slc17a-2

Overview
Nameslc17a-2 (AKN21525.1)
Smed IDSMED30020588
Length (bp)1652
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc17a-2 (SMED30020588) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc17a-2 (SMED30020588) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020588

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30020588SMESG000032477.1 SmedASXL_010376SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30020588SMESG000032477.1 dd_Smed_v6_15146_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc17a-2 vs. Ensembl Human
Match: SLC17A6 (solute carrier family 17 member 6 [Source:HGNC Symbol;Acc:HGNC:16703])

HSP 1 Score: 228.409 bits (581), Expect = 7.365e-67
Identity = 134/464 (28.88%), Postives = 236/464 (50.86%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI--ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQST 1498
            C C    +RY++A +  LG  I  G+R  +   I ++ N S   +H    +I    E  K  W +P     +  + F+ Y+I    GGY+     ++ +FG+++ +T  +N+ +P    +          +I +RILQGL EG   PA  G+   W P  ERS +   S  G   G +I +P+   +    GW  VFY+Y + G++W +FW  +  E P K  ++++ E+ ++ +SI   + +L    + K PW+    S P+YAI+       WTF +  +   +Y+   +   I K   L + P L  ++ VPIGG +AD +  K   S T +RK++   GFG++    + +G++     A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  +   + W+    +AA   +  +  Y  F S +++ WA +P +++
Sbjct:   62 CTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNST--IHRGGKVI---KEKAKFNW-DPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGC------VIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVFLIAALVHYGGVIFYAIFASGEKQPWA-DPEETS 512          
BLAST of slc17a-2 vs. Ensembl Human
Match: SLC17A8 (solute carrier family 17 member 8 [Source:HGNC Symbol;Acc:HGNC:20151])

HSP 1 Score: 219.55 bits (558), Expect = 1.807e-63
Identity = 135/461 (29.28%), Postives = 230/461 (49.89%), Query Frame = 2
Query:  116 CCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI-ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQS 1495
            CCG   KRY++A +  LG  I  G+R  +   I  + N S   +  K  +     +  +  W +P     +  + F+ Y++    GG+++    ++ +FG+++ +T  +N+F+P    +          ++ +RILQGL EG   PA  G+   W P  ERS +   S  G   G ++ +P+   +    GW  VFYIY   G+IW +FW     E P    ++SN EK ++  SI E   +    +   PWK    S P+YAI+       WTF +  +   +Y+   +  +I K   L + P +  ++ VPIGG LAD +  +   + T +RK++   GFG++    + +GF+  +  A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  H   + W+    +AA   +  +  Y  F S +++ WA   N S
Sbjct:   69 CCGL-PKRYIIAIMSGLGFCISFGIRCNLGVAIVEMVNNSTVYVDGKPEI-----QTAQFNW-DPETVGLIHGSFFWGYIMTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIPSAARVHYGC------VMCVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYIGWSSVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNEEKTYIETSIGEGANVVSLSKFSTPWKRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPHMVMTIVVPIGGQLADYLRSRQILTTTAVRKIMNCGGFGMEATLLLVVGFSHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTRHKTREEWQNVFLIAALVHYSGVIFYGVFASGEKQEWADPENLS 516          
BLAST of slc17a-2 vs. Ensembl Human
Match: SLC17A7 (solute carrier family 17 member 7 [Source:HGNC Symbol;Acc:HGNC:16704])

HSP 1 Score: 218.009 bits (554), Expect = 3.698e-63
Identity = 128/462 (27.71%), Postives = 232/462 (50.22%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI--ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQ 1492
            C C    +RY++A +  LG  I  G+R  +   I ++ N S T  H    ++ + ++     W +P     +  + F+ Y++    GG++     ++ +FG ++  T  +N+ +P    +          +I +RILQGL EG   PA  G+   W P  ERS +   +  G   G ++ +P+   +    GW  VFY+Y + G+ W +FW  +  E P    S+S  E+ ++  +I   +K++N   +   PW+    S P+YAI+       WTF +  +   +Y+   +   I K   + + P L  ++ VPIGG +AD +  +   S T++RKL+   GFG++    + +G++  +  A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  H   + W+    +A+   +  +  Y  F S +++ WA EP +
Sbjct:   54 CTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTT--HRGGHVVVQKAQ---FSW-DPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGC------VIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPLTKFSTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWA-EPEE 502          
BLAST of slc17a-2 vs. Ensembl Human
Match: SLC17A7 (solute carrier family 17 member 7 [Source:HGNC Symbol;Acc:HGNC:16704])

HSP 1 Score: 207.223 bits (526), Expect = 8.887e-60
Identity = 123/448 (27.46%), Postives = 224/448 (50.00%), Query Frame = 2
Query:  155 LCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI--ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQ 1492
            +  LG  I  G+R  +   I ++ N S T  H    ++ + ++     W +P     +  + F+ Y++    GG++     ++ +FG ++  T  +N+ +P    +          +I +RILQGL EG   PA  G+   W P  ERS +   +  G   G ++ +P+   +    GW  VFY+Y + G+ W +FW  +  E P    S+S  E+ ++  +I   +K++N   +   PW+    S P+YAI+       WTF +  +   +Y+   +   I K   + + P L  ++ VPIGG +AD +  +   S T++RKL+   GFG++    + +G++  +  A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  H   + W+    +A+   +  +  Y  F S +++ WA EP +
Sbjct:    1 MSGLGFCISFGIRCNLGVAIVSMVNNSTT--HRGGHVVVQKAQ---FSW-DPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGC------VIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPLTKFSTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWA-EPEE 435          
BLAST of slc17a-2 vs. Ensembl Human
Match: SLC17A5 (solute carrier family 17 member 5 [Source:HGNC Symbol;Acc:HGNC:10933])

HSP 1 Score: 182.956 bits (463), Expect = 1.064e-50
Identity = 128/472 (27.12%), Postives = 224/472 (47.46%), Query Frame = 2
Query:  116 CCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEH------------RKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGF-AQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQ 1492
            CC     RY LA L   G  IV  +R  +   + ++ + S+T L D  +    P EH            +K  W +   + ++  + F+ Y+I    GGY+       +L G  +  T  + LF P+   +       +  +I+LR L+GL EG   PAM  +   W P  ERS ++ +S  G  LG +I LP+   I     W  VFY +  +G+ W + W  L+ + P K   +S+YEK +++ S+ ++   +  Q  +PW  I+KS P++AI+  + + +WTF      + +Y +     ++ +  FL S P+L   L + + G  AD +  K ++S   +R++ + +G     +F VA GF   D   A   L++     G   +G+++N ++IAP+YAG+++G+ +  +T  G+   VIA  +        W+    +AAA   F    +  F   + + WA   + 
Sbjct:   35 CC---SARYNLAILAFFGFFIVYALRVNLSVALVDMVD-SNTTLEDNRTSKACP-EHSAPIKVHHNQTGKKYQW-DAETQGWILGSFFYGYIITQIPGGYVASKIGGKMLLGFGILGTAVLTLFTPIAADLG------VGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLSISYAGAQLGTVISLPLSGIICYYMNWTYVFYFFGTIGIFWFLLWIWLVSDTPQKHKRISHYEKEYILSSLRNQ---LSSQKSVPWVPILKSLPLWAIVVAHFSYNWTFYTLLTLLPTYMKEILRFNVQENGFLSSLPYLGSWLCMILSGQAADNLRAKWNFSTLCVRRIFSLIGMIGPAVFLVAAGFIGCDYSLAVAFLTISTTLGGFCSSGFSINHLDIAPSYAGILLGITNTFATIPGMVGPVIAKSLTPDNTVGEWQTVFYIAAAINVFGAIFFTLFAKGEVQNWALNDHH 491          
BLAST of slc17a-2 vs. Ensembl Celegans
Match: eat-4 (Probable vesicular glutamate transporter eat-4 [Source:UniProtKB/Swiss-Prot;Acc:P34644])

HSP 1 Score: 193.741 bits (491), Expect = 1.315e-54
Identity = 127/448 (28.35%), Postives = 212/448 (47.32%), Query Frame = 2
Query:  122 GPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLK-IPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSD 1462
            G  +KR+LLA L  +G  I  G+R             + T ++   +  +      +  WT   +   +E++ F+ Y++     G+L      + LFG  + +   +N+ LP    +  D     +++  ++I QGL +G   PAM GV R+W P  ERS +   +  G   G ++GLP+   +     W   FY+Y   G+IW I W+ +  EKP    ++S  EK F+  +I   V N    ++ IPWK I+ S+P++AI+    A  WTF +      +Y +      I  +  L + P L     V +GG LAD +      S T +RK+    GFG +  F + + +   + TA + L   +G SG A++G+ VN ++IAP YA ++MG ++G+ T  G+    +      H K  GW     LA+   F  ++ Y  + S +
Sbjct:   43 GKCRKRWLLAILANMGFMISFGIRCNF--------GAAKTHMYKNYTDPYGKVHMHEFNWTIDEL-SVMESSYFYGYLVTQIPAGFLAAKFPPNKLFGFGIGVGAFLNILLPYGFKVKSD-----YLVAFIQITQGLVQGVCYPAMHGVWRYWAPPMERSKLATTAFTGSYAGAVLGLPLSAFLVSYVSWAAPFYLYGVCGVIWAILWFCVTFEKPAFHPTISQEEKIFIEDAI-GHVSNTHPTIRSIPWKAIVTSKPVWAIIVANFARSWTFYLLLQNQLTYMKEALGMKIADSGLLAAIPHLVMGCVVLMGGQLADYLRSNKILSTTAVRKIFNCGGFGGEAAFMLIVAYTTSDTTAIMALIAAVGMSGFAISGFNVNHLDIAPRYAAILMGFSNGIGTLAGLTCPFVTEAFTAHSK-HGWTSVFLLASLIHFTGVTFYAVYASGE 474          
BLAST of slc17a-2 vs. Ensembl Celegans
Match: eat-4 (Probable vesicular glutamate transporter eat-4 [Source:UniProtKB/Swiss-Prot;Acc:P34644])

HSP 1 Score: 193.356 bits (490), Expect = 2.413e-54
Identity = 127/448 (28.35%), Postives = 212/448 (47.32%), Query Frame = 2
Query:  122 GPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLK-IPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSD 1462
            G  +KR+LLA L  +G  I  G+R             + T ++   +  +      +  WT   +   +E++ F+ Y++     G+L      + LFG  + +   +N+ LP    +  D     +++  ++I QGL +G   PAM GV R+W P  ERS +   +  G   G ++GLP+   +     W   FY+Y   G+IW I W+ +  EKP    ++S  EK F+  +I   V N    ++ IPWK I+ S+P++AI+    A  WTF +      +Y +      I  +  L + P L     V +GG LAD +      S T +RK+    GFG +  F + + +   + TA + L   +G SG A++G+ VN ++IAP YA ++MG ++G+ T  G+    +      H K  GW     LA+   F  ++ Y  + S +
Sbjct:   64 GKCRKRWLLAILANMGFMISFGIRCNF--------GAAKTHMYKNYTDPYGKVHMHEFNWTIDEL-SVMESSYFYGYLVTQIPAGFLAAKFPPNKLFGFGIGVGAFLNILLPYGFKVKSD-----YLVAFIQITQGLVQGVCYPAMHGVWRYWAPPMERSKLATTAFTGSYAGAVLGLPLSAFLVSYVSWAAPFYLYGVCGVIWAILWFCVTFEKPAFHPTISQEEKIFIEDAI-GHVSNTHPTIRSIPWKAIVTSKPVWAIIVANFARSWTFYLLLQNQLTYMKEALGMKIADSGLLAAIPHLVMGCVVLMGGQLADYLRSNKILSTTAVRKIFNCGGFGGEAAFMLIVAYTTSDTTAIMALIAAVGMSGFAISGFNVNHLDIAPRYAAILMGFSNGIGTLAGLTCPFVTEAFTAHSK-HGWTSVFLLASLIHFTGVTFYAVYASGE 495          
BLAST of slc17a-2 vs. Ensembl Celegans
Match: slc-17.1 (SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:Q23514])

HSP 1 Score: 159.458 bits (402), Expect = 9.393e-43
Identity = 99/451 (21.95%), Postives = 209/451 (46.34%), Query Frame = 2
Query:  131 KKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFE 1483
            K+R+++A L  LG   +  MR+ +   I  + + ++ K++  +  +    E+    WT P+ +  V ++ F+ Y+++   GGYL   H +  +F +    T    L  P    +         M++  R ++GL EG   PAM  +   W P  E++ +   +  G   G ++ +P+   + + +GW ++F+ +  LG+IWC+ W++ + ++P  D  +S  E   L +   S     +    +PW  I++S+P++A++  ++A +  F I    +    +     +++K     S P+      +  GG L D +     +    +RK+   LGF  + +F   +    +     +  S+ +G  G+   G++VN +++AP YAG +M  ++  +T  GI   ++   +V +     W + + +  +      +++  F  +  + WA E
Sbjct:   36 KRRHVVAILALLGFANIYAMRANLSIAIVEMTSGTERKVNGTTLHVLGDFEN----WT-PMTQGVVLSSFFYGYIVSQLPGGYLAYTHGAKTIFFAGTFGTAVFTLLTPPFARMGYG------MLVFARFMEGLLEGVTYPAMHVIWSRWAPPMEQTKLATFAFSGSYFGTVVAMPLSAYLGEHFGWPMIFWFFGALGVIWCMVWYKTVHDRPEDDPKISTSELALLQRDAVS-----QNHYIVPWAQILRSKPVWAVIVAHSAQNLGFYIMLTNLPKMLKDIAGYNVEKAGIASSLPYFLMGFQIITGGQLCDYLRRDKHYDTLFVRKMACALGFIGQSVFLFLVMTTSNSLLLVLFFSISIGLGGICWCGFSVNHLDLAPQYAGHLMATSNTFATIPGIFGPLLVGAIVQNGTIGEWNVIMYIIISAYLLGAAIFWKFADATLQPWAAE 470          
BLAST of slc17a-2 vs. Ensembl Celegans
Match: slc-17.1 (SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:Q23514])

HSP 1 Score: 159.458 bits (402), Expect = 1.085e-42
Identity = 99/451 (21.95%), Postives = 209/451 (46.34%), Query Frame = 2
Query:  131 KKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFE 1483
            K+R+++A L  LG   +  MR+ +   I  + + ++ K++  +  +    E+    WT P+ +  V ++ F+ Y+++   GGYL   H +  +F +    T    L  P    +         M++  R ++GL EG   PAM  +   W P  E++ +   +  G   G ++ +P+   + + +GW ++F+ +  LG+IWC+ W++ + ++P  D  +S  E   L +   S     +    +PW  I++S+P++A++  ++A +  F I    +    +     +++K     S P+      +  GG L D +     +    +RK+   LGF  + +F   +    +     +  S+ +G  G+   G++VN +++AP YAG +M  ++  +T  GI   ++   +V +     W + + +  +      +++  F  +  + WA E
Sbjct:   31 KRRHVVAILALLGFANIYAMRANLSIAIVEMTSGTERKVNGTTLHVLGDFEN----WT-PMTQGVVLSSFFYGYIVSQLPGGYLAYTHGAKTIFFAGTFGTAVFTLLTPPFARMGYG------MLVFARFMEGLLEGVTYPAMHVIWSRWAPPMEQTKLATFAFSGSYFGTVVAMPLSAYLGEHFGWPMIFWFFGALGVIWCMVWYKTVHDRPEDDPKISTSELALLQRDAVS-----QNHYIVPWAQILRSKPVWAVIVAHSAQNLGFYIMLTNLPKMLKDIAGYNVEKAGIASSLPYFLMGFQIITGGQLCDYLRRDKHYDTLFVRKMACALGFIGQSVFLFLVMTTSNSLLLVLFFSISIGLGGICWCGFSVNHLDLAPQYAGHLMATSNTFATIPGIFGPLLVGAIVQNGTIGEWNVIMYIIISAYLLGAAIFWKFADATLQPWAAE 465          
BLAST of slc17a-2 vs. Ensembl Celegans
Match: vglu-2 (Vesicular GLUtamate transporter [Source:UniProtKB/TrEMBL;Acc:G5EEK1])

HSP 1 Score: 145.976 bits (367), Expect = 2.176e-37
Identity = 113/459 (24.62%), Postives = 206/459 (44.88%), Query Frame = 2
Query:  131 KKRYLLAFLCTLGLTIVIGMRSEMLGIISN--LKNQSDT--KLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQS 1495
            K R+ +A L   G  I  G+RS   G+  N  + N +D   ++H+K           +  WT   +   +E++ F+ Y  +    G +      + LF   +     +N+   +   ++      IF +++++++QGLA G   PAM GV ++W P  ERS +   +  G S+G ++GLP    +   + W   FY++  LG++W I W  +    P     +S  EK ++ + + S  +       +PW+ ++ S  ++AI+       W+F +      +Y +      I  +  +  FP L   +     G L+D +      S   +RK +   GF ++ +    + F +D   A   L +    +G  ++G+ VN  +IAP +A ++MG+A+G+    G+G  V  SL   +    GW+    LA +   F +  +L F   D   WA EP + 
Sbjct:   45 KVRWQIALLAHFGFAISFGIRSN-FGVAKNRMINNFTDAYGEVHEK-----------EFFWTGTEV-GMMESSFFYGYAASQIPAGVIAAKFAPNKLFMLGILFASLLNIVTAIC--LNFHPFTDIF-VMVIQVMQGLALGVCYPAMHGVWKYWAPPLERSKLATTTFTGASVGVMVGLPASAYLVSHFSWSTPFYVFGALGIVWSILWIYVSGTSPETHGYISADEKKYITEKVGSVAVKNMTLTTLPWRDMMTSTAVWAIIICSFCRSWSFFLLLGNQLTYMKDVLHIDIKNSGLIAIFPQLGMCIVTLTSGQLSDYLRSSGKMSTEAVRKSVNTFGFTVEAVMLGCLAFVRDPVIAVTFLIIACSGAGAVLSGFNVNHFDIAPRHAPILMGIANGLGAIAGVGGIVTNSLTYQN--PDGWQWVFLLAMSIDIFGIIFFLIFAKGDVLPWAREPEKE 485          
BLAST of slc17a-2 vs. Ensembl Fly
Match: VGlut (gene:FBgn0031424 transcript:FBtr0307078)

HSP 1 Score: 202.986 bits (515), Expect = 2.955e-57
Identity = 138/463 (29.81%), Postives = 229/463 (49.46%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLH-DKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLK-IPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQS 1495
            C C P   RY +A +  +G  I  GMR           N S  KL  + +  +F       + WT   +E  V+++ F+ Y++    GG++     ++ +FG S+  +  ++LF+P   T+         ++I +R+LQGL EG   PA  G+ RFW P  ERS +  L+  G   G ++GLP+   + D  G+   FY Y   G+IW +FW  L  E P K  ++S  E  ++ +S+          LK  PW+ +++S P+YAI+       W F +  +   S+ +H++   +++  F+ S P L  +  VP GG+LAD +      S T++RKL    GFG++G+FF+ +  +     A   L+  + FSG A++GY VN ++IAP YA ++MG+++G+ T  GI        ++    +  W     LAA       + Y  F S + + WA  P + 
Sbjct:   89 CPCMP--ARYTIATMACVGFMIAFGMRC----------NMSAAKLKGEHNGTVF-------MNWTV-AVESHVDSSFFWGYLVTQIPGGFIASKFPANKIFGLSIVSSATLHLFVPFAMTLMHG-----HVVICVRVLQGLFEGVTYPACHGIWRFWAPPMERSRLATLAFSGSYAGVVVGLPLSGLLADAVGYQAPFYAYGVFGIIWYMFWIWLCFENPRKHPAISIPELKYIEKSLGESAHPTMPSLKTTPWREMMRSMPVYAIIVANFCRSWNFYLLVLFQSSFLKHKFGFKVEEAGFVGSLPHLIMTTIVPFGGMLADHLRKNGILSTTNVRKLFNCGGFGMEGLFFLFVAHSSTATGAMFALTCGVAFSGFAISGYNVNHLDIAPRYASILMGLSNGIGTLAGIIVPYALDGLIQANPTGCWTTVFTLAACVHLVGCTFYGIFASGELQPWAEPPAEE 526          
BLAST of slc17a-2 vs. Ensembl Fly
Match: VGlut (gene:FBgn0031424 transcript:FBtr0331202)

HSP 1 Score: 202.986 bits (515), Expect = 2.955e-57
Identity = 138/463 (29.81%), Postives = 229/463 (49.46%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLH-DKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLK-IPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQS 1495
            C C P   RY +A +  +G  I  GMR           N S  KL  + +  +F       + WT   +E  V+++ F+ Y++    GG++     ++ +FG S+  +  ++LF+P   T+         ++I +R+LQGL EG   PA  G+ RFW P  ERS +  L+  G   G ++GLP+   + D  G+   FY Y   G+IW +FW  L  E P K  ++S  E  ++ +S+          LK  PW+ +++S P+YAI+       W F +  +   S+ +H++   +++  F+ S P L  +  VP GG+LAD +      S T++RKL    GFG++G+FF+ +  +     A   L+  + FSG A++GY VN ++IAP YA ++MG+++G+ T  GI        ++    +  W     LAA       + Y  F S + + WA  P + 
Sbjct:   89 CPCMP--ARYTIATMACVGFMIAFGMRC----------NMSAAKLKGEHNGTVF-------MNWTV-AVESHVDSSFFWGYLVTQIPGGFIASKFPANKIFGLSIVSSATLHLFVPFAMTLMHG-----HVVICVRVLQGLFEGVTYPACHGIWRFWAPPMERSRLATLAFSGSYAGVVVGLPLSGLLADAVGYQAPFYAYGVFGIIWYMFWIWLCFENPRKHPAISIPELKYIEKSLGESAHPTMPSLKTTPWREMMRSMPVYAIIVANFCRSWNFYLLVLFQSSFLKHKFGFKVEEAGFVGSLPHLIMTTIVPFGGMLADHLRKNGILSTTNVRKLFNCGGFGMEGLFFLFVAHSSTATGAMFALTCGVAFSGFAISGYNVNHLDIAPRYASILMGLSNGIGTLAGIIVPYALDGLIQANPTGCWTTVFTLAACVHLVGCTFYGIFASGELQPWAEPPAEE 526          
BLAST of slc17a-2 vs. Ensembl Fly
Match: VGlut (gene:FBgn0031424 transcript:FBtr0077769)

HSP 1 Score: 202.986 bits (515), Expect = 2.955e-57
Identity = 138/463 (29.81%), Postives = 229/463 (49.46%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLH-DKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLK-IPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQS 1495
            C C P   RY +A +  +G  I  GMR           N S  KL  + +  +F       + WT   +E  V+++ F+ Y++    GG++     ++ +FG S+  +  ++LF+P   T+         ++I +R+LQGL EG   PA  G+ RFW P  ERS +  L+  G   G ++GLP+   + D  G+   FY Y   G+IW +FW  L  E P K  ++S  E  ++ +S+          LK  PW+ +++S P+YAI+       W F +  +   S+ +H++   +++  F+ S P L  +  VP GG+LAD +      S T++RKL    GFG++G+FF+ +  +     A   L+  + FSG A++GY VN ++IAP YA ++MG+++G+ T  GI        ++    +  W     LAA       + Y  F S + + WA  P + 
Sbjct:   89 CPCMP--ARYTIATMACVGFMIAFGMRC----------NMSAAKLKGEHNGTVF-------MNWTV-AVESHVDSSFFWGYLVTQIPGGFIASKFPANKIFGLSIVSSATLHLFVPFAMTLMHG-----HVVICVRVLQGLFEGVTYPACHGIWRFWAPPMERSRLATLAFSGSYAGVVVGLPLSGLLADAVGYQAPFYAYGVFGIIWYMFWIWLCFENPRKHPAISIPELKYIEKSLGESAHPTMPSLKTTPWREMMRSMPVYAIIVANFCRSWNFYLLVLFQSSFLKHKFGFKVEEAGFVGSLPHLIMTTIVPFGGMLADHLRKNGILSTTNVRKLFNCGGFGMEGLFFLFVAHSSTATGAMFALTCGVAFSGFAISGYNVNHLDIAPRYASILMGLSNGIGTLAGIIVPYALDGLIQANPTGCWTTVFTLAACVHLVGCTFYGIFASGELQPWAEPPAEE 526          
BLAST of slc17a-2 vs. Ensembl Fly
Match: MFS9 (gene:FBgn0038799 transcript:FBtr0083889)

HSP 1 Score: 191.045 bits (484), Expect = 6.150e-54
Identity = 118/455 (25.93%), Postives = 225/455 (49.45%), Query Frame = 2
Query:  131 KKRYLLAFLCTLGLTIVIGMRSEM-LGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQ 1492
            K+RY++  L   G   V  +R  + + I++  +N++   + D    +   S  +  PW +   +  + ++ F+ Y++   +GGY+      +++FG+ +  T  + L  P+  + S +      M + +RI++G  EG   P +  V   W+P  ERS +  ++  G   G ++ +P    +  K+GW  VFY++  +G+IW I W   +   P  D   S  E +++ ++I        + +K PW+ I  S P YAI+ ++ +++W F      + S+ R   +  + KT  L + P+LA  + + + G LAD + +K  W+ T +R+      F  + +F +   +  D   + V L++ +G    A +G+AVN ++IAP +A ++MG+ +  +T  GI S ++   VV +  S  WRI   ++A        +Y ++ S D + WA  P Q
Sbjct:   36 KQRYIVVLLAFFGFFNVYSLRVNLSVAIVAMTENRT---VFDADGNV---SYQQDFPW-DSKQKGLILSSFFYGYILTQFLGGYIGTKIGGNIVFGTGIGSTAILTLLTPMAASHSLE------MFLFVRIIEGFFEGVTFPGIHAVWARWSPPLERSRMASIAFAGNYAGTVVAMPCSGFLATKYGWESVFYVFGTIGVIWYITWLVFVKAGPELDRFCSKEECDYIQKTIG---YVGSKHVKHPWRAIFTSMPFYAIMASHFSENWGFYTLLTQLPSFLRDTLNFDLGKTGILSAVPYLAMGILLAVSGYLADWLQVKGIWTTTQVRRNFNCGAFLAQTVFMMLTAYLLDPTWSVVSLTIAVGLGAFAWSGFAVNHLDIAPQHASVLMGIGNTFATIPGIVSPLLTGYVVTNQTSDEWRIIFFISAGIYLVGCVIYWFYCSGDLQEWAKTPEQ 474          
BLAST of slc17a-2 vs. Ensembl Fly
Match: MFS9 (gene:FBgn0038799 transcript:FBtr0083888)

HSP 1 Score: 191.045 bits (484), Expect = 6.150e-54
Identity = 118/455 (25.93%), Postives = 225/455 (49.45%), Query Frame = 2
Query:  131 KKRYLLAFLCTLGLTIVIGMRSEM-LGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQ 1492
            K+RY++  L   G   V  +R  + + I++  +N++   + D    +   S  +  PW +   +  + ++ F+ Y++   +GGY+      +++FG+ +  T  + L  P+  + S +      M + +RI++G  EG   P +  V   W+P  ERS +  ++  G   G ++ +P    +  K+GW  VFY++  +G+IW I W   +   P  D   S  E +++ ++I        + +K PW+ I  S P YAI+ ++ +++W F      + S+ R   +  + KT  L + P+LA  + + + G LAD + +K  W+ T +R+      F  + +F +   +  D   + V L++ +G    A +G+AVN ++IAP +A ++MG+ +  +T  GI S ++   VV +  S  WRI   ++A        +Y ++ S D + WA  P Q
Sbjct:   36 KQRYIVVLLAFFGFFNVYSLRVNLSVAIVAMTENRT---VFDADGNV---SYQQDFPW-DSKQKGLILSSFFYGYILTQFLGGYIGTKIGGNIVFGTGIGSTAILTLLTPMAASHSLE------MFLFVRIIEGFFEGVTFPGIHAVWARWSPPLERSRMASIAFAGNYAGTVVAMPCSGFLATKYGWESVFYVFGTIGVIWYITWLVFVKAGPELDRFCSKEECDYIQKTIG---YVGSKHVKHPWRAIFTSMPFYAIMASHFSENWGFYTLLTQLPSFLRDTLNFDLGKTGILSAVPYLAMGILLAVSGYLADWLQVKGIWTTTQVRRNFNCGAFLAQTVFMMLTAYLLDPTWSVVSLTIAVGLGAFAWSGFAVNHLDIAPQHASVLMGIGNTFATIPGIVSPLLTGYVVTNQTSDEWRIIFFISAGIYLVGCVIYWFYCSGDLQEWAKTPEQ 474          
BLAST of slc17a-2 vs. Ensembl Zebrafish
Match: slc17a6a (solute carrier family 17 member 6a [Source:NCBI gene;Acc:494492])

HSP 1 Score: 228.409 bits (581), Expect = 4.936e-67
Identity = 133/464 (28.66%), Postives = 240/464 (51.72%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI--ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQST 1498
            C C    +RY++A +  LG  I  G+R  +   I ++ N S   +H    +I K  E  K  W +P     +  + F+ Y++    GGY++    ++ +FG+++ +T  +N+F+P    +          ++ +RILQGL EG   PA  G+   W P  ERS +   S  G   G ++ +P+   +    GW  VFYIY + G++W +FW  +  E P    ++++ E+ ++ +SI   +K+L    + K PW+    S P+YAI+       WTF +  +   +Y+   +   I K   + + P L  ++ VPIGG LAD +  K   + T +RK++   GFG++    + +GF+  +  A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  +   + W+    +A+   +  +  Y  F S +++ WA +P +++
Sbjct:   62 CTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNS--TIHKGGKIIIK--EKAKFNW-DPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAILLTSTLNMFIPSAARVHYGC------VMFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGILVQYSGWSSVFYIYGSFGIVWYMFWILVSYESPADHPTITDEERTYIEESIGESAKLLGAMEKYKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMVSALPHLVMTIIVPIGGQLADYLRSKNILTTTTVRKIMNCGGFGMEATLLLVVGFSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKNKTREEWQNVFLIASLVHYGGVIFYGIFASGEKQPWA-DPEETS 513          
BLAST of slc17a-2 vs. Ensembl Zebrafish
Match: slc17a6b (solute carrier family 17 member 6b [Source:NCBI gene;Acc:100149756])

HSP 1 Score: 224.942 bits (572), Expect = 1.020e-65
Identity = 136/457 (29.76%), Postives = 233/457 (50.98%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI--ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWA 1477
            C C    +RY++A +  LG  I  G+R  +   I ++ N S   L+ K  +I K  E  K  W +P     +  + F+ Y++    GGY++    ++ +FG+++ +T  +N+F+P               +I +RILQGL EG   PA  G+   W P  ERS +   S  G   G +I +P+   +    GW  VFY+Y   G+ W +FW  +  E P +  +++  E+ ++ +SI   +K+L    + K PW+    S P+YAI+       WTF +  +   +Y+   +   I K   L + P L  ++ VPIGG LAD +  K   S T +RK++   GFG++    + +G++  +  A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  H   + W+    +A+   +  +  Y  F S +++ WA
Sbjct:   61 CTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTIHLNGK--IIIK--EKAKFNW-DPETVGLIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAILLTSTLNMFIP------SAARGHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGCFGIFWYMFWILVSYESPAEHPTITAEERCYIEESIGESAKLLGPADKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSALPHLVMTIIVPIGGQLADHLRSKNILSTTTVRKIMNCGGFGMEATLLLIVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGIFASGEKQPWA 506          
BLAST of slc17a-2 vs. Ensembl Zebrafish
Match: slc17a8 (solute carrier family 17 member 8 [Source:NCBI gene;Acc:563467])

HSP 1 Score: 219.164 bits (557), Expect = 1.649e-63
Identity = 139/485 (28.66%), Postives = 238/485 (49.07%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIE--SKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQSTISTNKVVISVDTNTKEDLPIS 1561
            C C    KRY++A L  LG  I  G+R  +   I  + N  +  ++   + + +P++     W +P     +  + F+ Y++    GG+++    ++ +FG+++ +T  +N+F+P    +          ++ +RILQGL EG   PA  G+   W P  ERS +   S  G   G +I +P+   +    GW  VFYIY   G+IW IFW  L    P    ++S  E+N++  SI   + +++   + K PW+    S P+YAI+       WTF +  +   +Y+   +   I K   L + P +  ++ VPIGG LAD +  +   S T +RK++   GFG++    + +GF+     A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  H     W+    +A+   +  +  Y  F S +++ WA   N S       +I  D    E  P S
Sbjct:   67 CGCFGLPKRYIIAMLSGLGFCISFGIRCNLGVAIVEMVN--NNTVYINGTAVMQPAQFN---W-DPETVGLIHGSFFWGYIVTQIPGGFISNKLAANRVFGAAIFLTSVLNMFIPSAARVHYGC------VMFVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYVGWPSVFYIYGVFGIIWYIFWILLAYNSPAVHPTISEEERNYIETSIGEGANLMSSTEKFKTPWREFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGILSAVPHMVMTIIVPIGGQLADFLRSRKILSTTTVRKIMNCGGFGMEATLLLVVGFSHTRAVAISFLILAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKHKTRLEWQHVFVIASMVHYTGVIFYAIFASGEKQDWADPENTSDEKCG--IIGEDELADETEPSS 537          
BLAST of slc17a-2 vs. Ensembl Zebrafish
Match: slc17a8 (solute carrier family 17 member 8 [Source:NCBI gene;Acc:563467])

HSP 1 Score: 219.164 bits (557), Expect = 1.754e-63
Identity = 139/485 (28.66%), Postives = 238/485 (49.07%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIE--SKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQSTISTNKVVISVDTNTKEDLPIS 1561
            C C    KRY++A L  LG  I  G+R  +   I  + N  +  ++   + + +P++     W +P     +  + F+ Y++    GG+++    ++ +FG+++ +T  +N+F+P    +          ++ +RILQGL EG   PA  G+   W P  ERS +   S  G   G +I +P+   +    GW  VFYIY   G+IW IFW  L    P    ++S  E+N++  SI   + +++   + K PW+    S P+YAI+       WTF +  +   +Y+   +   I K   L + P +  ++ VPIGG LAD +  +   S T +RK++   GFG++    + +GF+     A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  H     W+    +A+   +  +  Y  F S +++ WA   N S       +I  D    E  P S
Sbjct:   67 CGCFGLPKRYIIAMLSGLGFCISFGIRCNLGVAIVEMVN--NNTVYINGTAVMQPAQFN---W-DPETVGLIHGSFFWGYIVTQIPGGFISNKLAANRVFGAAIFLTSVLNMFIPSAARVHYGC------VMFVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYVGWPSVFYIYGVFGIIWYIFWILLAYNSPAVHPTISEEERNYIETSIGEGANLMSSTEKFKTPWREFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGILSAVPHMVMTIIVPIGGQLADFLRSRKILSTTTVRKIMNCGGFGMEATLLLVVGFSHTRAVAISFLILAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKHKTRLEWQHVFVIASMVHYTGVIFYAIFASGEKQDWADPENTSDEKCG--IIGEDELADETEPSS 537          
BLAST of slc17a-2 vs. Ensembl Zebrafish
Match: slc17a7a (solute carrier family 17 member 7a [Source:ZFIN;Acc:ZDB-GENE-050105-5])

HSP 1 Score: 214.927 bits (546), Expect = 6.336e-62
Identity = 126/463 (27.21%), Postives = 229/463 (49.46%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI--ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQS 1495
            C C    +RY++A L  LG  I  G+R  +   I ++ N        K  ++       +  W +P     +  + F+ Y++    GG++     ++ +FG ++  T  +N+ +P    +          +I++R+ QGL EG   PA  G+   W P  ERS +   +  G   G ++ +P+   +    GW  VFY+Y ++G+ W +FW  +  E P    +++  E+ ++  +I   + ++N  ++ K PW+H   S P+YAI+       WTF +  +   +Y+   +   I K   + + P L  ++ VPIGG LAD +      + T++RKL+   GFG++    + +GF+  +  A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  H   + W+    +AA   +  +  Y  F S +++ WA   N S
Sbjct:   54 CTCFGLPRRYIIAILSGLGFCISFGIRCNLGVAIVSMVNDHTVYSGKKPVIVAA-----QFTW-DPETVGMIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGC------VIMVRVCQGLVEGVSYPACHGIWAKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYTGWSSVFYVYGSVGIFWYLFWILVSYESPAAHPTITPEERKYIEDAIGESAGLVNPLQKFKTPWRHFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMVSALPHLVMTIIVPIGGQLADYLRTHNLMTTTNVRKLMNCGGFGMEATLLLVVGFSHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIAALVHYGGVIFYGLFASGEKQPWADAENTS 504          
BLAST of slc17a-2 vs. Ensembl Xenopus
Match: lrpap1 (LDL receptor related protein associated protein 1 [Source:Xenbase;Acc:XB-GENE-946427])

HSP 1 Score: 234.958 bits (598), Expect = 1.117e-69
Identity = 137/464 (29.53%), Postives = 238/464 (51.29%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI--ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQST 1498
            C C    +RY++A +  LG  I  G+R  +   I ++ N S   +H    +I    E  K  W +P +   +  + F+ Y++    GGY+     ++ +FG+++ +T  +N+ +P    +          +I +RILQGL EG   PA  G+   W P  ERS +   S  G   G +I +P+   +    GW  VFY+Y   GL+W +FW  +  E P K  ++++ E+N++ +SI   + +L    + K PW+    S P+YAI+       WTF +  +   +Y+   +   I K   L + P L  ++ VPIGG +AD +  K   S T +RK++   GFG++    + +G++  +  A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  H   + W+    +AA   +  +  Y  F S +++ WA +P Q++
Sbjct:   49 CTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNST--IHHGGKII---KEKAKFNW-DPEIVGMIHGSFFWGYIVTQIPGGYIASRLAANRVFGAAIVLTSTLNMLIPSAARVHYGC------VIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGCFGLVWYLFWILVSYESPAKHPTITDEERNYIEESIGESANILGPVEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKSREEWQYVFLIAALVHYGGVIFYGIFASGEKQPWA-DPEQTS 499          
BLAST of slc17a-2 vs. Ensembl Xenopus
Match: lrpap1 (LDL receptor related protein associated protein 1 [Source:Xenbase;Acc:XB-GENE-946427])

HSP 1 Score: 233.802 bits (595), Expect = 3.555e-69
Identity = 137/464 (29.53%), Postives = 238/464 (51.29%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI--ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQST 1498
            C C    +RY++A +  LG  I  G+R  +   I ++ N S   +H    +I    E  K  W +P +   +  + F+ Y++    GGY+     ++ +FG+++ +T  +N+ +P    +          +I +RILQGL EG   PA  G+   W P  ERS +   S  G   G +I +P+   +    GW  VFY+Y   GL+W +FW  +  E P K  ++++ E+N++ +SI   + +L    + K PW+    S P+YAI+       WTF +  +   +Y+   +   I K   L + P L  ++ VPIGG +AD +  K   S T +RK++   GFG++    + +G++  +  A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  H   + W+    +AA   +  +  Y  F S +++ WA +P Q++
Sbjct:   36 CTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNS--TIHHGGKII---KEKAKFNW-DPEIVGMIHGSFFWGYIVTQIPGGYIASRLAANRVFGAAIVLTSTLNMLIPSAARVHYGC------VIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGCFGLVWYLFWILVSYESPAKHPTITDEERNYIEESIGESANILGPVEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKSREEWQYVFLIAALVHYGGVIFYGIFASGEKQPWA-DPEQTS 486          
BLAST of slc17a-2 vs. Ensembl Xenopus
Match: lrpap1 (LDL receptor related protein associated protein 1 [Source:Xenbase;Acc:XB-GENE-946427])

HSP 1 Score: 234.187 bits (596), Expect = 3.577e-69
Identity = 137/464 (29.53%), Postives = 238/464 (51.29%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI--ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQST 1498
            C C    +RY++A +  LG  I  G+R  +   I ++ N S   +H    +I    E  K  W +P +   +  + F+ Y++    GGY+     ++ +FG+++ +T  +N+ +P    +          +I +RILQGL EG   PA  G+   W P  ERS +   S  G   G +I +P+   +    GW  VFY+Y   GL+W +FW  +  E P K  ++++ E+N++ +SI   + +L    + K PW+    S P+YAI+       WTF +  +   +Y+   +   I K   L + P L  ++ VPIGG +AD +  K   S T +RK++   GFG++    + +G++  +  A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  H   + W+    +AA   +  +  Y  F S +++ WA +P Q++
Sbjct:   50 CTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNS--TIHHGGKII---KEKAKFNW-DPEIVGMIHGSFFWGYIVTQIPGGYIASRLAANRVFGAAIVLTSTLNMLIPSAARVHYGC------VIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGCFGLVWYLFWILVSYESPAKHPTITDEERNYIEESIGESANILGPVEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKSREEWQYVFLIAALVHYGGVIFYGIFASGEKQPWA-DPEQTS 500          
BLAST of slc17a-2 vs. Ensembl Xenopus
Match: lrpap1 (LDL receptor related protein associated protein 1 [Source:Xenbase;Acc:XB-GENE-946427])

HSP 1 Score: 234.187 bits (596), Expect = 4.275e-69
Identity = 137/464 (29.53%), Postives = 238/464 (51.29%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI--ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQST 1498
            C C    +RY++A +  LG  I  G+R  +   I ++ N S   +H    +I    E  K  W +P +   +  + F+ Y++    GGY+     ++ +FG+++ +T  +N+ +P    +          +I +RILQGL EG   PA  G+   W P  ERS +   S  G   G +I +P+   +    GW  VFY+Y   GL+W +FW  +  E P K  ++++ E+N++ +SI   + +L    + K PW+    S P+YAI+       WTF +  +   +Y+   +   I K   L + P L  ++ VPIGG +AD +  K   S T +RK++   GFG++    + +G++  +  A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  H   + W+    +AA   +  +  Y  F S +++ WA +P Q++
Sbjct:   51 CTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNST--IHHGGKII---KEKAKFNW-DPEIVGMIHGSFFWGYIVTQIPGGYIASRLAANRVFGAAIVLTSTLNMLIPSAARVHYGC------VIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGCFGLVWYLFWILVSYESPAKHPTITDEERNYIEESIGESANILGPVEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKSREEWQYVFLIAALVHYGGVIFYGIFASGEKQPWA-DPEQTS 501          
BLAST of slc17a-2 vs. Ensembl Xenopus
Match: lrpap1 (LDL receptor related protein associated protein 1 [Source:Xenbase;Acc:XB-GENE-946427])

HSP 1 Score: 233.802 bits (595), Expect = 5.933e-69
Identity = 137/464 (29.53%), Postives = 238/464 (51.29%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI--ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQST 1498
            C C    +RY++A +  LG  I  G+R  +   I ++ N S   +H    +I    E  K  W +P +   +  + F+ Y++    GGY+     ++ +FG+++ +T  +N+ +P    +          +I +RILQGL EG   PA  G+   W P  ERS +   S  G   G +I +P+   +    GW  VFY+Y   GL+W +FW  +  E P K  ++++ E+N++ +SI   + +L    + K PW+    S P+YAI+       WTF +  +   +Y+   +   I K   L + P L  ++ VPIGG +AD +  K   S T +RK++   GFG++    + +G++  +  A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  H   + W+    +AA   +  +  Y  F S +++ WA +P Q++
Sbjct:   57 CTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNS--TIHHGGKII---KEKAKFNW-DPEIVGMIHGSFFWGYIVTQIPGGYIASRLAANRVFGAAIVLTSTLNMLIPSAARVHYGC------VIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGCFGLVWYLFWILVSYESPAKHPTITDEERNYIEESIGESANILGPVEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKSREEWQYVFLIAALVHYGGVIFYGIFASGEKQPWA-DPEQTS 507          
BLAST of slc17a-2 vs. Ensembl Mouse
Match: Slc17a6 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6 [Source:MGI Symbol;Acc:MGI:2156052])

HSP 1 Score: 228.409 bits (581), Expect = 4.901e-67
Identity = 134/464 (28.88%), Postives = 236/464 (50.86%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI--ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQST 1498
            C C    +RY++A +  LG  I  G+R  +   I ++ N S   +H    +I    E  K  W +P     +  + F+ Y+I    GGY+     ++ +FG+++ +T  +N+ +P    +          +I +RILQGL EG   PA  G+   W P  ERS +   S  G   G +I +P+   +    GW  VFY+Y + G++W +FW  +  E P K  ++++ E+ ++ +SI   + +L    + K PW+    S P+YAI+       WTF +  +   +Y+   +   I K   L + P L  ++ VPIGG +AD +  K   S T +RK++   GFG++    + +G++     A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  +   + W+    +AA   +  +  Y  F S +++ WA +P +++
Sbjct:   62 CTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNS--TIHRGGKVI---KEKAKFNW-DPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGC------VIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVFLIAALVHYGGVIFYALFASGEKQPWA-DPEETS 512          
BLAST of slc17a-2 vs. Ensembl Mouse
Match: Slc17a8 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 8 [Source:MGI Symbol;Acc:MGI:3039629])

HSP 1 Score: 219.935 bits (559), Expect = 1.071e-63
Identity = 135/461 (29.28%), Postives = 230/461 (49.89%), Query Frame = 2
Query:  116 CCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI-ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQS 1495
            CCG   KRY++A +  LG  I  G+R  +   I  + N S   +  K  +     +  +  W +P     +  + F+ Y++    GG+++    +S +FG+++ +T  +N+F+P    +          ++ +RILQGL EG   PA  G+   W P  ERS +   S  G   G ++ +P+   +    GW  VFYIY   G+IW +FW     E P    ++SN E+ ++  SI E   L    +   PW+    S P+YAI+       WTF +  +   +Y+   +  +I K   L + P +  ++ VPIGG LAD +  +   + T +RK++   GFG++    + +GF+  +  A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  H   + W+    +AA   +  +  Y  F S +++ WA   N S
Sbjct:   82 CCGI-PKRYIIAVMSGLGFCISFGIRCNLGVAIVEMVNNSTVYVDGKPEI-----QTAQFNW-DPETVGLIHGSFFWGYIVTQIPGGFISNKFAASRVFGAAIFLTSTLNMFIPSAARVHYGC------VMGVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYIGWASVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNAERTYIETSIGEGANLASLSKFNTPWRRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPHMVMTIVVPIGGQLADYLRSRKILTTTAVRKIMNCGGFGMEATLLLVVGFSHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQNVFLIAALVHYSGVIFYGVFASGEKQDWADPENLS 529          
BLAST of slc17a-2 vs. Ensembl Mouse
Match: Slc17a7 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7 [Source:MGI Symbol;Acc:MGI:1920211])

HSP 1 Score: 218.394 bits (555), Expect = 2.174e-63
Identity = 128/462 (27.71%), Postives = 232/462 (50.22%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI--ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQ 1492
            C C    +RY++A +  LG  I  G+R  +   I ++ N S T  H    ++ + ++     W +P     +  + F+ Y++    GG++     ++ +FG ++  T  +N+ +P    +          +I +RILQGL EG   PA  G+   W P  ERS +   +  G   G ++ +P+   +    GW  VFY+Y + G+ W +FW  +  E P    S+S  E+ ++  +I   +K++N   +   PW+    S P+YAI+       WTF +  +   +Y+   +   I K   + + P L  ++ VPIGG +AD +  +   S T++RKL+   GFG++    + +G++  +  A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  H   + W+    +A+   +  +  Y  F S +++ WA EP +
Sbjct:   54 CTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTT--HRGGHVVVQKAQ---FNW-DPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGC------VIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPVTKFNTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRHIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWA-EPEE 502          
BLAST of slc17a-2 vs. Ensembl Mouse
Match: Slc17a7 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7 [Source:MGI Symbol;Acc:MGI:1920211])

HSP 1 Score: 212.616 bits (540), Expect = 3.882e-61
Identity = 129/482 (26.76%), Postives = 234/482 (48.55%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTK-------------LHDKSSLI-------FKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI--ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQ 1492
            C C    +RY++A +  LG  I  G+R  +   I ++ N S T              +H + ++           +E  +  W +P     +  + F+ Y++    GG++     ++ +FG ++  T  +N+ +P    +          +I +RILQGL EG   PA  G+   W P  ERS +   +  G   G ++ +P+   +    GW  VFY+Y + G+ W +FW  +  E P    S+S  E+ ++  +I   +K++N   +   PW+    S P+YAI+       WTF +  +   +Y+   +   I K   + + P L  ++ VPIGG +AD +  +   S T++RKL+   GFG++    + +G++  +  A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  H   + W+    +A+   +  +  Y  F S +++ WA EP +
Sbjct:   54 CTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQTPYRSVHKQEAVTPTLGDIQGGDTEKAQFNW-DPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGC------VIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPVTKFNTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRHIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWA-EPEE 527          
BLAST of slc17a-2 vs. Ensembl Mouse
Match: Slc17a8 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 8 [Source:MGI Symbol;Acc:MGI:3039629])

HSP 1 Score: 182.185 bits (461), Expect = 2.544e-51
Identity = 106/332 (31.93%), Postives = 172/332 (51.81%), Query Frame = 2
Query:  503 IILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI-ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQS 1495
            ++ +RILQGL EG   PA  G+   W P  ERS +   S  G   G ++ +P+   +    GW  VFYIY   G+IW +FW     E P    ++SN E+ ++  SI E   L    +   PW+    S P+YAI+       WTF +  +   +Y+   +  +I K   L + P +  ++ VPIGG LAD +  +   + T +RK++   GFG++    + +GF+  +  A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  H   + W+    +AA   +  +  Y  F S +++ WA   N S
Sbjct:   14 VMGVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYIGWASVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNAERTYIETSIGEGANLASLSKFNTPWRRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPHMVMTIVVPIGGQLADYLRSRKILTTTAVRKIMNCGGFGMEATLLLVVGFSHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQNVFLIAALVHYSGVIFYGVFASGEKQDWADPENLS 345          
BLAST of slc17a-2 vs. UniProt/SwissProt
Match: sp|A6QLI1|VGLU2_BOVIN (Vesicular glutamate transporter 2 OS=Bos taurus OX=9913 GN=SLC17A6 PE=2 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 3.090e-66
Identity = 135/464 (29.09%), Postives = 236/464 (50.86%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI--ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQST 1498
            C C    +RY++A +  LG  I  G+R  +   I ++ N S   +H    +I    E  K  W +P     +  + F+ Y+I    GGY+     ++ +FG+++ +T  +N+ +P    +          +I +RILQGL EG   PA  G+   W P  ERS +   S  G   G +I +P+   +    GW  VFY+Y + G+IW +FW  +  E P K  ++++ E+ ++ +SI   + +L    + K PW+    S P+YAI+       WTF +  +   +Y+   +   I K   L + P L  ++ VPIGG +AD +  K   S T +RK++   GFG++    + +G++     A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  +   + W+    +AA   +  +  Y  F S +++ WA +P +++
Sbjct:   62 CTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNST--IHRGGKVI---KEKAKFNW-DPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGC------VIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGSFGMIWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVFLIAALVHYGGVIFYAIFASGEKQPWA-DPEETS 512          
BLAST of slc17a-2 vs. UniProt/SwissProt
Match: sp|Q9P2U8|VGLU2_HUMAN (Vesicular glutamate transporter 2 OS=Homo sapiens OX=9606 GN=SLC17A6 PE=2 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 3.537e-66
Identity = 134/464 (28.88%), Postives = 236/464 (50.86%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI--ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQST 1498
            C C    +RY++A +  LG  I  G+R  +   I ++ N S   +H    +I    E  K  W +P     +  + F+ Y+I    GGY+     ++ +FG+++ +T  +N+ +P    +          +I +RILQGL EG   PA  G+   W P  ERS +   S  G   G +I +P+   +    GW  VFY+Y + G++W +FW  +  E P K  ++++ E+ ++ +SI   + +L    + K PW+    S P+YAI+       WTF +  +   +Y+   +   I K   L + P L  ++ VPIGG +AD +  K   S T +RK++   GFG++    + +G++     A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  +   + W+    +AA   +  +  Y  F S +++ WA +P +++
Sbjct:   62 CTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNST--IHRGGKVI---KEKAKFNW-DPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGC------VIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVFLIAALVHYGGVIFYAIFASGEKQPWA-DPEETS 512          
BLAST of slc17a-2 vs. UniProt/SwissProt
Match: sp|Q9JI12|VGLU2_RAT (Vesicular glutamate transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc17a6 PE=1 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 3.611e-66
Identity = 134/464 (28.88%), Postives = 236/464 (50.86%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI--ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQST 1498
            C C    +RY++A +  LG  I  G+R  +   I ++ N S   +H    +I    E  K  W +P     +  + F+ Y+I    GGY+     ++ +FG+++ +T  +N+ +P    +          +I +RILQGL EG   PA  G+   W P  ERS +   S  G   G +I +P+   +    GW  VFY+Y + G++W +FW  +  E P K  ++++ E+ ++ +SI   + +L    + K PW+    S P+YAI+       WTF +  +   +Y+   +   I K   L + P L  ++ VPIGG +AD +  K   S T +RK++   GFG++    + +G++     A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  +   + W+    +AA   +  +  Y  F S +++ WA +P +++
Sbjct:   62 CTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNS--TIHRGGKVI---KEKAKFNW-DPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGC------VIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVFLIAALVHYGGVIFYALFASGEKQPWA-DPEETS 512          
BLAST of slc17a-2 vs. UniProt/SwissProt
Match: sp|Q8BLE7|VGLU2_MOUSE (Vesicular glutamate transporter 2 OS=Mus musculus OX=10090 GN=Slc17a6 PE=1 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 5.034e-66
Identity = 134/464 (28.88%), Postives = 235/464 (50.65%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI--ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQST 1498
            C C    +RY++A +  LG  I  G+R  +   I ++ N S   +H    +I    E  K  W +P     +  + F+ Y+I    GGY+     ++ +FG+++ +T  +N+ +P    +          +I +RILQGL EG   PA  G+   W P  ERS +   S  G   G +I +P+   +    GW  VFY+Y + G++W +FW  +  E P K  ++++ E+ ++ +SI   + +L    + K PW+    S P+YAI+       WTF +  +   +Y+   +   I K   L + P L  ++ VPIGG +AD +  K   S T +RK++   GFG++    + +G++     A   L L +GFSG A++G+ VN ++IAP YA ++MG++ GV T +G+   +I   +  +   + W+    +AA   +  +  Y  F S +++ WA +P +++
Sbjct:   62 CTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNS--TIHRGGKVI---KEKAKFNW-DPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGC------VIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISDGVGTLSGMVCPIIVGAMTKNKSREEWQYVFLIAALVHYGGVIFYALFASGEKQPWA-DPEETS 512          
BLAST of slc17a-2 vs. UniProt/SwissProt
Match: sp|Q5W8I8|VGL2A_DANRE (Vesicular glutamate transporter 2.1 OS=Danio rerio OX=7955 GN=slc17a6b PE=2 SV=2)

HSP 1 Score: 224.942 bits (572), Expect = 7.702e-65
Identity = 136/457 (29.76%), Postives = 233/457 (50.98%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI--ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWA 1477
            C C    +RY++A +  LG  I  G+R  +   I ++ N S   L+ K  +I K  E  K  W +P     +  + F+ Y++    GGY++    ++ +FG+++ +T  +N+F+P               +I +RILQGL EG   PA  G+   W P  ERS +   S  G   G +I +P+   +    GW  VFY+Y   G+ W +FW  +  E P +  +++  E+ ++ +SI   +K+L    + K PW+    S P+YAI+       WTF +  +   +Y+   +   I K   L + P L  ++ VPIGG LAD +  K   S T +RK++   GFG++    + +G++  +  A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  H   + W+    +A+   +  +  Y  F S +++ WA
Sbjct:   61 CTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTIHLNGK--IIIK--EKAKFNW-DPETVGLIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAILLTSTLNMFIP------SAARGHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGCFGIFWYMFWILVSYESPAEHPTITAEERCYIEESIGESAKLLGPADKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSALPHLVMTIIVPIGGQLADHLRSKNILSTTTVRKIMNCGGFGMEATLLLIVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGIFASGEKQPWA 506          
BLAST of slc17a-2 vs. TrEMBL
Match: A0A0H3YF21 (Slc17a-2 OS=Schmidtea mediterranea OX=79327 GN=slc17a-2 PE=2 SV=1)

HSP 1 Score: 989.178 bits (2556), Expect = 0.000e+0
Identity = 498/498 (100.00%), Postives = 498/498 (100.00%), Query Frame = 2
Query:   74 MKNEFRLNRHRNFCCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQSTISTNKVVISVDTNTKEDLPISVV 1567
            MKNEFRLNRHRNFCCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKLLTGLGFGLKGIFFVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQSTISTNKVVISVDTNTKEDLPISVV
Sbjct:    1 MKNEFRLNRHRNFCCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKLLTGLGFGLKGIFFVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQSTISTNKVVISVDTNTKEDLPISVV 498          
BLAST of slc17a-2 vs. TrEMBL
Match: A0A0H3YJ22 (Slc17a-8 OS=Schmidtea mediterranea OX=79327 GN=slc17a-8 PE=2 SV=1)

HSP 1 Score: 677.552 bits (1747), Expect = 0.000e+0
Identity = 340/488 (69.67%), Postives = 394/488 (80.74%), Query Frame = 2
Query:   80 NEFRL-------NRHRNFCCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQS--DTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQSTISTNKV 1516
            NEF+        N+ R   CCGPG+KR+L+  LCT  LTIVIGMRSEMLGIISN+K+ S  D+K     +LIFKPS+HR LPWT+ L+EDF+ENAVFFA MI SPIGGYLTVNHD SLL GSSVAMTCG NLFLPLV TI  + T KI M+I++RI QGLAEGCLIPA+FGVLRFW P NERS+IIC SVIGVSLGPLIGLP+C  IE KWGWGVVFYIYANLGL+WCIFWWRL+DE+P++  S+S  E+++L+  I+SKV    R L IPWK I +S+ IYAILFTYAADDWTFQI+SVCMQSYY  +Y S I+ TI LL +PFLARS+FVP GG +AD++G  T+ SWT IRK+LT +GFGLKGIFF+AM FA+DEKTATV+LSLCLGFSG+AVAGYAVNV+EIAPNYAGLIMGMASG+STFTGIGSTVIAS++V  +K  GW IALC A A Q FS+SMYLWFGS  EE WAF P     S N V
Sbjct:   23 NEFKTEFDNKPKNKSRKIFCCGPGRKRHLIPLLCTTALTIVIGMRSEMLGIISNIKSNSSFDSKNSIDDNLIFKPSKHRNLPWTDNLLEDFIENAVFFANMIGSPIGGYLTVNHDPSLLLGSSVAMTCGFNLFLPLVATIGSNDTIKITMVIIMRIFQGLAEGCLIPAIFGVLRFWAPVNERSSIICFSVIGVSLGPLIGLPLCAAIEKKWGWGVVFYIYANLGLVWCIFWWRLVDERPSRSKSISAQERDYLLACIDSKVEKANRNLPIPWKEIFRSKSIYAILFTYAADDWTFQITSVCMQSYYEFKYHSDIENTITLLVYPFLARSIFVPAGGAVADILGFTTTLSWTAIRKILTSIGFGLKGIFFIAMAFAKDEKTATVMLSLCLGFSGIAVAGYAVNVIEIAPNYAGLIMGMASGLSTFTGIGSTVIASVMVQSMKQYGWMIALCSAGAIQLFSLSMYLWFGSCKEEPWAFPPIDEENSNNSV 510          
BLAST of slc17a-2 vs. TrEMBL
Match: A0A0H3YFB1 (Slc17a-4 OS=Schmidtea mediterranea OX=79327 GN=slc17a-4 PE=2 SV=1)

HSP 1 Score: 647.506 bits (1669), Expect = 0.000e+0
Identity = 326/498 (65.46%), Postives = 393/498 (78.92%), Query Frame = 2
Query:   86 FRLNRHRNFCCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQS-IESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQSTISTNKVV--------ISVDTNTKEDL 1552
            F  +   NF  CGPGKKRYL+A LCT+GLT+VIGMRSEMLGII+NLKN SD      S LIFKPS+HRK+PW +P+MEDFVENAVFF+Y++ASPIGG+LTV HDSSLL G SVAMTCGINLFLPLVET+  ++  KI MII LR+LQG+AEGCL+PA+FGVLRFW P NE+STI+CLSVIGVS+GPLIGLPVC +IE KWGWGVVFYIYAN+GLIWCIFWWR++DE+P  D +LS  E+ ++ ++       + K    IPWK I  S+P+YAI  TYAADDWTFQISSVCMQ+YY   Y   ++KTI+LLSFPFLARS+FVPIGG LAD + LKT+WSWT IRK L GLGFGLKGIFF+A+ FA+DE +AT+LLSL LGFSGLAVAGYAVNV+++APNYAGL+MG A+ +STFTGI STVIAS +V  + SQGW+IALC+AA  Q FSM MYL F SS+++ WA  P + T+    +         I +D  + ED 
Sbjct:   17 FDEDSKTNFVYCGPGKKRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSD-----HSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENSSFKSSFSKKSSASIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCLAGLGFGLKGIFFIALSFAKDEMSATILLSLALGFSGLAVAGYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVSKM-SQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWA-NPKEQTVEMEDISPELPLCHKIVIDAKSDEDF 507          
BLAST of slc17a-2 vs. TrEMBL
Match: A0A504Z222 (Vesicular glutamate transporter OS=Fasciola gigantica OX=46835 GN=FGIG_05083 PE=4 SV=1)

HSP 1 Score: 622.083 bits (1603), Expect = 0.000e+0
Identity = 322/516 (62.40%), Postives = 383/516 (74.22%), Query Frame = 2
Query:  101 HRNFCCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKN-------------------------QSDTKLH----------------------------DKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVK---SQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAF 1480
            H + C CGPG+KRYL+AFLC   LT+VIGMRSEMLGII+NL N                         Q+D  LH                              +SLIFKPSEHR++PWT+ +  D  ENAVFFAY+I SPIGGYLTVNHDSS L G SVAMTCG+NLFLPLVETI  ++ AK  M++LLR+LQGLAEGCLIPA+FGVLRFW+P NERST++C++VIGVSLGPLIGLPVC +IE KWGWGVVFYIYANLGLIWCIFWWRLIDEKP KDD L   E+ +L +SI  ++L  KRQ+ IPW+ I  SRP++AI FTYAADDWTFQISSVCMQS+Y+  Y   +++TIF LSFPFL+RS+FVPIGG+ AD + +KTS S T IRKL  GLGFGLKGIFFVA+GFA  E  ATVLLSL LGFSGLAVAGYAVNV+++APN++GL+MG A+ VSTFTGI ST IAS+VVH      + GWR+AL LAA +QF +M +YL FGSS+E+ WA+
Sbjct:  125 HSDSCFCGPGRKRYLIAFLCCACLTVVIGMRSEMLGIITNLNNTNPSGSILNRLSGPMDHLHGASANKQADDLLHLSGVVSHLPGEEIDALHEIPGLQAEINQPATSLIFKPSEHRQMPWTKTIKNDIAENAVFFAYLITSPIGGYLTVNHDSSFLLGCSVAMTCGMNLFLPLVETIGNNLQAKFIMVVLLRLLQGLAEGCLIPAVFGVLRFWSPENERSTLVCVAVIGVSLGPLIGLPVCAEIEKKWGWGVVFYIYANLGLIWCIFWWRLIDEKPMKDDRLGKRERAYLHRSIAQRILCAKRQIPIPWQSIFSSRPVFAIFFTYAADDWTFQISSVCMQSFYQQLYKVDVERTIFFLSFPFLSRSMFVPIGGVFADFLRIKTSLSLTTIRKLFAGLGFGLKGIFFVALGFAPSEIYATVLLSLSLGFSGLAVAGYAVNVIDLAPNFSGLVMGFANSVSTFTGILSTFIASIVVHKFGLELTNGWRVALALAALSQFCAMLIYLIFGSSEEQSWAY 640          
BLAST of slc17a-2 vs. TrEMBL
Match: A0A2H1CTT3 (Transporter, major facilitator family protein OS=Fasciola hepatica OX=6192 GN=D915_01575 PE=4 SV=1)

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 322/516 (62.40%), Postives = 383/516 (74.22%), Query Frame = 2
Query:  101 HRNFCCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQ--------------------SDTKLHDK---------------------------------SSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVK---SQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAF 1480
            H + C CGPG+KRYL+AFLC   LT+VIGMRSEMLGII+NL N                     S +KL D                                  +SLIFKPSEHR++PWT+ +  D  ENAVFFAY+I SPIGGYLTVNHDSS L G SVAMTCG+NLFLPLVETI  ++ AK  M++LLR+LQGLAEGCLIPA+FGVLRFW+P NERST++C++VIGVSLGPLIGLPVC +IE KWGWGVVFYIYANLGLIWCIFWWRLIDEKP KDD L   E+ +L +SI  ++L  KRQ+ IPW+ I  SRP++AI FTYAADDWTFQISSVCMQS+Y+  Y   +++TIF LSFPFL+RS+FVPIGG+ AD + +KTS S T IRKL  GLGFGLKGIFFVA+GFA  E  ATVLLSL LGFSGLAVAGYAVNV+++APN++GL+MG A+ VSTFTGI ST IAS+VVH      + GWR+AL LAA +QF +M +YL FGSS+E+ WA+
Sbjct:  130 HSDSCFCGPGRKRYLIAFLCCACLTVVIGMRSEMLGIITNLNNTNPSGSILNRLSGPMDHLHGASASKLADDLLDPSGVVGHLPGEEIDALHEIPGLQAEINQPATSLIFKPSEHRQMPWTKTIKNDIAENAVFFAYLITSPIGGYLTVNHDSSFLLGCSVAMTCGMNLFLPLVETIGNNLQAKFIMVVLLRLLQGLAEGCLIPAVFGVLRFWSPENERSTLVCVAVIGVSLGPLIGLPVCAEIEKKWGWGVVFYIYANLGLIWCIFWWRLIDEKPMKDDRLGKRERAYLHRSIAQRILCAKRQIPIPWQSIFSSRPVFAIFFTYAADDWTFQISSVCMQSFYQQLYKVDVERTIFFLSFPFLSRSMFVPIGGVFADFLRIKTSLSLTTIRKLFAGLGFGLKGIFFVALGFAPSEIYATVLLSLSLGFSGLAVAGYAVNVIDLAPNFSGLVMGFANSVSTFTGILSTFIASIVVHKFGLELTNGWRVALALAALSQFCAMLIYLIFGSSEEQSWAY 645          
BLAST of slc17a-2 vs. Ensembl Cavefish
Match: slc17a6b (vesicular glutamate transporter 2.1 [Source:NCBI gene;Acc:103031917])

HSP 1 Score: 230.72 bits (587), Expect = 3.631e-68
Identity = 134/458 (29.26%), Postives = 239/458 (52.18%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEM-LGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI--ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWA 1477
            C C    +RY++A +  LG  I  G+R  + + I+S + N +   +H+   +I K  E  K  W +P     +  + F+ Y++    GGY++    ++ +FG+++ +T  +N+F+P    +          +I +RILQGL EG   PA  G+   W P  ERS +   S  G   G +I +P+   +    GW  VFY+Y   GL+W +FW  +  E P +  ++++ E+ ++ +SI   +K+L    + K PW+    S P+YAI+       WTF +  +   +Y+   +   I K   L + P L  ++ VPIGG +AD +  K   S T++RK++   GFG++    + +G++  +  A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  +   + W+    +A+   +  +  Y  F S +++ WA
Sbjct:   40 CTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNST---IHENGKIIIK--EKAKFNW-DPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAIVLTSTLNMFIPSAARVHYGC------VIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGCFGLVWYMFWILVSYESPAEHPTITDEERCYIEESIGESAKLLGPAEKFKTPWRQFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSALPHLVMTIIVPIGGQIADYLRSKNLMSTTNVRKIMNCGGFGMEATLLLIVGYSHSKGMAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGTMTKNKTREEWQYVFLIASMVHYGGVIFYGIFASGEKQPWA 485          
BLAST of slc17a-2 vs. Ensembl Cavefish
Match: slc17a6b (vesicular glutamate transporter 2.1 [Source:NCBI gene;Acc:103031917])

HSP 1 Score: 230.72 bits (587), Expect = 6.655e-68
Identity = 134/458 (29.26%), Postives = 239/458 (52.18%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEM-LGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI--ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWA 1477
            C C    +RY++A +  LG  I  G+R  + + I+S + N +   +H+   +I K  E  K  W +P     +  + F+ Y++    GGY++    ++ +FG+++ +T  +N+F+P    +          +I +RILQGL EG   PA  G+   W P  ERS +   S  G   G +I +P+   +    GW  VFY+Y   GL+W +FW  +  E P +  ++++ E+ ++ +SI   +K+L    + K PW+    S P+YAI+       WTF +  +   +Y+   +   I K   L + P L  ++ VPIGG +AD +  K   S T++RK++   GFG++    + +G++  +  A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  +   + W+    +A+   +  +  Y  F S +++ WA
Sbjct:   62 CTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNST---IHENGKIIIK--EKAKFNW-DPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAIVLTSTLNMFIPSAARVHYGC------VIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGCFGLVWYMFWILVSYESPAEHPTITDEERCYIEESIGESAKLLGPAEKFKTPWRQFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSALPHLVMTIIVPIGGQIADYLRSKNLMSTTNVRKIMNCGGFGMEATLLLIVGYSHSKGMAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGTMTKNKTREEWQYVFLIASMVHYGGVIFYGIFASGEKQPWA 507          
BLAST of slc17a-2 vs. Ensembl Cavefish
Match: slc17a6a (solute carrier family 17 member 6 [Source:NCBI gene;Acc:103044031])

HSP 1 Score: 224.557 bits (571), Expect = 1.280e-65
Identity = 133/464 (28.66%), Postives = 237/464 (51.08%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIE--SKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQST 1498
            C C    +RY +A +  LG  I  G+R  +   I ++ N S   +H    +I K  E  K  W +P     +  + F+ Y++    GGY++    ++ +FG+++ +T  +N+F+P    +          +I +RILQGL EG   PA  G+   W P  ERS +   S  G   G ++ +P+   +    GW  VFYIY + G++W +FW  +  E P    ++++ E+ ++ +SI   + +L    + K PW+    S P+YAI+       WTF +  +   +Y+   +   I K   + + P L  ++ VPIGG LAD +      S T +RK++   GFG++    + +GF+  +  A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  +   + W+    +A+   +  +  Y  F S +++ WA +P +++
Sbjct:   62 CTCFGIPRRYTIAIMSGLGFCISFGIRCNLGVAIVDMVNNS--TIHKDGKIIIK--EKAKFNW-DPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAILLTSTLNMFIPSAARVHYGC------VIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYSGWSSVFYIYGSFGIVWYMFWILVSYESPADHPTITDEERLYIEESIGEGANLLGATEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGAVSALPHLVMTIIVPIGGQLADYLRSNNILSTTTVRKIMNCGGFGMEATLLLVVGFSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKNKTREEWQNVFLIASLVHYGGVVFYGIFASGEKQPWA-DPEETS 513          
BLAST of slc17a-2 vs. Ensembl Cavefish
Match: slc17a6a (solute carrier family 17 member 6 [Source:NCBI gene;Acc:103044031])

HSP 1 Score: 224.557 bits (571), Expect = 1.280e-65
Identity = 133/464 (28.66%), Postives = 237/464 (51.08%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIE--SKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQST 1498
            C C    +RY +A +  LG  I  G+R  +   I ++ N S   +H    +I K  E  K  W +P     +  + F+ Y++    GGY++    ++ +FG+++ +T  +N+F+P    +          +I +RILQGL EG   PA  G+   W P  ERS +   S  G   G ++ +P+   +    GW  VFYIY + G++W +FW  +  E P    ++++ E+ ++ +SI   + +L    + K PW+    S P+YAI+       WTF +  +   +Y+   +   I K   + + P L  ++ VPIGG LAD +      S T +RK++   GFG++    + +GF+  +  A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  +   + W+    +A+   +  +  Y  F S +++ WA +P +++
Sbjct:   62 CTCFGIPRRYTIAIMSGLGFCISFGIRCNLGVAIVDMVNNS--TIHKDGKIIIK--EKAKFNW-DPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAILLTSTLNMFIPSAARVHYGC------VIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYSGWSSVFYIYGSFGIVWYMFWILVSYESPADHPTITDEERLYIEESIGEGANLLGATEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGAVSALPHLVMTIIVPIGGQLADYLRSNNILSTTTVRKIMNCGGFGMEATLLLVVGFSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKNKTREEWQNVFLIASLVHYGGVVFYGIFASGEKQPWA-DPEETS 513          
BLAST of slc17a-2 vs. Ensembl Cavefish
Match: slc17a7a (vesicular glutamate transporter 1-like [Source:NCBI gene;Acc:103024379])

HSP 1 Score: 216.468 bits (550), Expect = 1.406e-62
Identity = 128/463 (27.65%), Postives = 234/463 (50.54%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI--ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQS 1495
            C C    +RY++A L  LG  I  G+R  +   I ++ N+  T    K  +I    E  +  W +P     +  + F+ Y++    GG++     ++ +FG ++  T  +N+ +P    +          +I++RI QGL EG   PA  G+   W P  ERS +   +  G   G ++ +P+   +    GW  VFY+Y ++G++W +FW  +  E P    +++  E+ ++ ++I   + ++N  ++ K PW+H   S P+YAI+       WTF +  +   +Y+   +   I K   + + P L  ++ VPIGG LAD +      + T++RKL+   GFG++    + +GF+  +  A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  H   + W+    +A+   +  +  Y  F S +++ WA   + S
Sbjct:   54 CTCFGLPRRYIIAILSGLGFCISFGIRCNLGVAIVSMVNE-HTVFRGKKPII----EAAQFTW-DPETVGMIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPAAARVHYGC------VIMVRICQGLVEGVSYPACHGIWAKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYTGWSSVFYVYGSVGILWYMFWILVSYESPAVHPTITPEERKYIEEAIGESAGLVNPLQKFKTPWRHFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQLADYLRTHNIMTTTNVRKLMNCGGFGMEATLLLVVGFSHTKVIAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIASLVHYGGVVFYGIFASGEKQPWADAEDTS 504          
BLAST of slc17a-2 vs. Ensembl Sea Lamprey
Match: slc17a6b (solute carrier family 17 member 6b [Source:NCBI gene;Acc:100149756])

HSP 1 Score: 185.267 bits (469), Expect = 5.764e-52
Identity = 133/467 (28.48%), Postives = 226/467 (48.39%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYL--TVNHDSSLLFGSSVAMTCGINLFLPL-VETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESK--VLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQST 1498
            C C    KRY++A +  LG  I  G+R  +   + ++ N S    H    LI +      L W+  L     E   FF + +A+  G  +  +++ +  L   S++        +LP+ VE       A +  + L  + QG+      PA  G+   W P  ERS +   +  G   G ++ +P+   +    GW  VFY+Y + GL W IFW  +  E P K  ++S+ EK ++ +SI     +L   ++ K PWK    S P+YAI+       WTF +  +   +Y+   +   I K   + + P L  ++ VPIGG LAD    K   S T +RK++   GFG++    + +GF+  +  A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +      + W+    +AA   +  +  Y  F S +++ WA +P +++
Sbjct:   22 CRCFGMPKRYVIAVMSGLGFCISFGIRCNLGVAVVDMVNNSS--YHSGDKLIVQKG---SLGWSMDLAMQLHELYNFFLFFLATWQGHIVVKSMSREERLHQCSTLPPH-----WLPVHVEERRAVPCACLTSLSLSSVEQGVT----YPACHGIWAKWAPPLERSRLATTAFCGSYAGAVVAMPLAGILVQYAGWSSVFYVYGSFGLFWYIFWLCIAYESPAKHPTISDEEKTYIEESIGESYGILGSTQKFKTPWKKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGIISALPHLVMTIVVPIGGQLADFFRSKKIMSTTTVRKMMNCGGFGMEATLLLVVGFSHGKGIAITFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKGKTREEWQNVFLIAALVHYGGVIFYGLFASGEKQPWA-DPEETS 473          
BLAST of slc17a-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010352.1 (pep scaffold:Pmarinus_7.0:GL492704:416:4460:1 gene:ENSPMAG00000009375.1 transcript:ENSPMAT00000010352.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.775 bits (286), Expect = 4.594e-29
Identity = 69/255 (27.06%), Postives = 123/255 (48.24%), Query Frame = 2
Query:  722 GLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQ-DEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFE 1483
            GL+W I W+    + P +   +S  E+ F+++S++++         IPW+H+    P++AI        W F +    + +Y        + +   L + P+LA  +F   GG+ AD + ++   S T IRK+ T LG  +  +  VA GF   +   A   L+L + F     AG  +N ++IAP YAG+++G+++  +   G  +  +   +  H   + W +   ++AA   F    YL FGS  ++ WA E
Sbjct:    4 GLLWSIVWFLFAFDSPERHPRISAEEREFILKSLQAE-RQANHGTSIPWRHVWTCMPLWAINVAMFCSGWGFYVLLTSLPTYMSTVLHYEMQQNGLLSALPYLAGWVFTVAGGMAADALRIRGLLSITAIRKVATTLGLAVPSLCLVASGFVGCNHLLAVSFLTLSVAFGAFTTAGCGINQLDIAPQYAGVLLGISNTFNNLPGFLAPTLTGYLTEHDTLKEWHMVFFISAAINMFGALFYLVFGSGKQQSWARE 257          
BLAST of slc17a-2 vs. Ensembl Nematostella
Match: EDO31704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX52])

HSP 1 Score: 177.948 bits (450), Expect = 1.486e-49
Identity = 132/467 (28.27%), Postives = 221/467 (47.32%), Query Frame = 2
Query:  134 KRYLLAFLCTLGLTIVIGMRSEM-LGIISNLKNQ--SDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIED---KWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLK-IPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQSTISTNK 1513
            KRY+L  +  LG   +  MR  + + I+  + +Q  S  +LH       K +E     W   L +  V  + F+ Y +    G +L +    + +FG  V +T  + L  P+    S      ++ ++ +RI QGL  G   P    +   W P  ERST+I +S+ G   G ++ +P+   +       GW  VFY +   G+IW   W  ++ E P    ++S  E+  +  SI S   + K Q + +PW HI++ + ++AI+  +    W +      M +Y++   D  I++T FL + P+L ++L  P+GGILAD +          +R +   +G  L G+F VA  +A       + L L +GFSGL   GYAVN ++IAP YAG++MG+ +  ++  G  S  I  +V  H K + WRI   +       ++  Y    S   + WA   +Q  +S  +
Sbjct:   38 KRYVLLAMTWLGFINIYSMRVNLNVAIVGMVNDQTISKGRLH-----FIKKAEFN---WDSAL-QGLVLGSFFYGYWVLQIPGAWLAMRIGGTRVFGYGVFVTSLLALLTPVATRYS------VWGLVGVRIFQGLFLGVTFPCNHAIWSKWAPPFERSTLITISIAGCPFGNIVAIPLTGLLSKYGFDGGWPSVFYCFGTSGIIWYCCWELVVHESPATHPTISKEERELIENSIASS--DNKAQFEGLPWHHILRCKAVWAIVIGHFGACWGYYTLFTGMPTYFKDVLDFDIEQTGFLAACPYLFKALLAPLGGILADYLIKHNILRIGTVRVIFYAVGCLLAGVFIVATSYATTRHMCVIFLVLGVGFSGLNAIGYAVNHLDIAPQYAGVLMGLTNTFASTPGFISPQITGIVTKHKKQEEWRIVFWITMIVYVVAVIGYSALCSGYRQPWAGGRDQVELSEKE 487          
BLAST of slc17a-2 vs. Ensembl Nematostella
Match: EDO48671 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIA9])

HSP 1 Score: 175.637 bits (444), Expect = 4.323e-49
Identity = 120/463 (25.92%), Postives = 221/463 (47.73%), Query Frame = 2
Query:  137 RYLLAFLCTLGLTIVIGMR---SEMLGIISNLKNQSDTKLHDKSSLIF---KPSEHRK-LP----WTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIED---KWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFE 1483
            RY++A +  LG+ +   +R   S  +G + N    ++     K  L+        H+K LP    W+  L +  +  A ++ YM     GG+L      + +FG  + +   + +  PL    S      +  +I LR+++GL  G L P    +   W P +ER+ +  ++V G  +G ++ +P+   +       GW  VFY +  +GL+W   W   I   P++  ++S  EK ++  +I  +      +L IPWK I+ S P++AI+      DW      +C+  Y+       + KT FL + P++ ++   P GG++ D + +K   S  + R+ +  +G  +  IF +A G+A     A  LL++ +G +G+  AGYAVN+++IAP YAG+IMG+ +      G  S  I  ++  +  ++ WR+   +        + ++    S D++ WA +
Sbjct:    1 RYIVAIMVFLGICVQYALRVNLSVAIGAMCNPHTVTENGFTIKKVLVVYCVTVRRHQKVLPAEFDWSSKL-QGTILGAFYYGYMTMQLPGGWLGQRFGGTRVFGICLGIASVLTMLTPLAARTS------VVALITLRVIEGLTLGALFPCNHAIWSKWAPPSERTRLFTITVAGCPVGTILSMPLSGLMSKYGFDGGWASVFYCFGAVGLLWFFVWQLSIHATPSEHPTISEEEKVYIETAIADQP---GVKLSIPWKSILTSGPVWAIIIANFTADWGMYTILICLPKYFIEVLKFDLAKTGFLAALPYVLKAFVGPTGGVIVDWL-IKNKLSVKNTRRCVFTVGCTVASIFVLATGYANQPYLAVGLLTIGVGITGINAAGYAVNILDIAPKYAGVIMGVTNVFGAAPGFISPQIVGIITPNKTAKEWRVVFWITFIVYIVGIVLFGLLVSGDKQKWAMD 452          
BLAST of slc17a-2 vs. Ensembl Nematostella
Match: EDO45514 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSS9])

HSP 1 Score: 174.096 bits (440), Expect = 3.760e-48
Identity = 126/461 (27.33%), Postives = 210/461 (45.55%), Query Frame = 2
Query:  131 KKRYLLAFLCTLGLTIVIGMRSEM----LGIISNLKNQSDTKLHDKSSLIFKPSEHRK---LPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLP---VCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKT--ATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQG-WRIALCLAAATQFFSMSMYLWFGSSDEEFW 1474
            + RY LA L  LG  +V G+R  +    + ++++  +  D   + +      P    K     W +   +  +  + F+ Y+     GG+L        LFG  V  T    L  P            I M+I LRIL+GL EG   PAM  +   W P  ERS ++ LS  G  LG +I +P   V    E   GW  VFYI+ +LG++W + W  ++ EKP    ++S  E++++I SI +       +   PW  I  S  ++AI+  +  ++W F      + SY++   + SI    FL + P+  + LF+ I G +AD +  +   S + +RK+     F +     VA  +     T  +  L S  LGF+G  ++G+ VN ++IAP YAG++MG+ +   T  GI +  +A  + +    +  W+I   ++A         ++      E  W
Sbjct:   23 RVRYTLALLACLGFCVVYGLRVNLSVALVAMVNSTYDGIDGNTNSECPGGNTPDTTYKNGDFNWDQK-TQGLILGSFFYGYICTQLPGGWLASQFGGKHLFGFGVLCTSIFTLLTPWAAH------QGIPMLIALRILEGLGEGVTFPAMHAIWSSWAPPLERSKLLTLSYAGCQLGNIIFMPLAGVLCASEIAGGWPSVFYIFGSLGILWFVVWTLMVTEKPADHPTISEAERDYIISSIGTSQDRKTTKQNTPWSAIWSSPAVWAIIIAHFCNNWGFYTFLTLLPSYFKEVLNFSILTNGFLSAVPYSTQWLFIVIAGQIADWLLRRRISSVSDVRKVFCVTAFIIPACLLVATSYTGCTTTTLSVCLFSTALGFTGFNLSGFNVNHLDIAPRYAGILMGITNSFGTVPGIAAPYVAGWITNKKPDRAHWQIVFFISAGLYVIGAISFVTLSKGSERRW 476          
BLAST of slc17a-2 vs. Ensembl Nematostella
Match: EDO46366 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQH0])

HSP 1 Score: 159.073 bits (401), Expect = 9.016e-43
Identity = 115/460 (25.00%), Postives = 206/460 (44.78%), Query Frame = 2
Query:  137 RYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVC-VQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGST-VIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQSTISTN 1510
            RY+LA L   GLT+   +R  +   +  + N + T          +P E     W +      +  + F+ Y++    GG+L   +      G  V ++  ++L  PL    S        M+I+LRIL+GLA+G + P++  +L  W P  ERS ++ ++  G   G +IGL V  +    ++ W  VFY++   G++W +FW  L+ + P+    +S  EK +++ +I +    V ++   PW+ I+ SR + AI  ++   +W F      + +Y++     +I     L + P+  +       G LAD +      + T +RK      F L     VA+GF      A  LL +   F  +   G+ ++ +E AP Y GL+  +A+ + T TGI +  V+  L         W+    + A    F    +   G+S E+ W   P ++ +  +
Sbjct:   11 RYILAVLGCFGLTVTFSLRVNLSVALVAMVNSTQTG---------QPKEDY-FSWDQQ-TRGIILGSFFYGYIVMLIPGGWLAERNGGKHFVGLGVLISSVLSLLTPLAARYSYK------MLIVLRILEGLAQGVIYPSVNVLLSCWAPPEERSKMLVITWTGCQAGNIIGLVVSGLLCASRFQWPSVFYLFGASGIVWYLFWCFLVYDSPSVHPRISLEEKEYIVTAIGASQDKVVKKHPTPWRQILTSRAVLAISISFFCSNWGFCTFLTSLPTYFQEVLHFNITTNGLLSALPYFCQYFTSLPAGFLADWLIHSHIITVTEVRK-----IFTLASCIMVALGFTNQPVVAVTLLCVLFMFQTIDTCGHWISPMEFAPRYCGLLFAIANSIGTSTGIAAPFVVGYLTNGQPTRDQWQKVYYIGAGIYVFGAVAFAALGTSKEQPWNTPPEENLVPVD 448          
BLAST of slc17a-2 vs. Ensembl Nematostella
Match: EDO31712 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX51])

HSP 1 Score: 148.673 bits (374), Expect = 1.621e-39
Identity = 106/425 (24.94%), Postives = 199/425 (46.82%), Query Frame = 2
Query:  212 ISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDK-WGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLK--IPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWA 1477
            I  + + S   ++ K ++  KP E     W+   M+  V  + ++ Y +     G+  +      +FG  + +   + L  P +      +     + I LRI QGL+ G +  A   +   W+P  ER++++ ++  G  +G ++ +PV   + D   GW + FY   +LG++W I W   + E P    +++  E  F+         N+    K  +PW  I+ S P++A  FT    DW F    +C+  + +     S+ +T F+ + PF+  ++  P+ G+ AD +  +   S   IRK+    G      F VA+G+      +  LL+L +G  GL  AG   N+++++P YAGL+MG ++ + + +G  +  +  ++  H   + WR+   L A      + +Y+ FGS  ++ WA
Sbjct:   12 IVAMVSNSTVLINGKKTV--KPPEFA---WSSE-MQGLVLGSFYYGYAVLQIPAGWAVLKIGGKPIFGFGILVASVLALVTPPI------VKQSFIVFICLRIAQGLSLGLIASAHHCIWATWSPIFERASLLTIAGSGTLVGTIVTMPVTGLLCDSPKGWPLAFYFIGSLGVLWFIAWQYFMYETPQDHPTITQAEIEFI-----GVPWNIDEATKSVVPWASILCSTPVWAANFTMFISDWCFYSMLICIPLFMKQVLHFSLSETGFVSALPFVLMTIVSPVSGMYADRLRARGVLSTGAIRKIFQCAGLAASSCFVVAVGYESKPFLSLALLTLGIGSFGLIAAGVGPNLIDLSPKYAGLLMGFSNTMGSLSGFLAPGVVGVLTVHGTLEEWRLVFWLTAVLSLAGILVYVAFGSGKKQSWA 419          
BLAST of slc17a-2 vs. Ensembl Medaka
Match: slc17a6a (solute carrier family 17 member 6 [Source:NCBI gene;Acc:101175075])

HSP 1 Score: 227.639 bits (579), Expect = 9.438e-67
Identity = 133/464 (28.66%), Postives = 240/464 (51.72%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEM-LGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI--ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQS 1495
            C C    +RY++A L  LG  I  G+R  + + I+S + N +   +H    +I K  E  K  W +P     +  + F+ Y++    GGY++    ++ +FG+++ +T  +N+F+P          +    +I +RILQGL EG   PA  G+   W P  ERS +  LS  G   G +I +P+   +    GW  VFY+Y + G+ W +FW  +  E P +  +++  E+ ++ +SI   ++++    + K PW+    S P+YAI+       WTF +  +   +Y+   +   I K   L + P L  ++ VP+GG LAD +      S T +RK++   GFG++    + +G++  +  A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  +   + W+    +A+   +  +  Y  F S +++ WA +P ++
Sbjct:   62 CTCFGLPRRYIIAILSGLGFCISFGIRCNLGVAIVSMVNNST---IHQNGKIIVK--EKAKFNW-DPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAIVLTSTLNMFIP------SAARSHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATLSFCGSYAGAVIAMPLAGVLVQYTGWSSVFYVYGSFGIFWYMFWILVSYESPAEHPTITEEERRYIEESIGESAQLMGPSEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPLGGQLADYLRSHNIMSTTMVRKIMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKNKTREEWQYVFLIASLVHYGGVVFYGIFASGEKQPWA-DPEET 512          
BLAST of slc17a-2 vs. Ensembl Medaka
Match: SLC17A6 (vesicular glutamate transporter 2.1 [Source:NCBI gene;Acc:101166288])

HSP 1 Score: 222.631 bits (566), Expect = 5.324e-65
Identity = 131/457 (28.67%), Postives = 232/457 (50.77%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI--ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWA 1477
            C C    +RY++A +  +G  I  G+R  +   I  + N S   +H    +I K  E  K  W +P     +  + F+ Y++    GGY+     ++ +FG+++ +T  +N+F+P    +          +I +RILQGL EG   PA  G+   W P  ERS +  +S  G   G +I +P+   +    GW  VFY+Y  +G+ W IFW  +  E P    ++++ E+ ++ +SI   +++     + K PW+    S P+YAI+       WTF +  +   +Y+   +   I K   L + P L  ++ VPIGG LAD +  K   + T +RK++   GFG++    + +G++  +  A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  +   + W+    +A+   +  +  Y  F S +++ WA
Sbjct:   58 CSCFGLPRRYIIAIMSGMGFCISFGIRCNLGVAIVGMVNNST--IHQNGKIIIK--EKAKFNW-DPETVGMIHGSFFWGYIVTQIPGGYICSRLAANRVFGAAIVLTSTLNMFIPSAARVHYGC------VIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATISFCGSYAGAVIAMPLAGILVQYSGWSSVFYVYGCVGIFWYIFWILVSYESPADHPTITDEERCYIEESIGESARLSGPGEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPIGGQLADHLRSKNILTTTTVRKIMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKNKTREEWQYVFLIASLVHYGGVVFYGIFASGEKQPWA 503          
BLAST of slc17a-2 vs. Ensembl Medaka
Match: slc17a8 (vesicular glutamate transporter 3 [Source:NCBI gene;Acc:101165727])

HSP 1 Score: 215.698 bits (548), Expect = 2.273e-62
Identity = 133/479 (27.77%), Postives = 235/479 (49.06%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQSTISTNKVVISVDTNTKED 1549
            C CG   KRY++A L  LG  I  G+R  +   I  + N +   ++    L     +  +  W +P     +  + F+ Y++    GG++     ++ +FG+++ +T  +N+F+P    +          ++ +RILQGL EG   PA  G+   W P  ERS +   S  G   G +I +P+   +    GW  VFYIY   G++W + W  L    P    +++  E+ ++  +I  + +N   + + PW+    S P+YAI+       WTF +  +   +Y+   +   I K   L + P +  ++ VPIGG LAD +  K   S T++RKL+   GFG++    + +GF+     A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  +     W+    +A+   +  +  Y  F S +++ WA   N  ++S +K  I  +    E+
Sbjct:   65 CSCGGLPKRYIIAILSGLGFCISFGIRCNLGVAIVEMVNNNTVYINGTPVL-----QRAQFNW-DPETVGLIHGSFFWGYIVTQIPGGFIANKLSANRVFGAAIFLTSVLNMFIPSAARVHYGC------VLFVRILQGLVEGVTYPACHGLWAKWAPPLERSRLATTSFCGSYAGAVIAMPLAGVLVQYVGWPSVFYIYGVFGIMWYVMWLLLAYGSPADHPTITEEERLYIEAAI-GETVNQLSKFRTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGLLSAVPHMVMTIVVPIGGQLADFLRSKKIMSTTNVRKLMNCGGFGMEATLLLVVGFSHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKNKTRLEWQHVFVIASMVHYSGVIFYAIFASGEQQDWA---NPESLSEDKCGIIDEDELAEE 527          
BLAST of slc17a-2 vs. Ensembl Medaka
Match: ENSORLT00000010015.2 (vesicular glutamate transporter 1-like [Source:NCBI gene;Acc:101167994])

HSP 1 Score: 210.305 bits (534), Expect = 8.479e-61
Identity = 128/481 (26.61%), Postives = 235/481 (48.86%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQSTISTNKVVISVD-TNTKEDL 1552
            C C    +RY++A L  +G  I  G+R  +   + ++ N S   L     +I K     +  W +P     +  + F+ Y++    GG++     ++ +FG ++  T  +N+ +P    +          +I++RI QGL EG   PA  G+   W P  ERS +   +  G   G +I +P+   +    GW  VFY+Y + G++W  FW  +  E P    +++  E+ ++ +SI     +   +   PW+    S P+YAI+       WTF +  +   +Y+   +   I K   + + P L  ++ VPIGG +AD +      + T++RKL+   GFG++    + +GF+  +  A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  H   + W+    +A+   +  +  Y  F S +++ WA EP + ++    ++   +  N  E+L
Sbjct:    6 CTCFGLPRRYIIAILSGIGFCISFGIRCNLGVAVVSMVN-SHKVLRGNKEVIVKA----QFEW-DPETVGMIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSCLNMLIPAAARM------HFGCVIIVRIFQGLVEGVSYPACHGIWAKWAPPLERSRLATTAFCGSYAGAVIAMPLAGILVQYSGWSSVFYVYGSFGVMWYCFWILVSYESPAAHPTITEEERKYIEESIGESAQHTVTKFNTPWRCFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGIVSALPHLVMTIIVPIGGQIADYLRSNQIMTTTNVRKLMNCGGFGMEATLLLVVGFSHTKGVAITFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQGVFLIASLVHYGGVIFYGLFASGEKQTWA-EPEELSVEKCGILDEDELANETEEL 473          
BLAST of slc17a-2 vs. Ensembl Medaka
Match: slc17a7a (vesicular glutamate transporter 1 [Source:NCBI gene;Acc:101175655])

HSP 1 Score: 210.305 bits (534), Expect = 2.567e-60
Identity = 126/457 (27.57%), Postives = 225/457 (49.23%), Query Frame = 2
Query:  113 CCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI--ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWA 1477
            C C    +RY++A L  LG  I  G+R  +   I ++ N       +K  L+       +  W +P     +  + F+ Y++    GG++     ++ +FG ++  T  +N+ +P               +IL+RI QGL EG   PA  G+   W P  ERS +   +  G   G ++ +P+   +    GW  VFY+Y + G+ W +FW  +  E P    +++  E+ ++ ++I   S  LN  ++ K PW+    S P+YAI+       WTF +  +   +Y+   +   I K   + + P L  ++ VPIGG LAD +      + T++RKL+   GFG++    + +G++  +  A   L L +GFSG A++G+ VN ++IAP YA ++MG+++GV T +G+   +I   +  H   + W+    +A+   +  +  Y  F S +++ WA
Sbjct:   54 CTCFGLPRRYIIAILSGLGFCISFGIRCNLGVAIVSMVNDHTVYKGNKEVLVAA-----QFTW-DPETVGMIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARCHYSC------VILVRICQGLVEGVSYPACHGIWAKWAPPLERSRLATTAFCGSYAGAVVAMPLAGILVQYIGWPSVFYVYGSFGIFWYLFWILVSYESPAAHPTITAEERKYIEEAIGESSSFLNPLQKFKTPWRQFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMVSALPHLVMTIIVPIGGQLADYLRSHNLMTTTNVRKLMNCGGFGMEATLLLVVGYSHTKVIAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIASLVHYGGVVFYGLFASGEKQPWA 498          
BLAST of slc17a-2 vs. Planmine SMEST
Match: SMESG000032477.1 (SMESG000032477.1)

HSP 1 Score: 827.009 bits (2135), Expect = 0.000e+0
Identity = 419/419 (100.00%), Postives = 419/419 (100.00%), Query Frame = 2
Query:   74 MKNEFRLNRHRNFCCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTG 1330
            MKNEFRLNRHRNFCCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKLLTGLGFGLKGIFFVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTG
Sbjct:    1 MKNEFRLNRHRNFCCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKLLTGLGFGLKGIFFVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTG 419          
BLAST of slc17a-2 vs. Planmine SMEST
Match: SMESG000012683.1 (SMESG000012683.1)

HSP 1 Score: 677.552 bits (1747), Expect = 0.000e+0
Identity = 340/488 (69.67%), Postives = 394/488 (80.74%), Query Frame = 2
Query:   80 NEFRL-------NRHRNFCCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQS--DTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQSTISTNKV 1516
            NEF+        N+ R   CCGPG+KR+L+  LCT  LTIVIGMRSEMLGIISN+K+ S  D+K     +LIFKPS+HR LPWT+ L+EDF+ENAVFFA MI SPIGGYLTVNHD SLL GSSVAMTCG NLFLPLV TI  + T KI M+I++RI QGLAEGCLIPA+FGVLRFW P NERS+IIC SVIGVSLGPLIGLP+C  IE KWGWGVVFYIYANLGL+WCIFWWRL+DE+P++  S+S  E+++L+  I+SKV    R L IPWK I +S+ IYAILFTYAADDWTFQI+SVCMQSYY  +Y S I+ TI LL +PFLARS+FVP GG +AD++G  T+ SWT IRK+LT +GFGLKGIFF+AM FA+DEKTATV+LSLCLGFSG+AVAGYAVNV+EIAPNYAGLIMGMASG+STFTGIGSTVIAS++V  +K  GW IALC A A Q FS+SMYLWFGS  EE WAF P     S N V
Sbjct:   23 NEFKTEFDNKPKNKSRKIFCCGPGRKRHLIPLLCTTALTIVIGMRSEMLGIISNIKSNSSFDSKNSIDDNLIFKPSKHRNLPWTDNLLEDFIENAVFFANMIGSPIGGYLTVNHDPSLLLGSSVAMTCGFNLFLPLVATIGSNDTIKITMVIIMRIFQGLAEGCLIPAIFGVLRFWAPVNERSSIICFSVIGVSLGPLIGLPLCAAIEKKWGWGVVFYIYANLGLVWCIFWWRLVDERPSRSKSISAQERDYLLACIDSKVEKANRNLPIPWKEIFRSKSIYAILFTYAADDWTFQITSVCMQSYYEFKYHSDIENTITLLVYPFLARSIFVPAGGAVADILGFTTTLSWTAIRKILTSIGFGLKGIFFIAMAFAKDEKTATVMLSLCLGFSGIAVAGYAVNVIEIAPNYAGLIMGMASGLSTFTGIGSTVIASVMVQSMKQYGWMIALCSAGAIQLFSLSMYLWFGSCKEEPWAFPPIDEENSNNSV 510          
BLAST of slc17a-2 vs. Planmine SMEST
Match: SMESG000061339.1 (SMESG000061339.1)

HSP 1 Score: 647.506 bits (1669), Expect = 0.000e+0
Identity = 326/498 (65.46%), Postives = 393/498 (78.92%), Query Frame = 2
Query:   86 FRLNRHRNFCCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQS-IESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQSTISTNKVV--------ISVDTNTKEDL 1552
            F  +   NF  CGPGKKRYL+A LCT+GLT+VIGMRSEMLGII+NLKN SD      S LIFKPS+HRK+PW +P+MEDFVENAVFF+Y++ASPIGG+LTV HDSSLL G SVAMTCGINLFLPLVET+  ++  KI MII LR+LQG+AEGCL+PA+FGVLRFW P NE+STI+CLSVIGVS+GPLIGLPVC +IE KWGWGVVFYIYAN+GLIWCIFWWR++DE+P  D +LS  E+ ++ ++       + K    IPWK I  S+P+YAI  TYAADDWTFQISSVCMQ+YY   Y   ++KTI+LLSFPFLARS+FVPIGG LAD + LKT+WSWT IRK L GLGFGLKGIFF+A+ FA+DE +AT+LLSL LGFSGLAVAGYAVNV+++APNYAGL+MG A+ +STFTGI STVIAS +V  + SQGW+IALC+AA  Q FSM MYL F SS+++ WA  P + T+    +         I +D  + ED 
Sbjct:   17 FDEDSKTNFVYCGPGKKRYLIALLCTIGLTVVIGMRSEMLGIITNLKNSSD-----HSQLIFKPSQHRKMPWKDPIMEDFVENAVFFSYLVASPIGGFLTVKHDSSLLLGCSVAMTCGINLFLPLVETLGNNLIPKITMIIFLRLLQGMAEGCLVPAVFGVLRFWCPKNEKSTILCLSVIGVSMGPLIGLPVCAEIEQKWGWGVVFYIYANIGLIWCIFWWRIVDERPENDRNLSKQERQYIFENSSFKSSFSKKSSASIPWKLIFSSKPVYAIFCTYAADDWTFQISSVCMQTYYLQMYKVRVEKTIYLLSFPFLARSIFVPIGGFLADFLKLKTTWSWTTIRKCLAGLGFGLKGIFFIALSFAKDEMSATILLSLALGFSGLAVAGYAVNVIDLAPNYAGLVMGFANSISTFTGILSTVIASFIVSKM-SQGWKIALCMAAGIQLFSMQMYLLFASSEKQKWA-NPKEQTVEMEDISPELHLCHKIVIDAKSDEDF 507          
BLAST of slc17a-2 vs. Planmine SMEST
Match: SMESG000019933.1 (SMESG000019933.1)

HSP 1 Score: 218.009 bits (554), Expect = 2.153e-64
Identity = 140/476 (29.41%), Postives = 248/476 (52.10%), Query Frame = 2
Query:  101 HRNFCCCGP--GKKRYLLAFLCTLGLTIVIGMRSEMLGIISNLKNQSDTKLHDKSSLI--FKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVK-SQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFEPNQSTISTNK 1513
            H    CC    G KRYLLA L   GL I +GMR E+   I  L    D  +   ++ I  FK  + R++ W+   +   +E + +  Y + S  GG+L+    ++ +FG +V  +   N  +PL+  I Q     +F   +LRI QG++EGCL P++    R+W P  ERS ++ +S  G++LGP+IG P+   +  ++ W   FY +    + W + W  +  + P++D  +S  EK ++ Q+     +      ++PW  I+ S P++AI+      +WT+Q S   + S+ R +++ S     F +S P++  ++  P  GI+AD + +K  +S   +RK    +GFG+ G+ F+ +GF      AT  LS+ LG  G+ ++G+ VN ++IA  YAG++MG+++G+ T  GI + ++A  + +    + GW I   ++      +++ Y  F S + + WA       I  ++
Sbjct:    3 HDTEECCQKVLGNKRYLLAILACFGLLIPLGMRCEIGIAIIKLTELHDMVVPAGNNNISEFKVIQVREVAWSNTKV-SLIEASFYIGYTLFSIPGGFLSTIFPANKVFGFAVFTSAFFNFAIPLL-VIYQCGFVSVF---VLRIFQGMSEGCLYPSVHSFWRYWAPKQERSKLVTISFFGMALGPIIGYPISGILTKRYDWPANFYFWGTAAMSWAVIWLAVSRKCPSQDSFISEAEKTYIEQNTSQMAITAS---QVPWISILTSVPVWAIIIANIGRNWTYQFSFSGLPSFLRKKFNDSSINLGFHMSIPYIVMAILTPSCGIVADCM-IKRKFSVAFVRKFFNSVGFGIAGLMFLFLGFIPYLWLATTTLSIGLGSFGIGISGFGVNHLDIADIYAGVLMGISNGIGTLAGILAPIVAMEITNKFSVNDGWLIFFIISGIIHLITVTFYAIFASGENQSWAVHTEPEGIKDSE 469          
BLAST of slc17a-2 vs. Planmine SMEST
Match: SMESG000075620.1 (SMESG000075620.1)

HSP 1 Score: 172.94 bits (437), Expect = 1.512e-47
Identity = 120/452 (26.55%), Postives = 228/452 (50.44%), Query Frame = 2
Query:  134 KRYLLAFLCTLGLTIVIGMRSEM-LGIISNLKNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIGGYLTVNHDSSLLFGSSVAMTCGINLFLPL-VETISQDITAKIFMIILLRILQGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQIEDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSIESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYRHQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKXXXXXXXXXXXXXXVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIAPNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQFFSMSMYLWFGSSDEEFWAFE 1483
            +R+++  LC  GL IV  MR  + + +++ L   + +K+  +++++  P    K+ W   ++   + +  +  ++I    GGY++    S+ LF   + ++C +N+ LP+ ++  +   T        +R+ QGL+EG + PA++ ++  W P             G+  GP+IG P+   I   W W  VFY+++  G+IW I  + L  E P+   S+S  E ++L+   E     + +++KIPW  I  S  ++AI+       W F I  +  +  Y +Q+  ++ +     + P + + +   + G L +++      S T++RKL   LGFG++ +    + FA     A V L + +GFSGLAV+G+ +N ++IAP ++G+I G+++   TF GI S ++  L+ H      W+ +  L  +   F + ++  FG  D   W  E
Sbjct:   45 RRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLP----KVTWNSKMI-GILHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYCFTC------FIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQE-----IVKEMKIPWCKIFSSTAVWAIITCNFVKSWMF-ILMLTNEPVYLNQFKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNWNSE 479          
The following BLAST results are available for this feature:
BLAST of slc17a-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC17A67.365e-6728.88solute carrier family 17 member 6 [Source:HGNC Sym... [more]
SLC17A81.807e-6329.28solute carrier family 17 member 8 [Source:HGNC Sym... [more]
SLC17A73.698e-6327.71solute carrier family 17 member 7 [Source:HGNC Sym... [more]
SLC17A78.887e-6027.46solute carrier family 17 member 7 [Source:HGNC Sym... [more]
SLC17A51.064e-5027.12solute carrier family 17 member 5 [Source:HGNC Sym... [more]
back to top
BLAST of slc17a-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eat-41.315e-5428.35Probable vesicular glutamate transporter eat-4 [S... [more]
eat-42.413e-5428.35Probable vesicular glutamate transporter eat-4 [S... [more]
slc-17.19.393e-4321.95SLC (SoLute Carrier) homolog [Source:UniProtKB/Tr... [more]
slc-17.11.085e-4221.95SLC (SoLute Carrier) homolog [Source:UniProtKB/Tr... [more]
vglu-22.176e-3724.62Vesicular GLUtamate transporter [Source:UniProtKB... [more]
back to top
BLAST of slc17a-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VGlut2.955e-5729.81gene:FBgn0031424 transcript:FBtr0307078[more]
VGlut2.955e-5729.81gene:FBgn0031424 transcript:FBtr0331202[more]
VGlut2.955e-5729.81gene:FBgn0031424 transcript:FBtr0077769[more]
MFS96.150e-5425.93gene:FBgn0038799 transcript:FBtr0083889[more]
MFS96.150e-5425.93gene:FBgn0038799 transcript:FBtr0083888[more]
back to top
BLAST of slc17a-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc17a6a4.936e-6728.66solute carrier family 17 member 6a [Source:NCBI ge... [more]
slc17a6b1.020e-6529.76solute carrier family 17 member 6b [Source:NCBI ge... [more]
slc17a81.649e-6328.66solute carrier family 17 member 8 [Source:NCBI gen... [more]
slc17a81.754e-6328.66solute carrier family 17 member 8 [Source:NCBI gen... [more]
slc17a7a6.336e-6227.21solute carrier family 17 member 7a [Source:ZFIN;Ac... [more]
back to top
BLAST of slc17a-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrpap11.117e-6929.53LDL receptor related protein associated protein 1 ... [more]
lrpap13.555e-6929.53LDL receptor related protein associated protein 1 ... [more]
lrpap13.577e-6929.53LDL receptor related protein associated protein 1 ... [more]
lrpap14.275e-6929.53LDL receptor related protein associated protein 1 ... [more]
lrpap15.933e-6929.53LDL receptor related protein associated protein 1 ... [more]
back to top
BLAST of slc17a-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc17a64.901e-6728.88solute carrier family 17 (sodium-dependent inorgan... [more]
Slc17a81.071e-6329.28solute carrier family 17 (sodium-dependent inorgan... [more]
Slc17a72.174e-6327.71solute carrier family 17 (sodium-dependent inorgan... [more]
Slc17a73.882e-6126.76solute carrier family 17 (sodium-dependent inorgan... [more]
Slc17a82.544e-5131.93solute carrier family 17 (sodium-dependent inorgan... [more]
back to top
BLAST of slc17a-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A6QLI1|VGLU2_BOVIN3.090e-6629.09Vesicular glutamate transporter 2 OS=Bos taurus OX... [more]
sp|Q9P2U8|VGLU2_HUMAN3.537e-6628.88Vesicular glutamate transporter 2 OS=Homo sapiens ... [more]
sp|Q9JI12|VGLU2_RAT3.611e-6628.88Vesicular glutamate transporter 2 OS=Rattus norveg... [more]
sp|Q8BLE7|VGLU2_MOUSE5.034e-6628.88Vesicular glutamate transporter 2 OS=Mus musculus ... [more]
sp|Q5W8I8|VGL2A_DANRE7.702e-6529.76Vesicular glutamate transporter 2.1 OS=Danio rerio... [more]
back to top
BLAST of slc17a-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF210.000e+0100.00Slc17a-2 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YJ220.000e+069.67Slc17a-8 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YFB10.000e+065.46Slc17a-4 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A504Z2220.000e+062.40Vesicular glutamate transporter OS=Fasciola gigant... [more]
A0A2H1CTT30.000e+062.40Transporter, major facilitator family protein OS=F... [more]
back to top
BLAST of slc17a-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc17a6b3.631e-6829.26vesicular glutamate transporter 2.1 [Source:NCBI g... [more]
slc17a6b6.655e-6829.26vesicular glutamate transporter 2.1 [Source:NCBI g... [more]
slc17a6a1.280e-6528.66solute carrier family 17 member 6 [Source:NCBI gen... [more]
slc17a6a1.280e-6528.66solute carrier family 17 member 6 [Source:NCBI gen... [more]
slc17a7a1.406e-6227.65vesicular glutamate transporter 1-like [Source:NCB... [more]
back to top
BLAST of slc17a-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc17a6b5.764e-5228.48solute carrier family 17 member 6b [Source:NCBI ge... [more]
ENSPMAT00000010352.14.594e-2927.06pep scaffold:Pmarinus_7.0:GL492704:416:4460:1 gene... [more]
back to top
BLAST of slc17a-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc17a-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO317041.486e-4928.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486714.323e-4925.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455143.760e-4827.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463669.016e-4325.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317121.621e-3924.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc17a-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc17a6a9.438e-6728.66solute carrier family 17 member 6 [Source:NCBI gen... [more]
SLC17A65.324e-6528.67vesicular glutamate transporter 2.1 [Source:NCBI g... [more]
slc17a82.273e-6227.77vesicular glutamate transporter 3 [Source:NCBI gen... [more]
ENSORLT00000010015.28.479e-6126.61vesicular glutamate transporter 1-like [Source:NCB... [more]
slc17a7a2.567e-6027.57vesicular glutamate transporter 1 [Source:NCBI gen... [more]
back to top
BLAST of slc17a-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032477.10.000e+0100.00SMESG000032477.1[more]
SMESG000012683.10.000e+069.67SMESG000012683.1[more]
SMESG000061339.10.000e+065.46SMESG000061339.1[more]
SMESG000019933.12.153e-6429.41SMESG000019933.1[more]
SMESG000075620.11.512e-4726.55SMESG000075620.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30020588
GenBankAKN21525.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020588 ID=SMED30020588|Name=slc17a-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1652bp
AAAAATATCAATTTCCAAAATGAGCAAAAAATAAATAATAAAATTGCAAA
AAAAATTTATTAAATCTCTTCTTATGAAAAACGAATTTCGGCTCAATCGA
CACAGAAATTTTTGTTGCTGTGGACCCGGAAAAAAGCGTTATCTGTTGGC
GTTTTTGTGCACTCTCGGACTGACAATTGTCATTGGGATGAGATCTGAAA
TGCTTGGAATTATTAGCAATTTAAAAAATCAGAGTGACACAAAATTGCAC
GACAAGTCTTCGTTGATTTTCAAACCCTCGGAACATAGGAAGTTACCATG
GACCGAACCATTGATGGAGGATTTCGTTGAGAATGCTGTATTTTTCGCAT
ACATGATCGCCAGTCCGATTGGCGGTTATTTAACTGTCAATCACGATTCG
TCACTTTTATTCGGGAGTTCGGTTGCAATGACCTGTGGAATCAACTTATT
CCTTCCACTTGTAGAAACGATAAGTCAAGACATTACAGCAAAGATTTTCA
TGATTATTTTACTGAGAATTCTTCAGGGACTCGCAGAAGGCTGCCTCATT
CCGGCAATGTTTGGTGTTTTGAGATTCTGGACACCTTGGAATGAAAGATC
GACAATAATTTGTTTGTCCGTTATTGGTGTATCTCTAGGACCTTTGATTG
GATTGCCGGTATGTGTTCAAATTGAAGACAAATGGGGTTGGGGTGTCGTT
TTTTACATTTATGCCAATCTCGGTTTGATTTGGTGCATCTTTTGGTGGCG
TTTAATCGACGAAAAACCAACCAAAGACGATTCTTTGAGTAATTATGAAA
AGAATTTTCTTATTCAATCAATTGAATCTAAAGTTTTAAACGTGAAACGT
CAGTTAAAAATTCCCTGGAAGCACATAATAAAGTCTCGGCCTATTTATGC
TATATTATTTACGTATGCAGCCGACGACTGGACTTTTCAGATCTCTTCTG
TATGCATGCAATCGTATTACCGGCATCAGTATGATTCCAGCATTGATAAA
ACAATTTTCCTACTATCATTCCCATTTTTAGCCAGATCTCTTTTTGTTCC
AATAGGAGGAATTCTAGCAGATGTCATTGGTTTAAAGACTTCGTGGTCTT
GGACACATATCAGAAAATTACTAACCGGGTTAGGATTTGGCTTGAAGGGA
ATATTTTTCGTTGCCATGGGATTCGCACAAGATGAAAAAACAGCGACAGT
ATTATTATCACTTTGTCTAGGATTTTCTGGATTAGCTGTTGCAGGATATG
CAGTAAATGTTGTTGAAATTGCTCCAAATTATGCAGGTTTAATAATGGGT
ATGGCTAGCGGTGTCAGCACATTTACCGGAATAGGAAGCACCGTAATAGC
CTCATTAGTAGTTCATCATGTAAAAAGTCAGGGATGGCGTATAGCCTTAT
GTTTGGCTGCCGCGACTCAATTCTTTTCAATGTCAATGTATCTCTGGTTC
GGATCAAGTGACGAAGAGTTCTGGGCATTTGAACCGAATCAAAGTACGAT
TTCCACGAATAAAGTTGTGATATCCGTTGACACTAATACGAAGGAGGATC
TGCCAATCTCAGTTGTATGATGAATACTCGTCAATTAAAATCTCATTACC
GTTTCGCTTTCAACACAGTGATTGTATTAATTATATAAATCTTTACTTCG
AT
back to top

protein sequence of SMED30020588-orf-1

>SMED30020588-orf-1 ID=SMED30020588-orf-1|Name=SMED30020588-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=499bp
MKNEFRLNRHRNFCCCGPGKKRYLLAFLCTLGLTIVIGMRSEMLGIISNL
KNQSDTKLHDKSSLIFKPSEHRKLPWTEPLMEDFVENAVFFAYMIASPIG
GYLTVNHDSSLLFGSSVAMTCGINLFLPLVETISQDITAKIFMIILLRIL
QGLAEGCLIPAMFGVLRFWTPWNERSTIICLSVIGVSLGPLIGLPVCVQI
EDKWGWGVVFYIYANLGLIWCIFWWRLIDEKPTKDDSLSNYEKNFLIQSI
ESKVLNVKRQLKIPWKHIIKSRPIYAILFTYAADDWTFQISSVCMQSYYR
HQYDSSIDKTIFLLSFPFLARSLFVPIGGILADVIGLKTSWSWTHIRKLL
TGLGFGLKGIFFVAMGFAQDEKTATVLLSLCLGFSGLAVAGYAVNVVEIA
PNYAGLIMGMASGVSTFTGIGSTVIASLVVHHVKSQGWRIALCLAAATQF
FSMSMYLWFGSSDEEFWAFEPNQSTISTNKVVISVDTNTKEDLPISVV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 88..420
e-value: 3.0E-31
score: 108.6
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 19..238
e-value: 3.9E-22
score: 80.6
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 260..465
e-value: 1.1E-20
score: 75.8
NoneNo IPR availablePANTHERPTHR11662SODIUM-DEPENDENT PHOSPHATE TRANSPORTERScoord: 20..478
NoneNo IPR availablePANTHERPTHR11662:SF418VESICULAR GLUTAMATE TRANSPORTER, ISOFORM Acoord: 20..478
NoneNo IPR availableCDDcd17382MFS_SLC17A6_7_8_VGluTcoord: 26..460
e-value: 1.24117E-64
score: 212.2
NoneNo IPR availableTMHMMTMhelixcoord: 407..429
NoneNo IPR availableTMHMMTMhelixcoord: 375..397
NoneNo IPR availableTMHMMTMhelixcoord: 178..200
NoneNo IPR availableTMHMMTMhelixcoord: 88..105
NoneNo IPR availableTMHMMTMhelixcoord: 438..460
NoneNo IPR availableTMHMMTMhelixcoord: 24..46
NoneNo IPR availableTMHMMTMhelixcoord: 349..368
NoneNo IPR availableTMHMMTMhelixcoord: 144..166
NoneNo IPR availableTMHMMTMhelixcoord: 112..134
NoneNo IPR availableTMHMMTMhelixcoord: 205..227
NoneNo IPR availableTMHMMTMhelixcoord: 312..334
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 26..464
score: 8.825
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 20..460