G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30020589
Length (bp)1401
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30020589) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30020589) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30020589) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30020589) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020589

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30020589SMESG000061638.1 SmedASXL_064934SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30020589SMESG000061638.1 SmedASXL_004784SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30020589SMESG000061638.1 dd_Smed_v6_33870_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30020589SMESG000061638.1 dd_Smed_v6_21674_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A267FSD8 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025013g6 PE=4 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.794e-33
Identity = 121/374 (32.35%), Postives = 198/374 (52.94%), Query Frame = 3
Query:  231 IVSSNQCHIHLP---SDNSDPP-FLKYFYYMKATFSLLGLMFNIISMIYFATVNRYKIFNLLLLHLSCVEVIFCSSGFIFEVTYYWYAAKHN----ILSYTWQAKFIIYLVYFWLWVVYKSSLLARNWITAVVAWQRYRAISHPLSTKQYETYKSISMILFIMYFLVILFSIPRAFEKSYYLCEKDVYIITMNNSIYYTDLYKNIYNPLYXXXXXXXXXXXXXXCSLSMLIVLKKRQENLNNL----TSQPSRFSKYKQKXXXXXXXXXXXXXXXXKTVIILCAAFTICELPACIAGIMLNVSTDMSIWKILSYFVGIAMVLTSVDSLLDFFIYFYSIVHFRQAISQVLLFKKVSVNQSQYVSRSVDESKMLRK 1316
            IV  N      P   +DN      L   Y++K   +++GLM N++S+  F +  R  +F  ++ +LSC EV F S G  FE+ Y    + ++    I S    A+F+IYLV   +W++YKSSL+ RNWI  ++AW+RYRAIS  LS+++ ++ +S  + L ++  L  L + PRAFE +Y+LC +   I+ +  + +      + Y  L+F L+SP+P++ ++V S  M   L+      N L    ++  S     +  +S       S+  ++N+TV++LC +F +CELP  IAGI+ +        K+   F G+A  LTS+DS  +F +Y  SI  FR  +      +  S  +     RS +ES  LR+
Sbjct:   17 IVHGNCTEPQTPLFHADNGPTQVMLDSLYFIKCIAAMIGLMVNLVSIKVFLSFKRRSLFISMIFYLSCCEVCFNSCGLSFELFYLLVGSTNSHLMPIGSSLAVAQFLIYLVCQVVWIIYKSSLILRNWIIVLIAWRRYRAISASLSSQRSQSRRSFRLSLLLIGLLAALLTTPRAFELAYFLCAESRQIVRLAPAAFAHSRRYSAYPKLFFVLTSPMPIVCLLVISTLMTCSLRAAANTANVLQVPISNSVSSTRDRESTNSTSMRHRRSQSDAVNRTVLVLCGSFVLCELPMLIAGIIKDFECGDHCMKV-HVFSGVANTLTSMDSFANFVVYVVSIPSFRNKL------RPCSAGE----QRSREESVQLRR 379          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A1I8HVZ0 (Phosphodiesterase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 3.306e-18
Identity = 81/234 (34.62%), Postives = 132/234 (56.41%), Query Frame = 3
Query:  531 YLVYFWLWVVYKSSLLARNWITAVVAWQRYRAISHPLST-KQYETYKSISMILFIMYFLVILFSIPRAFEKSYYLCEKDVYIITMNNSIYYTDLYKNIYNPLYXXXXXXXXXXXXXXCSLSMLIVLKKRQENLNNLTSQPSRFSKYKQKXXXXXXXXXXXXXXXXKTVIILCAAFTICELPACIAGIMLNVSTDMSIWKILSYFVGIAMVLTSVDSLLDFFIYFYSIVHFRQAI 1229
            YL+   +WVVYK+SL+ RNWI  V+AW+RYRAI   L+  +     +S+ + L  +  L  L + PR+ E +YYLC +   ++ +  + + +    ++Y  ++F  +SPLP++ ++V S  ML  L+      N+  +Q             G + S  R  S+N+TV +LCA F +CELP  +AG++ +   +      L  F+GIA +LTS+DSL +F +YF+SI  FR  +
Sbjct:    1 YLLCQAVWVVYKASLILRNWIIVVIAWRRYRAIRASLNGYRSGPGRRSLRLSLLCLGVLAALLTAPRSLEVAYYLCVESRQLVRVAVAGFASSRGYSVYPKIFFVATSPLPIVCLLVISFLMLCSLR------NSTDAQ-----LLHGGGGSGGSGSGGRCDSVNRTVQVLCATFVLCELPMLVAGVVKDADCNEHCPH-LQVFMGIANILTSLDSLANFGVYFFSIRAFRHKL 222          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A3S5ANT6 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS27551 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 5.277e-11
Identity = 47/143 (32.87%), Postives = 71/143 (49.65%), Query Frame = 3
Query:  390 IFNLLLLHLSCVEVIFCSSGFIFEVTYYWY---AAKHNILSYTWQAKFIIYLVYFWLWVVYKSSLLARNWITAVVAWQRYRAISHPLSTKQYETYKSISM-ILFIMYFLVILFSIPRAFEKSYYLC-----EKDVYIITMNNS 791
            IF+L+L HLS VE++   SGF+FE  Y+       +  +      A F+   V    W+VYK+SLLARNW+ A +AW+R   +  P    +    +S +   L  +Y    + +  RA E+ Y++C      KDV  I    S
Sbjct:  245 IFSLMLCHLSAVEMVCGLSGFLFETVYFSTIVLGDESPVFLSPRLAYFLALGVLQLDWIVYKASLLARNWVIAFIAWRRLCVVHDPFQAHRKALRRSAATGCLLTLYLTACILTTIRALEQVYFVCLNETVSKDVEAIAGGRS 387          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A193KUG9 (GCR049 OS=Schmidtea mediterranea OX=79327 GN=gcr049 PE=2 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 3.612e-7
Identity = 77/312 (24.68%), Postives = 154/312 (49.36%), Query Frame = 3
Query:  390 IFNLLLLHLSCVEVIFCSSGFIFEVTYYWYAAKHNILSYTWQAKFIIYLVYFWLWVVYKSSLLARNWITAVVAWQRYRAISHPLSTKQYETYKSISMILFIMYFLVILFSIPRAFEKSYYLCEKDVYIITMNNSIYYTDLYKNIYNPLYXXXXXXXXXXXXXXCSLSMLIVLKKRQENLNNLTSQPSRFSKYKQKXXXXXXXXXXXXXXXXKTVIILCAAFTICELPACIAGIMLNVSTDMSIWKILSYFVGIAMVLTSVDSLLDFFIYFYSIVHFRQAISQVL--LFKKVSVNQSQYVSRSVDESKMLRKP 1319
            + N +L   S +E+IF  +  +F +  Y    ++ I+S  +    I+  ++  +++     L+ARN    ++A+ R+  I +PL TK+Y T  +I+   F +    IL + PR FE++Y  C +   ++ ++ ++     Y+ +Y  ++ FL      L+ +   LS+L++ K RQ    +LT + +  +  ++K          +  + +K V+ LC  F   E+P+  + +  N S  +S  KI+ +   IA +   +DS ++  IY  S   FR A+ Q +  +  K +V+ ++Y++ +  E K    P
Sbjct:   59 LMNQILARFSFIELIFQMTLLLFYLVEYMKIDEY-IISSRFVNPGIMDALFRCIYLFSVGFLIARNSWIILLAFHRFECICYPLRTKRYVTSANINFYFFGIVSFAILIAFPRMFEQTYTYCLQTGDVVNVSEALSNVYQYRIVYLNVFVFLIQIGIPLLSVNI-LSILMLRKIRQ----SLTFRRTSAAPNQKK----------KSFAADKLVVALCITFFTFEMPSFFSKLFHN-SHIISNDKIIYHLTFIANISIYIDSSMNLLIYLVSNRIFRGAVLQQISKVSHKKTVSTTKYLTIAKKEEKQFISP 353          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000061638.1 (SMESG000061638.1)

HSP 1 Score: 613.609 bits (1581), Expect = 0.000e+0
Identity = 341/341 (100.00%), Postives = 341/341 (100.00%), Query Frame = 3
Query:  309 MKATFSLLGLMFNIISMIYFATVNRYKIFNLLLLHLSCVEVIFCSSGFIFEVTYYWYAAKHNILSYTWQAKFIIYLVYFWLWVVYKSSLLARNWITAVVAWQRYRAISHPLSTKQYETYKSISMILFIMYFLVILFSIPRAFEKSYYLCEKDVYIITMNNSIYYTDLYKNIYNPLYXXXXXXXXXXXXXXCSLSMLIVLKKRQENLNNLTSQPSRFSKYKQKXXXXXXXXXXXXXXXXKTVIILCAAFTICELPACIAGIMLNVSTDMSIWKILSYFVGIAMVLTSVDSLLDFFIYFYSIVHFRQAISQVLLFKKVSVNQSQYVSRSVDESKMLRKPSNSV 1331
            MKATFSLLGLMFNIISMIYFATVNRYKIFNLLLLHLSCVEVIFCSSGFIFEVTYYWYAAKHNILSYTWQAKFIIYLVYFWLWVVYKSSLLARNWITAVVAWQRYRAISHPLSTKQYETYKSISMILFIMYFLVILFSIPRAFEKSYYLCEKDVYIITMNNSIYYTDLYKNIYNPLYFFLSSPLPLLVIIVCSLSMLIVLKKRQENLNNLTSQPSRFSKYKQKSSLGNNSSNSRGQSINKTVIILCAAFTICELPACIAGIMLNVSTDMSIWKILSYFVGIAMVLTSVDSLLDFFIYFYSIVHFRQAISQVLLFKKVSVNQSQYVSRSVDESKMLRKPSNSV
Sbjct:    1 MKATFSLLGLMFNIISMIYFATVNRYKIFNLLLLHLSCVEVIFCSSGFIFEVTYYWYAAKHNILSYTWQAKFIIYLVYFWLWVVYKSSLLARNWITAVVAWQRYRAISHPLSTKQYETYKSISMILFIMYFLVILFSIPRAFEKSYYLCEKDVYIITMNNSIYYTDLYKNIYNPLYFFLSSPLPLLVIIVCSLSMLIVLKKRQENLNNLTSQPSRFSKYKQKSSLGNNSSNSRGQSINKTVIILCAAFTICELPACIAGIMLNVSTDMSIWKILSYFVGIAMVLTSVDSLLDFFIYFYSIVHFRQAISQVLLFKKVSVNQSQYVSRSVDESKMLRKPSNSV 341          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000013334.1 (SMESG000013334.1)

HSP 1 Score: 157.147 bits (396), Expect = 2.279e-43
Identity = 111/319 (34.80%), Postives = 172/319 (53.92%), Query Frame = 3
Query:  303 YYMKATFSLLGLMFNIISMIYFATVNRYKIFNLLLLHLSCVEVIFCSSGFIFEVTYYWYAAKHNILSYTWQAKFIIYLVYFWLWVVYKSSLLARNWITAVVAWQRYRAISHPLSTKQYETYKSISMILFIMYFLVILFSIPRAFEKSY-YLCEKDVYIIT---MNNSIY---YTDLYKNIYNPLYXXXXXXXXXXXXXXCSLSMLIVLKKRQENLNNLTSQPSRFSKYKQKXXXXXXXXXXXXXXXXKTVIILCAAFTICELPACIAGIMLNV---STDMSIWKILSYFVGIAMVLTSVDSLLDFFIYFYSIVHFRQAI 1229
            Y +K T SL G + N+ +  +F    +   F  +L HLS VE+IF  SG +FE  Y+                FIIYLV+ ++W++YKSSLL+RNW+  ++AW+RY+AI  PLS+KQ  + K I  ++F +Y + +    PR FE +Y Y  E    IIT   + NSIY   Y  L+  + +P+           V ++C  S+ ++   R+   + L ++   F   ++++   +        S NKTV++LC  FT CE P C+AGI   +   ST +     L++F G+A +LTS DS+ +F IYF S   F+Q+I
Sbjct:   25 YKIKITVSLFGFVLNLWAFSFFHRFEKQSHFCFMLKHLSLVELIFSLSGVVFECFYFTLVVLQRPFPKVL-VNFIIYLVFNFMWLMYKSSLLSRNWVIVLIAWRRYQAIHRPLSSKQLLSKKLIQYLIFGIYAISLFLVTPRLFEITYSYSNETKNVIITPYLLVNSIYLSTYPILFFILISPV----------PVCVICFYSIFMLRSLRKPECHELETRSDHF---QRQNPTISRRIARNRSSSNKTVLVLCTVFTTCEFPMCLAGIFNQISRESTGVQFQWFLTHFAGVANILTSCDSIFNFVIYFISFPFFKQSI 329          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000074473.1 (SMESG000074473.1)

HSP 1 Score: 70.0922 bits (170), Expect = 9.490e-13
Identity = 85/349 (24.36%), Postives = 160/349 (45.85%), Query Frame = 3
Query:  201 FTLKSDQFINIVSSNQCHIHLPSDNSDPPFLKYFYYMKATFSLLGLMFNIISMIYFATVNRYKIFNLLLLHLSCVEVIFCSSGFIFEVTYYWYAAKH--NILSYTWQAKFIIYLVYFWLWVVYKSSLLARNWITAVVAWQRYRAISHPLSTKQYETYKSISMILFIMYFLVILFSIPRAFEKSYYLCEKDVYIITMNNSIYYTDLYKNIYNPLYXXXXXXXXXXXXXXCSLSMLIVLKKRQENLNNLTSQPSRFSKYKQKXXXXXXXXXXXXXXXXKTVIILCAAFTICELPACIAGIMLNVST----DMSIWKILSYFVGIAMVLTSVDSLLDFFIYFYSIVHFRQAI 1229
            FTLK  + I I S   C    P  + + P L          S++ L+ N  S+  F    +  +  + L+ LS  E +F S   +  ++  + +AK+  N     W   +I   +     V+    + ARNW   +++  R  A+ +PL +++   +  I  I F   F+ I+FSI R  + +  +C    Y +T +N  +++    +++  +YF L + +P + +I  ++ M+IVL +     + L S P   S+  QK                +TV++L   F++CELP  I+  ++N++     D +  + L         L  +DS+ +FF+Y  S+ +FR+ +
Sbjct:   10 FTLK--EVIVIYSDRNCS--KPQISQEKPVLNAIQINFLCLSIIALILNSFSLFVFWHQPKLSMMRVTLILLSISETLFHSFLILNFISLEFLSAKYFLNETPSYWHL-YIAPRISAATMVILHVFISARNWCNLIISMSRTEAVLYPLKSRRLFRHSMIYFIYFFTTFVAIVFSILRHLDFAVTICISSQYYVTESN--FFSSKTTSVFLIIYFILQTGIPWVSVITSTVIMIIVLGRFHS--DQLLSNP--VSQRNQK-------------VAIRTVLLLAIIFSLCELPNLISSFIMNLNNFLNYDFTKRETLEILSNAGNTLVILDSVFNFFVYVTSLPYFRRKL 334          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000004763.1 (SMESG000004763.1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.093e-10
Identity = 78/312 (25.00%), Postives = 154/312 (49.36%), Query Frame = 3
Query:  390 IFNLLLLHLSCVEVIFCSSGFIFEVTYYWYAAKHNILSYTWQAKFIIYLVYFWLWVVYKSSLLARNWITAVVAWQRYRAISHPLSTKQYETYKSISMILFIMYFLVILFSIPRAFEKSYYLCEKDVYIITMNNSIYYTDLYKNIYNPLYXXXXXXXXXXXXXXCSLSMLIVLKKRQENLNNLTSQPSRFSKYKQKXXXXXXXXXXXXXXXXKTVIILCAAFTICELPACIAGIMLNVSTDMSIWKILSYFVGIAMVLTSVDSLLDFFIYFYSIVHFRQAISQVL--LFKKVSVNQSQYVSRSVDESKMLRKP 1319
            + N +L   S +E+IF  +  +F +  Y    ++ I+S  +    I+  ++  +++     L+ARN    ++A+ R+  I +PL TK+Y T  +I+   F +    IL + PR FE++Y  C +   ++ ++ ++     Y+ IY  ++ FL      L+ +   LS+L++ K RQ    +LT + +  +  ++K          +  + +K V+ LC  F   E+P+  + +  N S  +S  KI+ +   IA +   +DS ++  IY  S   FR A+ Q +  +  K +V+ ++Y++ +  E K    P
Sbjct:   80 LMNQILARFSFIELIFQMTLLLFYLVEYIKIDEY-IISSRFVNPGIMDALFRCIYLFSVGFLIARNSWIILLAFHRFECICYPLRTKRYVTSANINFYFFGIVSFAILIAFPRMFEQTYTYCLQTGDVVNVSEALSNVYQYRIIYLNVFVFLIQIGIPLLSVNI-LSILMLRKIRQ----SLTFRRTSAAPNQKK----------KSFAADKLVVALCITFFTFEMPSFFSKLFHN-SHIISNDKIIYHLTFIANISIYIDSSMNLLIYLVSNRIFRGAVLQQISKVSHKKTVSTTKYLTIAKKEEKQFISP 374          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000023730.1 (SMESG000023730.1)

HSP 1 Score: 62.3882 bits (150), Expect = 3.867e-10
Identity = 81/319 (25.39%), Postives = 152/319 (47.65%), Query Frame = 3
Query:  327 LLGLMFNIISM-IYFATVNRYKIFNLLLLHLSCVEVIFCSSGFIFEVTYYW-YAAKHNILSYTWQAKFIIYLVYFWLWVVYKSSLLARNWITAVVAWQRYRAISHPLSTKQYETYKSISMILFIMYFLVILFSIPRAFEKSYYLCEKDVYIITMNNSIYYTDLYKNIY-NPLYXXXXXXXXXXXXXXCSLSMLIVLKKRQENLNNLTSQPSRFSKYKQKXXXXXXXXXXXXXXXXKTVIILCAAFTICELPACIAGIMLN--VSTDMSIWKILSYFVGIAMVLTSVDSLLDFFIYFYSIVHFRQAISQVLLFKKVSVNQ 1268
            ++ ++FN   + I+F  + +  I ++LL +LS  E++F  SGF++ VT +  Y + +      W   FI+ +  F +     S L+ RNW    +A  R+ +I  PL+TK+  T  S   +L+I Y L  + + PR FE     CE +   + +  S+   D Y   Y   L F + +  P++   + S+S++  + K +           RF K   K+    N++ S        +I +C AF + E P+  +  + +  +  +  I  +L     +A +L  +DS+++ F+Y  S   FR+ + Q+  FK  ++ +
Sbjct:  277 IISIIFNGFCLFIFFDKIWKKSILSILLKYLSATEIVFNISGFLYSVTKFIDYPSINQFSKLFWV--FILQIGTFSV----ASGLICRNWTILHLAIYRFDSICRPLNTKKIYTETSTYKLLWITYILAAVIAFPRTFEYKATFCEGN---LVLKPSLLNYDWYAYGYQGSLIFIIQTAAPVVCTSILSISVMRAILKVK-----------RFRKSFSKTIKTKNNAISGDAL----MIFICLAFFLFETPSFFSKALQSYLMRNNKIIEDVL--LATVANLLVYLDSVINIFVYILSNPVFRKKLKQIFHFKAFNLKE 569          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 4
Match NameE-valueIdentityDescription
A0A267FSD81.794e-3332.35G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A1I8HVZ03.306e-1834.62Phosphodiesterase OS=Macrostomum lignano OX=282301... [more]
A0A3S5ANT65.277e-1132.87G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A193KUG93.612e-724.68GCR049 OS=Schmidtea mediterranea OX=79327 GN=gcr04... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061638.10.000e+0100.00SMESG000061638.1[more]
SMESG000013334.12.279e-4334.80SMESG000013334.1[more]
SMESG000074473.19.490e-1324.36SMESG000074473.1[more]
SMESG000004763.11.093e-1025.00SMESG000004763.1[more]
SMESG000023730.13.867e-1025.39SMESG000023730.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020589 ID=SMED30020589|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1401bp
CGTCCACATAACGAAGAAATTTTATTATTAACACAAATTAGTGTAGGTGT
CTTAGTCATTCATTTAAAATTCTAAACAAGCTATGAAAATAGTTTGAATT
TTGGAGAAATTTTTTAATTATTAACGTGTTATTATTAAATCATTTGTGGA
CGAATTACTTTACGATCGGAAAGTATATGAATTCAAAAGGTTCAAAAGAT
TTTACTCTTAAATCTGATCAGTTTATCAACATAGTTTCGTCCAACCAATG
TCATATTCACCTACCTTCCGATAATTCGGATCCACCGTTTTTAAAATATT
TCTACTATATGAAGGCTACATTTAGTTTACTTGGACTAATGTTTAACATA
ATCTCTATGATATATTTTGCTACAGTTAATCGGTATAAAATATTCAATCT
GCTCCTCTTACATTTATCTTGTGTCGAAGTGATTTTCTGTTCCAGTGGAT
TTATTTTTGAAGTAACTTATTATTGGTATGCGGCAAAGCACAATATCTTA
TCCTATACATGGCAAGCTAAATTTATCATATATTTGGTGTATTTTTGGCT
ATGGGTTGTATACAAATCCTCCCTACTCGCTAGAAATTGGATCACTGCCG
TAGTAGCTTGGCAGAGATATCGCGCAATCAGCCATCCATTATCAACCAAA
CAATATGAAACATACAAATCTATTTCAATGATCCTTTTTATTATGTATTT
TCTTGTTATATTATTTTCAATACCGAGAGCATTTGAAAAGAGTTATTATT
TGTGCGAAAAAGATGTTTATATTATCACAATGAATAATTCAATCTATTAT
ACAGATTTGTATAAGAATATTTACAATCCTTTGTATTTTTTCCTATCTTC
TCCTTTACCTTTACTCGTAATTATTGTTTGTAGTTTGTCTATGCTTATAG
TTTTGAAAAAGAGACAGGAAAATCTTAACAATCTCACGTCTCAACCGTCG
AGATTTTCAAAATATAAACAGAAATCGTCTTTGGGAAACAACAGTTCCAA
TAGTCGTGGTCAGTCAATTAATAAAACTGTGATAATTTTATGTGCAGCAT
TTACAATATGCGAACTTCCTGCTTGTATAGCAGGGATCATGTTGAATGTA
TCAACGGACATGTCAATTTGGAAAATATTAAGTTATTTCGTTGGTATCGC
TATGGTGTTGACAAGTGTTGACTCGTTGTTGGATTTTTTTATTTACTTTT
ATTCAATTGTTCATTTCCGGCAAGCGATTTCACAAGTTTTATTGTTCAAA
AAGGTGTCAGTCAATCAATCTCAATATGTGTCCAGGAGTGTTGACGAATC
CAAGATGTTGAGAAAACCTTCAAATTCGGTGTAAATACAACATATCGAAA
CTCATATTGTTTTTATAATTGTTATTTATTGTTTATGTAATTAACTCGGT
G
back to top

protein sequence of SMED30020589-orf-1

>SMED30020589-orf-1 ID=SMED30020589-orf-1|Name=SMED30020589-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=386bp
MNSKGSKDFTLKSDQFINIVSSNQCHIHLPSDNSDPPFLKYFYYMKATFS
LLGLMFNIISMIYFATVNRYKIFNLLLLHLSCVEVIFCSSGFIFEVTYYW
YAAKHNILSYTWQAKFIIYLVYFWLWVVYKSSLLARNWITAVVAWQRYRA
ISHPLSTKQYETYKSISMILFIMYFLVILFSIPRAFEKSYYLCEKDVYII
TMNNSIYYTDLYKNIYNPLYFFLSSPLPLLVIIVCSLSMLIVLKKRQENL
NNLTSQPSRFSKYKQKSSLGNNSSNSRGQSINKTVIILCAAFTICELPAC
IAGIMLNVSTDMSIWKILSYFVGIAMVLTSVDSLLDFFIYFYSIVHFRQA
ISQVLLFKKVSVNQSQYVSRSVDESKMLRKPSNSV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 61..340
e-value: 2.5E-12
score: 46.7
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 41..363
e-value: 7.7E-34
score: 119.0
NoneNo IPR availablePANTHERPTHR46641FAMILY NOT NAMEDcoord: 47..375
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 41..351
e-value: 6.01224E-21
score: 89.9996
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 30..368
NoneNo IPR availableTMHMMTMhelixcoord: 165..182
NoneNo IPR availableTMHMMTMhelixcoord: 109..128
NoneNo IPR availableTMHMMTMhelixcoord: 72..94
NoneNo IPR availableTMHMMTMhelixcoord: 43..65
NoneNo IPR availableTMHMMTMhelixcoord: 321..343
NoneNo IPR availableTMHMMTMhelixcoord: 221..243
NoneNo IPR availableTMHMMTMhelixcoord: 284..306
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 56..340
score: 20.452