002-1])

HSP 1 Score: 114.39 bits (285), Expect = 1.327e-30
Identity = 53/86 (61.63%), Postives = 66/86 (76.74%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEG 260
            +RF +SHS+   +SL  YV RMK  QDKI+F+AG S  + + SP VE LLKK YEV+YL EP+DEY  Q+LPEF+GK+FQNVAKEG
Sbjct:  505 LRFQTSHSETVLSSLEQYVERMKEKQDKIYFMAGTSRKEAESSPFVEKLLKKGYEVVYLTEPVDEYCIQALPEFDGKRFQNVAKEG 590          
BLAST of HATPase_c domain-containing protein vs. Ensembl Cavefish
Match: hsp90aa1.2 (Astyanax mexicanus heat shock protein HSP 90-alpha 1-like (LOC103024454), mRNA. [Source:RefSeq mRNA;Acc:NM_001291257])

HSP 1 Score: 84.7297 bits (208), Expect = 3.195e-20
Identity = 41/87 (47.13%), Postives = 56/87 (64.37%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGF 263
            +R+++S+S +   SL DYVSRMK +Q  I++I G +   V  S  VE L K   EV+Y+IEPIDEY  Q L E++GK   +V KEG 
Sbjct:  454 LRYYTSNSGDEMVSLKDYVSRMKDSQKHIYYITGETKDQVANSAFVERLRKAGLEVIYMIEPIDEYCVQQLKEYDGKNLLSVTKEGL 540          
BLAST of HATPase_c domain-containing protein vs. Ensembl Cavefish
Match: hsp90aa1.2 (Astyanax mexicanus heat shock protein HSP 90-alpha 1-like (LOC103024454), mRNA. [Source:RefSeq mRNA;Acc:NM_001291257])

HSP 1 Score: 84.7297 bits (208), Expect = 3.195e-20
Identity = 41/87 (47.13%), Postives = 56/87 (64.37%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGF 263
            +R+++S+S +   SL DYVSRMK +Q  I++I G +   V  S  VE L K   EV+Y+IEPIDEY  Q L E++GK   +V KEG 
Sbjct:  454 LRYYTSNSGDEMVSLKDYVSRMKDSQKHIYYITGETKDQVANSAFVERLRKAGLEVIYMIEPIDEYCVQQLKEYDGKNLLSVTKEGL 540          
BLAST of HATPase_c domain-containing protein vs. Ensembl Cavefish
Match: hsp90ab1 (heat shock protein 90 alpha family class B member 1 [Source:NCBI gene;Acc:103047517])

HSP 1 Score: 84.3445 bits (207), Expect = 4.405e-20
Identity = 42/87 (48.28%), Postives = 56/87 (64.37%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGF 263
            +R+ SS S +  TSL++Y+SRMK  Q  I++I G S   V  S  VE + K+ +EVLY+ EPIDEY  Q L EF+GK   +V KEG 
Sbjct:  455 LRYHSSQSGDEMTSLSEYLSRMKENQKSIYYITGESKDQVANSAFVERVRKRGFEVLYMTEPIDEYCVQQLKEFDGKTLVSVTKEGL 541          
BLAST of HATPase_c domain-containing protein vs. Ensembl Cavefish
Match: hsp90aa1.2 (Astyanax mexicanus heat shock protein HSP 90-alpha 1-like (LOC103024454), mRNA. [Source:RefSeq mRNA;Acc:NM_001291257])

HSP 1 Score: 81.6481 bits (200), Expect = 4.083e-19
Identity = 41/84 (48.81%), Postives = 53/84 (63.10%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAK 254
            +R+++S S +   SL DYV+RMK TQ  I++I G +   V  S  VE L K   EV+Y+IEPIDEY  Q L EFEGK   +V K
Sbjct:  462 LRYYTSASGDEMVSLKDYVTRMKDTQKHIYYITGETKDQVANSAFVERLRKAGLEVIYMIEPIDEYCVQQLKEFEGKNLVSVTK 545          
BLAST of HATPase_c domain-containing protein vs. Ensembl Sea Lamprey
Match: hsp90b1 (heat shock protein 90, beta (grp94), member 1 [Source:ZFIN;Acc:ZDB-GENE-031002-1])

HSP 1 Score: 81.6481 bits (200), Expect = 8.082e-20
Identity = 40/70 (57.14%), Postives = 50/70 (71.43%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQS 212
            +RF SS+  +  TSL +YV RMK  QDKI+FIAG +  +V+ SP VE LLKK YEVL+L E +DEY  QS
Sbjct:  487 LRFQSSYGTDKLTSLEEYVERMKEKQDKIYFIAGANRKEVESSPFVERLLKKGYEVLFLTEAVDEYCIQS 556          
BLAST of HATPase_c domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003399.1 (pep scaffold:Pmarinus_7.0:GL479675:6143:15195:1 gene:ENSPMAG00000002912.1 transcript:ENSPMAT00000003399.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.1814 bits (191), Expect = 1.345e-18
Identity = 40/87 (45.98%), Postives = 53/87 (60.92%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGF 263
            +R+ +S + E   SL +YVSRMK  Q  I++I G S   V  S  VE + K+  EV+Y+ EPIDEY  Q L EF+GK   +V KEG 
Sbjct:  433 LRYHTSVTGEDVCSLKEYVSRMKENQKHIYYITGESKEQVSNSAFVERVRKRGLEVVYMTEPIDEYCVQQLKEFDGKTLVSVTKEGL 519          
BLAST of HATPase_c domain-containing protein vs. Ensembl Yeast
Match: HSC82 (Cytoplasmic chaperone of the Hsp90 family; plays a role in determining prion variants; redundant in function and nearly identical with Hsp82p, and together they are essential; expressed constitutively at 10-fold higher basal levels than HSP82 and induced 2-3 fold by heat shock; contains two acid-rich unstructured regions that promote the solubility of chaperone-substrate complexes; HSC82 has a paralog, HSP82, that arose from the whole genome duplication [Source:SGD;Acc:S000004798])

HSP 1 Score: 80.4925 bits (197), Expect = 1.241e-19
Identity = 39/85 (45.88%), Postives = 55/85 (64.71%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKE 257
            +R+ S+ S +  TSL DYV+RM   Q  I++I G SL  V+ SP ++ L  K +EVL+L +PIDEY F  L EFEGK   ++ K+
Sbjct:  439 LRYNSTKSVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKD 523          
BLAST of HATPase_c domain-containing protein vs. Ensembl Yeast
Match: HSP82 (Hsp90 chaperone; redundant in function with Hsc82p; required for pheromone signaling, negative regulation of Hsf1p; docks with Tom70p for mitochondrial preprotein delivery; promotes telomerase DNA binding, nucleotide addition; protein abundance increases in response to DNA replication stress; contains two acid-rich unstructured regions that promote solubility of chaperone-substrate complexes; HSP82 has a paralog, HSC82, that arose from the whole genome duplication [Source:SGD;Acc:S000006161])

HSP 1 Score: 80.4925 bits (197), Expect = 1.253e-19
Identity = 39/85 (45.88%), Postives = 55/85 (64.71%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKE 257
            +R+ S+ S +  TSL DYV+RM   Q  I++I G SL  V+ SP ++ L  K +EVL+L +PIDEY F  L EFEGK   ++ K+
Sbjct:  443 LRYNSTKSVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKD 527          
BLAST of HATPase_c domain-containing protein vs. Ensembl Nematostella
Match: EDO45344 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT97])

HSP 1 Score: 120.939 bits (302), Expect = 2.038e-33
Identity = 57/87 (65.52%), Postives = 71/87 (81.61%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGF 263
            +RF+SS+S++  TSLA+Y+ RMK  QD I+F+AG +  +V+ SP VE LLK+ YEVLYLIEP+DEY  QSLPEFEGKKFQNVAKEG 
Sbjct:  526 LRFYSSNSEKDMTSLAEYIERMKEKQDVIYFMAGHNRKEVESSPFVEKLLKEGYEVLYLIEPVDEYCMQSLPEFEGKKFQNVAKEGL 612          
BLAST of HATPase_c domain-containing protein vs. Ensembl Nematostella
Match: HSP90 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ66])

HSP 1 Score: 87.0409 bits (214), Expect = 1.933e-21
Identity = 43/87 (49.43%), Postives = 56/87 (64.37%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGF 263
            +R+ SS S +  TSL DYV+RMK  Q  I+FI G S   V  S  VE +  + +EVLY++EPIDEY  Q L E++GKK  +V KEG 
Sbjct:  457 LRYHSSSSGDELTSLKDYVTRMKENQKDIYFITGESKDQVSHSAFVERVKSRGFEVLYMVEPIDEYAIQQLKEYDGKKLVSVTKEGL 543          
BLAST of HATPase_c domain-containing protein vs. Ensembl Nematostella
Match: EDO45666 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS03])

HSP 1 Score: 46.2098 bits (108), Expect = 3.800e-7
Identity = 24/65 (36.92%), Postives = 35/65 (53.85%), Query Frame = 3
Query:   39 TSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGK 233
            T+L  YVSRMKPTQ K++++   S    + SP  E L +   EVL+     D+     L ++E K
Sbjct:  409 TNLPAYVSRMKPTQKKVYYLCAPSRDLAETSPYYETLKQNDVEVLFSYNEQDDVVLHYLRKYENK 473          
BLAST of HATPase_c domain-containing protein vs. Ensembl Medaka
Match: hsp90b1 (heat shock protein 90 beta family member 1 [Source:NCBI gene;Acc:101166123])

HSP 1 Score: 112.079 bits (279), Expect = 7.658e-30
Identity = 52/86 (60.47%), Postives = 65/86 (75.58%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEG 260
            +RF +S+S+    SL  YV RMK  QDKI+F+AG S  + + SP VE LLKK YEV+YL EP+DEY  Q+LPEF+GK+FQNVAKEG
Sbjct:  514 LRFQTSNSETGLASLEQYVERMKEKQDKIYFMAGTSRKEAESSPFVEKLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEG 599          
BLAST of HATPase_c domain-containing protein vs. Ensembl Medaka
Match: hsp90ab1 (heat shock protein 90 alpha family class B member 1 [Source:NCBI gene;Acc:100125466])

HSP 1 Score: 84.3445 bits (207), Expect = 3.710e-20
Identity = 42/87 (48.28%), Postives = 55/87 (63.22%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGF 263
            +R+ SS S +  TSL +Y+SRMK  Q  I++I G S   V  S  VE + K+ +EVLY+ EPIDEY  Q L EF+GK   +V KEG 
Sbjct:  452 LRYHSSQSGDEMTSLTEYLSRMKENQKSIYYITGESKDQVANSAFVERVRKRGFEVLYMTEPIDEYCVQQLKEFDGKNLVSVTKEGL 538          
BLAST of HATPase_c domain-containing protein vs. Ensembl Medaka
Match: hsp90ab1 (heat shock protein 90 alpha family class B member 1 [Source:NCBI gene;Acc:100125466])

HSP 1 Score: 84.3445 bits (207), Expect = 4.043e-20
Identity = 42/87 (48.28%), Postives = 55/87 (63.22%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGF 263
            +R+ SS S +  TSL +Y+SRMK  Q  I++I G S   V  S  VE + K+ +EVLY+ EPIDEY  Q L EF+GK   +V KEG 
Sbjct:  452 LRYHSSQSGDEMTSLTEYLSRMKENQKSIYYITGESKDQVANSAFVERVRKRGFEVLYMTEPIDEYCVQQLKEFDGKNLVSVTKEGL 538          
BLAST of HATPase_c domain-containing protein vs. Ensembl Medaka
Match: hsp90aa1.2 (heat shock protein HSP 90-alpha [Source:NCBI gene;Acc:101169506])

HSP 1 Score: 78.5666 bits (192), Expect = 4.432e-18
Identity = 39/84 (46.43%), Postives = 52/84 (61.90%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAK 254
            +R+++S S +   SL DYVSRMK  Q  I++I G +   V  S  VE L K   EV+Y+IEPIDEY  Q L +F+GK   +V K
Sbjct:  455 LRYYTSASGDEMVSLKDYVSRMKDNQKHIYYITGETKDQVANSAFVERLRKAGLEVIYMIEPIDEYCVQQLKDFDGKNLVSVTK 538          
BLAST of HATPase_c domain-containing protein vs. Ensembl Medaka
Match: hsp90aa1.2 (heat shock protein HSP 90-alpha [Source:NCBI gene;Acc:101169506])

HSP 1 Score: 77.7962 bits (190), Expect = 9.190e-18
Identity = 38/84 (45.24%), Postives = 52/84 (61.90%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAK 254
            +R+++S S +   SL DYV+RMK  Q  I++I G +   V  S  VE L K   EV+Y+IEPIDEY  Q L +F+GK   +V K
Sbjct:  455 LRYYTSASGDEMVSLKDYVTRMKDNQKHIYYITGETKDQVANSAFVERLRKAGLEVIYMIEPIDEYCVQQLKDFDGKNLVSVTK 538          
BLAST of HATPase_c domain-containing protein vs. Planmine SMEST
Match: SMESG000054819.1 (SMESG000054819.1)

HSP 1 Score: 181.8 bits (460), Expect = 8.357e-55
Identity = 87/87 (100.00%), Postives = 87/87 (100.00%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGF 263
            IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGF
Sbjct:  515 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGF 601          
BLAST of HATPase_c domain-containing protein vs. Planmine SMEST
Match: SMESG000041107.1 (SMESG000041107.1)

HSP 1 Score: 112.464 bits (280), Expect = 4.437e-30
Identity = 50/86 (58.14%), Postives = 68/86 (79.07%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEG 260
            +RFW+SH+ + Q++L DYVSRMK  Q+ I++IAG S  D+  SP+VE +LKK +EV+Y+I+P+DEY  QSL EFEGKK QN+ KEG
Sbjct:  511 LRFWTSHNDKKQSTLTDYVSRMKEKQEVIYYIAGHSKDDLIKSPLVEKVLKKGFEVVYMIDPVDEYVVQSLTEFEGKKMQNLGKEG 596          
BLAST of HATPase_c domain-containing protein vs. Planmine SMEST
Match: SMESG000071533.1 (SMESG000071533.1)

HSP 1 Score: 88.5817 bits (218), Expect = 9.122e-22
Identity = 43/87 (49.43%), Postives = 58/87 (66.67%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGF 263
            +RF+S+ S E  TSL DY+SRMK  Q  I++I G S  +V  S  VE L K+ +EVL +++PIDEY+ Q L E++GKK   V KEG 
Sbjct:  447 LRFYSTSSGEEMTSLKDYISRMKENQKDIYYITGESKDNVIHSAFVERLTKRGFEVLLMVDPIDEYSVQQLKEYDGKKLVCVTKEGL 533          
BLAST of HATPase_c domain-containing protein vs. Planmine SMEST
Match: SMESG000071531.1 (SMESG000071531.1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.663e-21
Identity = 42/87 (48.28%), Postives = 58/87 (66.67%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGF 263
            +RF+S+ S E  TSL DY++RMK  Q  I++I G S  +V  S  VE L K+ +EVL +++PIDEY+ Q L E++GKK   V KEG 
Sbjct:  428 LRFYSTSSGEEMTSLKDYITRMKENQKDIYYITGESKDNVIHSAFVERLTKRGFEVLLMVDPIDEYSVQQLKEYDGKKLVCVTKEGL 514          
BLAST of HATPase_c domain-containing protein vs. Planmine SMEST
Match: SMESG000024822.1 (SMESG000024822.1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.652e-20
Identity = 42/84 (50.00%), Postives = 56/84 (66.67%), Query Frame = 3
Query:    3 IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAK 254
            +R+ S+ S E  TSL DY+SRMK  Q  I++I G S  +V  S  VE L K+ +EVLY+I+PIDEY+ Q L E++GKK   V K
Sbjct:  446 LRYHSTSSGEEMTSLKDYLSRMKENQKDIYYITGESKDNVAHSAFVERLTKRGFEVLYMIDPIDEYSVQQLKEYDGKKLVCVTK 529          
The following BLAST results are available for this feature:
BLAST of HATPase_c domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HSP90B17.108e-3062.79heat shock protein 90 beta family member 1 [Source... [more]
HSP90AB11.663e-1847.62heat shock protein 90 alpha family class B member ... [more]
HSP90AB11.663e-1847.62heat shock protein 90 alpha family class B member ... [more]
HSP90AB11.663e-1847.62heat shock protein 90 alpha family class B member ... [more]
HSP90AB11.663e-1847.62heat shock protein 90 alpha family class B member ... [more]
back to top
BLAST of HATPase_c domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
enpl-14.115e-2755.81Endoplasmin homolog [Source:UniProtKB/Swiss-Prot;... [more]
enpl-14.115e-2755.81Endoplasmin homolog [Source:UniProtKB/Swiss-Prot;... [more]
enpl-14.115e-2755.81Endoplasmin homolog [Source:UniProtKB/Swiss-Prot;... [more]
enpl-14.115e-2755.81Endoplasmin homolog [Source:UniProtKB/Swiss-Prot;... [more]
enpl-14.115e-2755.81Endoplasmin homolog [Source:UniProtKB/Swiss-Prot;... [more]
back to top
BLAST of HATPase_c domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Gp932.716e-2757.47gene:FBgn0039562 transcript:FBtr0085254[more]
Hsp832.002e-1947.13gene:FBgn0001233 transcript:FBtr0332873[more]
Hsp832.002e-1947.13gene:FBgn0001233 transcript:FBtr0073040[more]
back to top
BLAST of HATPase_c domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp90b12.861e-3061.63heat shock protein 90, beta (grp94), member 1 [Sou... [more]
hsp90b13.014e-3061.63heat shock protein 90, beta (grp94), member 1 [Sou... [more]
hsp90aa1.12.483e-2048.28heat shock protein 90, alpha (cytosolic), class A ... [more]
hsp90aa1.12.483e-2048.28heat shock protein 90, alpha (cytosolic), class A ... [more]
hsp90ab12.790e-2048.28heat shock protein 90, alpha (cytosolic), class A ... [more]
back to top
BLAST of HATPase_c domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp90b15.275e-3264.37heat shock protein 90kDa beta (Grp94), member 1 [S... [more]
hsp90b15.983e-3264.37heat shock protein 90kDa beta (Grp94), member 1 [S... [more]
hsp90b16.766e-3264.37heat shock protein 90kDa beta (Grp94), member 1 [S... [more]
hsp90b17.165e-3264.37heat shock protein 90kDa beta (Grp94), member 1 [S... [more]
hsp90b18.443e-3264.37heat shock protein 90kDa beta (Grp94), member 1 [S... [more]
back to top
BLAST of HATPase_c domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hsp90b15.316e-3162.79heat shock protein 90, beta (Grp94), member 1 [Sou... [more]
Hsp90b12.916e-3062.79heat shock protein 90, beta (Grp94), member 1 [Sou... [more]
Hsp90ab11.153e-1847.62heat shock protein 90 alpha (cytosolic), class B m... [more]
Hsp90aa12.935e-1847.62heat shock protein 90, alpha (cytosolic), class A ... [more]
Hsp90aa12.935e-1847.62heat shock protein 90, alpha (cytosolic), class A ... [more]
back to top
BLAST of HATPase_c domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P08110|ENPL_CHICK1.849e-3062.79Endoplasmin OS=Gallus gallus OX=9031 GN=HSP90B1 PE... [more]
sp|P08712|ENPL_MESAU2.725e-3062.79Endoplasmin (Fragment) OS=Mesocricetus auratus OX=... [more]
sp|Q95M18|ENPL_BOVIN5.941e-3062.79Endoplasmin OS=Bos taurus OX=9913 GN=HSP90B1 PE=2 ... [more]
sp|O18750|ENPL_RABIT1.937e-2962.79Endoplasmin (Fragment) OS=Oryctolagus cuniculus OX... [more]
sp|P08113|ENPL_MOUSE2.040e-2962.79Endoplasmin OS=Mus musculus OX=10090 GN=Hsp90b1 PE... [more]
back to top
BLAST of HATPase_c domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2R4NBU53.593e-4483.91Heat shock protein 902 OS=Dugesia japonica OX=6161... [more]
A0A3M6TBK71.603e-3168.97HATPase_c domain-containing protein OS=Pocillopora... [more]
T2MGW52.375e-3170.11Endoplasmin (Fragment) OS=Hydra vulgaris OX=6087 G... [more]
A5LGG75.732e-3167.82Glucose-regulated protein 94 OS=Crassostrea gigas ... [more]
T1RTR88.873e-3161.63Tumor rejection antigen (Fragment) OS=Carassius au... [more]
back to top
BLAST of HATPase_c domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp90b11.327e-3061.63heat shock protein 90, beta (grp94), member 1 [Sou... [more]
hsp90aa1.23.195e-2047.13Astyanax mexicanus heat shock protein HSP 90-alpha... [more]
hsp90aa1.23.195e-2047.13Astyanax mexicanus heat shock protein HSP 90-alpha... [more]
hsp90ab14.405e-2048.28heat shock protein 90 alpha family class B member ... [more]
hsp90aa1.24.083e-1948.81Astyanax mexicanus heat shock protein HSP 90-alpha... [more]
back to top
BLAST of HATPase_c domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hsp90b18.082e-2057.14heat shock protein 90, beta (grp94), member 1 [Sou... [more]
ENSPMAT00000003399.11.345e-1845.98pep scaffold:Pmarinus_7.0:GL479675:6143:15195:1 ge... [more]
back to top
BLAST of HATPase_c domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
HSC821.241e-1945.88Cytoplasmic chaperone of the Hsp90 family; plays a... [more]
HSP821.253e-1945.88Hsp90 chaperone; redundant in function with Hsc82p... [more]
back to top
BLAST of HATPase_c domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO453442.038e-3365.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
HSP901.933e-2149.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO456663.800e-736.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of HATPase_c domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp90b17.658e-3060.47heat shock protein 90 beta family member 1 [Source... [more]
hsp90ab13.710e-2048.28heat shock protein 90 alpha family class B member ... [more]
hsp90ab14.043e-2048.28heat shock protein 90 alpha family class B member ... [more]
hsp90aa1.24.432e-1846.43heat shock protein HSP 90-alpha [Source:NCBI gene;... [more]
hsp90aa1.29.190e-1845.24heat shock protein HSP 90-alpha [Source:NCBI gene;... [more]
back to top
BLAST of HATPase_c domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000054819.18.357e-55100.00SMESG000054819.1[more]
SMESG000041107.14.437e-3058.14SMESG000041107.1[more]
SMESG000071533.19.122e-2249.43SMESG000071533.1[more]
SMESG000071531.11.663e-2148.28SMESG000071531.1[more]
SMESG000024822.11.652e-2050.00SMESG000024822.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020593 ID=SMED30020593|Name=HATPase_c domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=319bp
TAATTCGGTTTTGGTCGTCACATTCTCAAGAAAGTCAAACATCTCTCGCT
GACTACGTTTCGAGGATGAAACCAACTCAAGACAAAATATTTTTTATTGC
CGGAGTATCTTTGAGTGATGTCCAGCTGTCACCAATGGTGGAAATACTCT
TGAAAAAACAATATGAAGTCCTTTATTTAATCGAACCGATCGATGAGTAC
ACTTTTCAATCATTACCGGAATTTGAAGGAAAGAAATTTCAAAACGTTGC
AAAAGAAGGCTTCAAACTGGACGATTCTGACAAAAAAATAGAAATCAAAG
AAAAGTTGGAGAAAGAATA
back to top

protein sequence of SMED30020593-orf-1

>SMED30020593-orf-1 ID=SMED30020593-orf-1|Name=SMED30020593-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=105bp
IRFWSSHSQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILL
KKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGFKLDDSDKKIEIKE
KLEKE
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR001404Hsp90_fam
IPR020568Ribosomal_S5_D2-typ_fold
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0051082unfolded protein binding
Vocabulary: biological process
TermDefinition
GO:0006457protein folding
GO:0006950response to stress
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001404Heat shock protein Hsp90 familyPFAMPF00183HSP90coord: 1..104
e-value: 3.2E-37
score: 128.6
IPR001404Heat shock protein Hsp90 familyPANTHERPTHR11528HEAT SHOCK PROTEIN 90 FAMILY MEMBERcoord: 1..105
NoneNo IPR availableGENE3DG3DSA:3.40.50.11260coord: 3..95
e-value: 1.2E-32
score: 113.6
NoneNo IPR availablePANTHERPTHR11528:SF96ENDOPLASMINcoord: 1..105
IPR020568Ribosomal protein S5 domain 2-type foldSUPERFAMILYSSF54211Ribosomal protein S5 domain 2-likecoord: 1..85