Acid sphingomyelinase-like phosphodiesterase

Overview
NameAcid sphingomyelinase-like phosphodiesterase
Smed IDSMED30020584
Length (bp)1795
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Acid sphingomyelinase-like phosphodiesterase (SMED30020584) t-SNE clustered cells

Violin plots show distribution of expression levels for Acid sphingomyelinase-like phosphodiesterase (SMED30020584) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Acid sphingomyelinase-like phosphodiesterase (SMED30020584) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Acid sphingomyelinase-like phosphodiesterase (SMED30020584) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020584

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30020584h1SMcG0016622 dd_Smed_v4_3479_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020584h1SMcG0016622 dd_Smed_v4_3479_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Human
Match: SMPDL3B (sphingomyelin phosphodiesterase acid like 3B [Source:HGNC Symbol;Acc:HGNC:21416])

HSP 1 Score: 193.356 bits (490), Expect = 1.392e-54
Identity = 126/450 (28.00%), Postives = 217/450 (48.22%), Query Frame = 1
Query:   97 MKNTFLILFFLVLEETQCFKGVFWHVCDVHLNLSYK----------SFGRKQ------FGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRH---RTVSQSDFNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDPKSQ-WCRILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPF--YLSGL--GSVNPSVRLYHW-RTDPADRKYEQYHAKLNDVQTK-TLSWSLEYSSNSL--IPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCLKNCPHKPVSQ 1362
            M+    ++F       +   G FWH+ D+HL+  YK          S G +       +GDY  DSP++L+ S+   MK+I P PDFI+  GD+  H     + ++   + +  ++  +   FP + +  +LGNHD +P N F   S      + E W  + SN S+ +  F KG +Y  ++   +   ++++LNT ++Y+ N+    T +  DP  QF WL   L ++  +   V+++GH+PPG  E +       R GFN K+LK+++    +I   FF H HTD+F+++YD    P+  +FI+P ++P+   L G+  G+ NP++R++ + R   + +    Y   L+    + T  W LEY       +P  SA H    V D    D     +++ Y+     +    C E  +C    +C ++ +D     +CL      PV Q
Sbjct:    1 MRLLAWLIFLANWGGARAEPGKFWHIADLHLDPDYKVSKDPFQVCPSAGSQPVPDAGPWGDYLCDSPWALINSSIYAMKEIEPEPDFILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDFHPKNQFPAGSNNIYNQIAELWKPWLSNESIAL--FKKGAFYCEKLPGPSGAGRIVVLNTNLYYTSNA---LTADMADPGQQFQWLEDVLTDASKAGDMVYIVGHVPPGFFEKTQNK-AWFREGFNEKYLKVVRKHHRVIAGQFFGHHHTDSFRMLYDDAGVPISAMFITPGVTPWKTTLPGVVNGANNPAIRVFEYDRATLSLKDMVTYFMNLSQANAQGTPRWELEYQLTEAYGVPDASA-HSMHTVLDRIAGDQSTLQRYYVYN--SVSYSAGVCDE--ACSMQHVCAMRQVDIDAYTTCLYASGTTPVPQ 439          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Human
Match: SMPDL3B (sphingomyelin phosphodiesterase acid like 3B [Source:HGNC Symbol;Acc:HGNC:21416])

HSP 1 Score: 172.94 bits (437), Expect = 7.227e-48
Identity = 100/333 (30.03%), Postives = 175/333 (52.55%), Query Frame = 1
Query:   97 MKNTFLILFFLVLEETQCFKGVFWHVCDVHLNLSYK----------SFGRKQ------FGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRH---RTVSQSDFNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDPKSQ-WCRILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPF--YLSGL--GSVNPSVRLYHW 1023
            M+    ++F       +   G FWH+ D+HL+  YK          S G +       +GDY  DSP++L+ S+   MK+I P PDFI+  GD+  H     + ++   + +  ++  +   FP + +  +LGNHD +P N F   S      + E W  + SN S+ +  F KG +Y  ++   +   ++++LNT ++Y+ N+    T +  DP  QF WL   L ++  +   V+++GH+PPG  E +       R GFN K+LK+++    +I   FF H HTD+F+++YD    P+  +FI+P ++P+   L G+  G+ NP++R++ +
Sbjct:    1 MRLLAWLIFLANWGGARAEPGKFWHIADLHLDPDYKVSKDPFQVCPSAGSQPVPDAGPWGDYLCDSPWALINSSIYAMKEIEPEPDFILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDFHPKNQFPAGSNNIYNQIAELWKPWLSNESIAL--FKKGAFYCEKLPGPSGAGRIVVLNTNLYYTSNA---LTADMADPGQQFQWLEDVLTDASKAGDMVYIVGHVPPGFFEKTQNK-AWFREGFNEKYLKVVRKHHRVIAGQFFGHHHTDSFRMLYDDAGVPISAMFITPGVTPWKTTLPGVVNGANNPAIRVFEY 327          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Human
Match: SMPDL3A (sphingomyelin phosphodiesterase acid like 3A [Source:HGNC Symbol;Acc:HGNC:17389])

HSP 1 Score: 168.318 bits (425), Expect = 1.945e-45
Identity = 129/420 (30.71%), Postives = 195/420 (46.43%), Query Frame = 1
Query:  157 GVFWHVCDVHLNLSY-----------KSFGRKQ-----FGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRHRTV---SQSDFNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDP-KSQWCRILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFY-LSGLGSVNPSVRLYHWRTDPADRK---YEQYHAKLNDVQTKTLS-WSLEY--SSNSLIPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCLK 1335
            G FWHV D+HL+ +Y            S G        FGD   DSP+ L+ SAF  +K       F+I  GD+  H  V   S       +T+++  +   FP+  + P+LGNHD  P +      S+    +   W  +    +  I T  KG +YS+++T N    ++I LNT ++Y  N     T N  DP NQF WL   L  S+ +  KV++I H+P G    S  +   +R  +N K + I Q ++D+I   F+ H H D+  ++ D    PV  LF++P+++P   +    + NP +RL+ +  DP D K     QY+  L +   K  S W LEY  +    I  L    L  L   FT  DSK F K++ Y         +  + + +C+   IC I N+D      CLK
Sbjct:   38 GQFWHVTDLHLDPTYHITDDHTKVCASSKGANASNPGPFGDVLCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTDTVINVITNMTTTIQSLFPNLQVFPALGNHDYWPQDQLPVVTSKVYNAVANLWKPWLDEEA--ISTLRKGGFYSQKVTTNP-NLRIISLNTNLYYGPN---IMTLNKTDPANQFEWLESTLNNSQQNKEKVYIIAHVPVGYLPSSQNI-TAMREYYNEKLIDIFQKYSDVIAGQFYGHTHRDSIMVLSDKKGSPVNSLFVAPAVTPVKSVLEKQTNNPGIRLFQY--DPRDYKLLDMLQYYLNLTEANLKGESIWKLEYILTQTYDIEDLQPESLYGLAKQFTILDSKQFIKYYNYFFVSY---DSSVTCDKTCKAFQICAIMNLDNISYADCLK 445          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Human
Match: SMPDL3B (sphingomyelin phosphodiesterase acid like 3B [Source:HGNC Symbol;Acc:HGNC:21416])

HSP 1 Score: 157.147 bits (396), Expect = 9.246e-42
Identity = 116/446 (26.01%), Postives = 194/446 (43.50%), Query Frame = 1
Query:   97 MKNTFLILFFLVLEETQCFKGVFWHVCDVHLNLSYK----------SFGRKQ------FGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRHRTVSQSDFNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDPKSQWCRILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPF--YLSGL--GSVNPSVRLYHW-RTDPADRKYEQYHAKLNDVQTK-TLSWSLEYSSNSL--IPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCLKNCPHKPVSQ 1362
            M+    ++F       +   G FWH+ D+HL+  YK          S G +       +GDY  DSP++L+ S+   MK+I P PDFI+  GD+  H              V DE             LG   V                    L+     +  I+    G +Y  ++   +   ++++LNT ++Y+ N+    T +  DP  QF WL   L ++  +   V+++GH+PPG  E +       R GFN K+LK+++    +I   FF H HTD+F+++YD    P+  +FI+P ++P+   L G+  G+ NP++R++ + R   + +    Y   L+    + T  W LEY       +P  SA H    V D    D     +++ Y+     +    C E  +C    +C ++ +D     +CL      PV Q
Sbjct:    1 MRLLAWLIFLANWGGARAEPGKFWHIADLHLDPDYKVSKDPFQVCPSAGSQPVPDAGPWGDYLCDSPWALINSSIYAMKEIEPEPDFILWTGDDTPH--------------VPDE------------KLGEAAV--------------------LEIVERLTKLIREVFPGAFYCEKLPGPSGAGRIVVLNTNLYYTSNA---LTADMADPGQQFQWLEDVLTDASKAGDMVYIVGHVPPGFFEKTQNK-AWFREGFNEKYLKVVRKHHRVIAGQFFGHHHTDSFRMLYDDAGVPISAMFITPGVTPWKTTLPGVVNGANNPAIRVFEYDRATLSLKDMVTYFMNLSQANAQGTPRWELEYQLTEAYGVPDASA-HSMHTVLDRIAGDQSTLQRYYVYN--SVSYSAGVCDE--ACSMQHVCAMRQVDIDAYTTCLYASGTTPVPQ 391          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Human
Match: SMPDL3A (sphingomyelin phosphodiesterase acid like 3A [Source:HGNC Symbol;Acc:HGNC:17389])

HSP 1 Score: 137.887 bits (346), Expect = 1.177e-35
Identity = 99/318 (31.13%), Postives = 152/318 (47.80%), Query Frame = 1
Query:  406 FPSSIILPSLGNHDVNPANFFDP-KSQWCRILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFY-LSGLGSVNPSVRLYHWRTDPADRK---YEQYHAKLNDVQTKTLS-WSLEY--SSNSLIPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCLK 1335
            FP+  + P+LGNHD  P +      S+    +   W  +    +  I T  KG +YS+++T N    ++I LNT ++Y  N  T    N  DP NQF WL   L  S+ +  KV++I H+P G    S  +   +R  +N K + I Q ++D+I   F+ H H D+  ++ D    PV  LF++P+++P   +    + NP +RL+ +  DP D K     QY+  L +   K  S W LEY  +    I  L    L  L   FT  DSK F K++ Y         +  + + +C+   IC I N+D      CLK
Sbjct:    9 FPNLQVFPALGNHDYWPQDQLPVVTSKVYNAVANLWKPWLDEEA--ISTLRKGGFYSQKVTTNP-NLRIISLNTNLYYGPNIMTL---NKTDPANQFEWLESTLNNSQQNKEKVYIIAHVPVGYLPSSQNI-TAMREYYNEKLIDIFQKYSDVIAGQFYGHTHRDSIMVLSDKKGSPVNSLFVAPAVTPVKSVLEKQTNNPGIRLFQY--DPRDYKLLDMLQYYLNLTEANLKGESIWKLEYILTQTYDIEDLQPESLYGLAKQFTILDSKQFIKYYNYFFVSY---DSSVTCDKTCKAFQICAIMNLDNISYADCLK 314          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Celegans
Match: ZK856.5 (pep chromosome:WBcel235:V:10186012:10190157:-1 gene:WBGene00014106.1 transcript:ZK856.5.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK856.5)

HSP 1 Score: 155.606 bits (392), Expect = 3.305e-41
Identity = 117/416 (28.12%), Postives = 185/416 (44.47%), Query Frame = 1
Query:  169 HVCDVHLNLSYKSFGRK----------------QFGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRH-RTVSQSDFNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDPKSQWCRILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIE--------SRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFY--LSGLGSVNPSVRLYHWRTDPADRKYEQYHAKLNDV-QTKTLSWSLEYSSNSLIPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCL 1332
            H+ D HL++ Y   G                  ++GDY  D+P  L++ A  +  +I+PNPD II  GDNV H           ++   +  L   FP+  ILP+ GNHD  P+N F+ +S       E W     + +    TF KG YY  R+      A  ++LNT ++Y+ N       N  DP +QFA+L KEL          S N  + V ++ HI PG  E +P  F   R  +N +FL +   +A+ I    F H HTD F ++ D  +  V    ++P+++P++  L G G+ NP+ R+Y        +    Y   L+D+ + K+  +  EYS      G++   +N        +  K+ D  F  ++       N        R   +C ++  DY +  SCL
Sbjct:   25 HLADFHLDVQYSINGDNKHMCHDDGTERNTTLGEYGDYMCDAPKPLIQLAIDESARIFPNPDLIIWTGDNVAHIDGYGWEIVLDAVNQTTSLLFSRFPNQTILPTFGNHDYAPSNGFESESSLYTKTWELWKGKLGDENK--ATFLKGGYYKYRLR----NATAVVLNTNLYYNANKAYVNFTNKVDPADQFAFLEKELSNAEKCPNRISENCTSIVHIVAHIGPGVFEKTPN-FTWFRDEYNERFLDLTVRYANSIGWMIFGHHHTDTFHLIKDSKENNVQLALMAPAVTPWFSDLPGAGANNPTFRVYETDAYSKIQDISTYFINLDDLNKNKSTPFVFEYSFKDAY-GITG-DINPTTMSALLDKMKNNDTLFKKYIDYNTAFWNPQMPLGVYRGAQLCSMEYSDYPRYYSCL 431          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Celegans
Match: ZK856.5 (pep chromosome:WBcel235:V:10186023:10190366:-1 gene:WBGene00014106.1 transcript:ZK856.5.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK856.5)

HSP 1 Score: 155.606 bits (392), Expect = 3.305e-41
Identity = 117/416 (28.12%), Postives = 185/416 (44.47%), Query Frame = 1
Query:  169 HVCDVHLNLSYKSFGRK----------------QFGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRH-RTVSQSDFNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDPKSQWCRILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIE--------SRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFY--LSGLGSVNPSVRLYHWRTDPADRKYEQYHAKLNDV-QTKTLSWSLEYSSNSLIPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCL 1332
            H+ D HL++ Y   G                  ++GDY  D+P  L++ A  +  +I+PNPD II  GDNV H           ++   +  L   FP+  ILP+ GNHD  P+N F+ +S       E W     + +    TF KG YY  R+      A  ++LNT ++Y+ N       N  DP +QFA+L KEL          S N  + V ++ HI PG  E +P  F   R  +N +FL +   +A+ I    F H HTD F ++ D  +  V    ++P+++P++  L G G+ NP+ R+Y        +    Y   L+D+ + K+  +  EYS      G++   +N        +  K+ D  F  ++       N        R   +C ++  DY +  SCL
Sbjct:   25 HLADFHLDVQYSINGDNKHMCHDDGTERNTTLGEYGDYMCDAPKPLIQLAIDESARIFPNPDLIIWTGDNVAHIDGYGWEIVLDAVNQTTSLLFSRFPNQTILPTFGNHDYAPSNGFESESSLYTKTWELWKGKLGDENK--ATFLKGGYYKYRLR----NATAVVLNTNLYYNANKAYVNFTNKVDPADQFAFLEKELSNAEKCPNRISENCTSIVHIVAHIGPGVFEKTPN-FTWFRDEYNERFLDLTVRYANSIGWMIFGHHHTDTFHLIKDSKENNVQLALMAPAVTPWFSDLPGAGANNPTFRVYETDAYSKIQDISTYFINLDDLNKNKSTPFVFEYSFKDAY-GITG-DINPTTMSALLDKMKNNDTLFKKYIDYNTAFWNPQMPLGVYRGAQLCSMEYSDYPRYYSCL 431          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Celegans
Match: ZK856.5 (pep chromosome:WBcel235:V:10186023:10190131:-1 gene:WBGene00014106.1 transcript:ZK856.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK856.5)

HSP 1 Score: 155.606 bits (392), Expect = 3.305e-41
Identity = 117/416 (28.12%), Postives = 185/416 (44.47%), Query Frame = 1
Query:  169 HVCDVHLNLSYKSFGRK----------------QFGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRH-RTVSQSDFNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDPKSQWCRILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIE--------SRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFY--LSGLGSVNPSVRLYHWRTDPADRKYEQYHAKLNDV-QTKTLSWSLEYSSNSLIPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCL 1332
            H+ D HL++ Y   G                  ++GDY  D+P  L++ A  +  +I+PNPD II  GDNV H           ++   +  L   FP+  ILP+ GNHD  P+N F+ +S       E W     + +    TF KG YY  R+      A  ++LNT ++Y+ N       N  DP +QFA+L KEL          S N  + V ++ HI PG  E +P  F   R  +N +FL +   +A+ I    F H HTD F ++ D  +  V    ++P+++P++  L G G+ NP+ R+Y        +    Y   L+D+ + K+  +  EYS      G++   +N        +  K+ D  F  ++       N        R   +C ++  DY +  SCL
Sbjct:   25 HLADFHLDVQYSINGDNKHMCHDDGTERNTTLGEYGDYMCDAPKPLIQLAIDESARIFPNPDLIIWTGDNVAHIDGYGWEIVLDAVNQTTSLLFSRFPNQTILPTFGNHDYAPSNGFESESSLYTKTWELWKGKLGDENK--ATFLKGGYYKYRLR----NATAVVLNTNLYYNANKAYVNFTNKVDPADQFAFLEKELSNAEKCPNRISENCTSIVHIVAHIGPGVFEKTPN-FTWFRDEYNERFLDLTVRYANSIGWMIFGHHHTDTFHLIKDSKENNVQLALMAPAVTPWFSDLPGAGANNPTFRVYETDAYSKIQDISTYFINLDDLNKNKSTPFVFEYSFKDAY-GITG-DINPTTMSALLDKMKNNDTLFKKYIDYNTAFWNPQMPLGVYRGAQLCSMEYSDYPRYYSCL 431          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Celegans
Match: asm-2 (Sphingomyelin phosphodiesterase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q23498])

HSP 1 Score: 107.071 bits (266), Expect = 4.694e-24
Identity = 97/392 (24.74%), Postives = 164/392 (41.84%), Query Frame = 1
Query:  232 YKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRHRTVSQSD--FNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDPKS---------QWC-RILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPL---FISPSISPFYLSGLGSVNPSVRLYHWRTDPADRKYEQYHAKLNDVQT------------KTLSWSLEYSSNSLIPGLSAFHLNELVSDFTKED-SKHFDKFFT--------YHLSGRPHEQNECSENISCRCNIICGIQ 1299
            Y  D P+   +SA + + K + + D+II+ GD   H +   ++    +++ ++++  L  FP   +  S+GNH+  P +   P +         QW  +I+ E W  +    +L+        Y +          K+I LNT+    FN + +   N  DP     WL +EL +S N    V +I HIPPG +        +   G++  F +I++ + + I   F+ H H D F + YD +D    P    +ISPS++ +       +NP+ R+Y       D  YE     + D +T            K   W L Y +            +  ++DF+ +  S   DK +T          L  R H  NEC  +  CR   +C I+
Sbjct:  247 YLCDLPYQTFESAMKHISKTFKDLDYIIITGDFEAHDSWDYTEDLTRENMNNMTNVFLEYFPGVPVYVSIGNHEGVPQDAMAPHTMPEYDTRGPQWLYKIMSEMWSHWIPQEALDTVQ-----YRASYAVYPKPGLKLISLNTIYCSEFNFYLYV--NEVDPDATLEWLIEELQDSENKGELVHIISHIPPGDN--------YCLKGWSWNFFEIVKRYENTIAQMFYGHTHYDQFMVYYDMDDPNRRPFHFNWISPSLTTY-----DWLNPAYRIYE-----IDGGYEGATYTVKDAKTYFANVTEANMKNKEPEWVLSYDTRE----------HYQMADFSPQSWSDLSDKLWTNTTLFRDYVRLYYRNHYNNECYTDYKCRYTFVCDIK 603          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Celegans
Match: asm-1 (Sphingomyelin phosphodiesterase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q10916])

HSP 1 Score: 104.375 bits (259), Expect = 3.017e-23
Identity = 106/380 (27.89%), Postives = 168/380 (44.21%), Query Frame = 1
Query:  235 KSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRHRTVSQS-DFNKSLTDVSDELLHN-FPSSIILPSLGNHDVNPANFFDPKSQ----WCRILLEK-------WLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYD--HN--DKPVIPLFISPSISPFYLSGLGSVNPSVRLYHWRTDPADR----KYEQYHAKLNDV-QTKTLSWSLEYSSNSL--IPGLSAFHLNELVSD-FTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQ 1299
            K D PF  V++    + K +   D +I+ GD + H     S + + S+      L+ N FPS+ I  +LGNH+  P N F P S     W   L ++       WL   + +SL      +G Y ++ +       K+I LNT   +   ++ F   N  DP +  +W  KEL ES     +V+++ HIPPG SE           G+   + +++Q F+  I A FF H H D F + Y+  HN   KP+   + SPS++ F        NP+ R+Y    DP ++     +  Y+A L    + K   W   YS+     +  LS    N+++   FT E  +  +KF+ Y              N S +C+  C +Q
Sbjct:  205 KCDIPFWTVENMLSHINKTH-MIDMVIMTGDYINHVDWEYSIEEHLSVLRKLHRLVQNTFPSTPIYWALGNHEGVPVNSFAPHSVDERFWPTWLYKEFQTMSGPWLSEGAKDSL----LKRGSYSTQVMD----GLKLITLNTG--FCEVTNFFLYLNQSDPDSSMSWFVKELFESEKKGEQVYVLAHIPPGDSE--------CLEGWAFNYYRVIQRFSSTIAAQFFGHDHLDYFTVFYEDMHNVSSKPISVGYASPSVTTFEYQ-----NPAYRIY--EIDPYNKFKIVDFTTYYADLEKATEDKKPVWEKLYSARQAHGMDDLSPLSWNKVIQKLFTSEKKR--EKFYQYAF-----------RNFSPQCDSTCQMQ 545          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Fly
Match: CG32052 (gene:FBgn0044328 transcript:FBtr0347598)

HSP 1 Score: 146.362 bits (368), Expect = 1.785e-37
Identity = 126/472 (26.69%), Postives = 211/472 (44.70%), Query Frame = 1
Query:  115 ILFFLVLEETQCFKGVFWHVCDVHLNLSYKSFGR-------------------------KQFGDYKSDSPFSLVKSAFQQMK-KIYPNPDFIILNGDNVRH--RTVSQSDFNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDPKSQWCRILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNT----------------MVW----YSFNSHTFTTQNSDDPL---NQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNM---------KFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFYLSGLGSV-NPSVRLYHWRTDPAD-RKYEQYHAKLNDV-QTKTLSWSLEYSSNS--LIPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCLK 1335
            +L +  L   Q   G FWH+ D+HL+  Y + G                            FG Y  DSP+ L++SA + MK K   N +F++  GD + H  + +S+   ++ L ++++ L  +F S  I P LG+ D + +          R L E W  +  + +L   TF +G YYS   T + +  +++ LNT                + W    ++    + ++ +++D L    Q+ WL + L +S+     V+++GH+PPG  E      RHL    N          ++L +++ FA +I   FF H H+D F+++YD    P+  L I+PSI P   +G+GS  NP++RLY + T       Y Q+   L    +    +W  EY+      +P +SA  L+     FT  D   F ++   + + R H  + C     C  N  C I  +DY +   CL+
Sbjct:   12 LLAYSGLPGAQARIGYFWHISDLHLDTLYSTQGDIYRSCWELARSVSGSNANSAASEPPGPFGHYNCDSPWRLIESAVKTMKAKQGDNVEFVLWTGDALSHSAQPLSEQKQHEILRNITELLGRSFSSQFIFPVLGHEDGSGS---------YRRLGELWRHWLPSEAL--VTFDQGGYYSIEQTKSRL--RIVALNTNFMRLDPDPDPRASLSLRWPAEYFAEPKASVSSISAEDELLAEQQWLWLEEVLTKSKEKQETVYIVGHMPPGVDE------RHLGTQHNQLTFTERNNQRYLDMVRRFAPVIQGQFFGHLHSDTFRLIYDAKGNPISWLMIAPSIVP-RKAGIGSSNNPALRLYKFDTGSGQVLDYTQFWLDLPLANRANEPTWQPEYNLTHYYALPEISAVALHNFAERFTGTDLSWFTRYHRAN-AVRYHSGSACPG--LCMLNHYCAITRLDYDEFRICLE 460          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Fly
Match: CG32052 (gene:FBgn0044328 transcript:FBtr0347599)

HSP 1 Score: 146.362 bits (368), Expect = 1.785e-37
Identity = 126/472 (26.69%), Postives = 211/472 (44.70%), Query Frame = 1
Query:  115 ILFFLVLEETQCFKGVFWHVCDVHLNLSYKSFGR-------------------------KQFGDYKSDSPFSLVKSAFQQMK-KIYPNPDFIILNGDNVRH--RTVSQSDFNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDPKSQWCRILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNT----------------MVW----YSFNSHTFTTQNSDDPL---NQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNM---------KFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFYLSGLGSV-NPSVRLYHWRTDPAD-RKYEQYHAKLNDV-QTKTLSWSLEYSSNS--LIPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCLK 1335
            +L +  L   Q   G FWH+ D+HL+  Y + G                            FG Y  DSP+ L++SA + MK K   N +F++  GD + H  + +S+   ++ L ++++ L  +F S  I P LG+ D + +          R L E W  +  + +L   TF +G YYS   T + +  +++ LNT                + W    ++    + ++ +++D L    Q+ WL + L +S+     V+++GH+PPG  E      RHL    N          ++L +++ FA +I   FF H H+D F+++YD    P+  L I+PSI P   +G+GS  NP++RLY + T       Y Q+   L    +    +W  EY+      +P +SA  L+     FT  D   F ++   + + R H  + C     C  N  C I  +DY +   CL+
Sbjct:   12 LLAYSGLPGAQARIGYFWHISDLHLDTLYSTQGDIYRSCWELARSVSGSNANSAASEPPGPFGHYNCDSPWRLIESAVKTMKAKQGDNVEFVLWTGDALSHSAQPLSEQKQHEILRNITELLGRSFSSQFIFPVLGHEDGSGS---------YRRLGELWRHWLPSEAL--VTFDQGGYYSIEQTKSRL--RIVALNTNFMRLDPDPDPRASLSLRWPAEYFAEPKASVSSISAEDELLAEQQWLWLEEVLTKSKEKQETVYIVGHMPPGVDE------RHLGTQHNQLTFTERNNQRYLDMVRRFAPVIQGQFFGHLHSDTFRLIYDAKGNPISWLMIAPSIVP-RKAGIGSSNNPALRLYKFDTGSGQVLDYTQFWLDLPLANRANEPTWQPEYNLTHYYALPEISAVALHNFAERFTGTDLSWFTRYHRAN-AVRYHSGSACPG--LCMLNHYCAITRLDYDEFRICLE 460          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Fly
Match: CG32052 (gene:FBgn0044328 transcript:FBtr0332818)

HSP 1 Score: 146.362 bits (368), Expect = 1.785e-37
Identity = 126/472 (26.69%), Postives = 211/472 (44.70%), Query Frame = 1
Query:  115 ILFFLVLEETQCFKGVFWHVCDVHLNLSYKSFGR-------------------------KQFGDYKSDSPFSLVKSAFQQMK-KIYPNPDFIILNGDNVRH--RTVSQSDFNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDPKSQWCRILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNT----------------MVW----YSFNSHTFTTQNSDDPL---NQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNM---------KFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFYLSGLGSV-NPSVRLYHWRTDPAD-RKYEQYHAKLNDV-QTKTLSWSLEYSSNS--LIPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCLK 1335
            +L +  L   Q   G FWH+ D+HL+  Y + G                            FG Y  DSP+ L++SA + MK K   N +F++  GD + H  + +S+   ++ L ++++ L  +F S  I P LG+ D + +          R L E W  +  + +L   TF +G YYS   T + +  +++ LNT                + W    ++    + ++ +++D L    Q+ WL + L +S+     V+++GH+PPG  E      RHL    N          ++L +++ FA +I   FF H H+D F+++YD    P+  L I+PSI P   +G+GS  NP++RLY + T       Y Q+   L    +    +W  EY+      +P +SA  L+     FT  D   F ++   + + R H  + C     C  N  C I  +DY +   CL+
Sbjct:   12 LLAYSGLPGAQARIGYFWHISDLHLDTLYSTQGDIYRSCWELARSVSGSNANSAASEPPGPFGHYNCDSPWRLIESAVKTMKAKQGDNVEFVLWTGDALSHSAQPLSEQKQHEILRNITELLGRSFSSQFIFPVLGHEDGSGS---------YRRLGELWRHWLPSEAL--VTFDQGGYYSIEQTKSRL--RIVALNTNFMRLDPDPDPRASLSLRWPAEYFAEPKASVSSISAEDELLAEQQWLWLEEVLTKSKEKQETVYIVGHMPPGVDE------RHLGTQHNQLTFTERNNQRYLDMVRRFAPVIQGQFFGHLHSDTFRLIYDAKGNPISWLMIAPSIVP-RKAGIGSSNNPALRLYKFDTGSGQVLDYTQFWLDLPLANRANEPTWQPEYNLTHYYALPEISAVALHNFAERFTGTDLSWFTRYHRAN-AVRYHSGSACPG--LCMLNHYCAITRLDYDEFRICLE 460          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Fly
Match: CG3376 (gene:FBgn0034997 transcript:FBtr0072265)

HSP 1 Score: 103.99 bits (258), Expect = 6.984e-23
Identity = 80/281 (28.47%), Postives = 127/281 (45.20%), Query Frame = 1
Query:  220 QFGDY-KSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRHRTVSQSDFN--KSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDP--------KSQWCRILLE-KWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHND--KPVIPLFISPSISPFYLSGLGSVNPSVRLYH 1020
            ++GDY K D+P   V      + + + + D+I+  GD   H   +Q+       + D   +++  FP   I P+LGNH+  P N F P           W    L+ +W ++   +     T  +G +YS  +       ++I LN    Y  N + +   NS DP  +  W   EL  +  S  KV +IGHIPPG S+      R+        F KI+  +   + A F+ H H D F++ YD +D   P    +I PS+SP+Y      +NP  R+Y+
Sbjct:  314 KWGDYRKCDTPKRTVDHMLSHIAETHKDIDYILWTGDLPPHDVWNQTKEENLAIIKDTVKQMVEMFPGVPIFPALGNHESAPVNSFPPPYVNQVDISISWLYDELDIQWRRWLPQSV--THTVRRGAFYSVLVRPG---FRIISLNMN--YCNNKNWWLLLNSTDPATELQWFIYELQSAEFSNEKVHVIGHIPPGHSDCLKVWSRN--------FYKIISRYESTVTAQFYGHTHYDEFEMFYDPHDLNHPNGIAYIGPSVSPYY-----DLNPGYRIYY 574          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Fly
Match: CG3376 (gene:FBgn0034997 transcript:FBtr0072266)

HSP 1 Score: 103.99 bits (258), Expect = 6.997e-23
Identity = 80/281 (28.47%), Postives = 127/281 (45.20%), Query Frame = 1
Query:  220 QFGDY-KSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRHRTVSQSDFN--KSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDP--------KSQWCRILLE-KWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHND--KPVIPLFISPSISPFYLSGLGSVNPSVRLYH 1020
            ++GDY K D+P   V      + + + + D+I+  GD   H   +Q+       + D   +++  FP   I P+LGNH+  P N F P           W    L+ +W ++   +     T  +G +YS  +       ++I LN    Y  N + +   NS DP  +  W   EL  +  S  KV +IGHIPPG S+      R+        F KI+  +   + A F+ H H D F++ YD +D   P    +I PS+SP+Y      +NP  R+Y+
Sbjct:  314 KWGDYRKCDTPKRTVDHMLSHIAETHKDIDYILWTGDLPPHDVWNQTKEENLAIIKDTVKQMVEMFPGVPIFPALGNHESAPVNSFPPPYVNQVDISISWLYDELDIQWRRWLPQSV--THTVRRGAFYSVLVRPG---FRIISLNMN--YCNNKNWWLLLNSTDPATELQWFIYELQSAEFSNEKVHVIGHIPPGHSDCLKVWSRN--------FYKIISRYESTVTAQFYGHTHYDEFEMFYDPHDLNHPNGIAYIGPSVSPYY-----DLNPGYRIYY 574          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Zebrafish
Match: smpdl3b (sphingomyelin phosphodiesterase acid like 3B [Source:ZFIN;Acc:ZDB-GENE-041008-132])

HSP 1 Score: 189.504 bits (480), Expect = 2.685e-53
Identity = 122/439 (27.79%), Postives = 215/439 (48.97%), Query Frame = 1
Query:   97 MKNTFLILFFLVLEETQCFKGVFWHVCDVHLNLSY-----------KSFGR-----KQFGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRH---RTVSQSDFNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDP-KSQWCRILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFY--LSGL--GSVNPSVRLYHWRTDPADRK-YEQYHAKLNDVQTKTLSWSLEYSSNSL--IPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCL 1332
            M    L+  F+V   +    G FWH+ D+H + SY            S GR      ++GDY  DSP+SL+ S+   M++I P+PDFI+  GD+  H     + +    + + ++++ +   FP + +  ++GNHD +P N   P KS         W  +    S E  TF  G YY+ ++ +N    +VI+LNT ++Y  N     T+   DP +QF+W +K L ++  +  KV+LIGH+PPG  E         R  FN ++++++Q  + +I   FF H HTD+F++ Y+    P+  ++++P ++P+   L G+  G  NP +R++ + T     K    Y+  L         W  EY       +P  S   ++ ++   + E      K+F   L+   ++ +EC  +  CR + +C ++ +DY   + C+
Sbjct:    3 MWKCILLSIFIVFGRSDALTGYFWHISDLHWDPSYDLSSSSQSKCASSGGRPTPHAGRYGDYVCDSPWSLINSSLTAMREILPDPDFIMWTGDDTPHVPDDQLGEQAVLRIIGNLTNIIKSTFPKTKVYSAMGNHDYHPKNQMPPAKSTIYEQTANLWRDWLHTASQE--TFKTGGYYTEKL-LNQTGLRVIVLNTNLYYDQNK---LTEKVKDPADQFSWADKVLQDAAKNNEKVYLIGHVPPGLFEKKRDK-GWFRKEFNKRYIELIQKHSAVIMGQFFGHHHTDSFRMFYNSKGSPISAMYLTPGVTPWITTLPGVIDGGNNPGIRIFEYDTKTLLVKDIITYYLNLTYANIARARWEKEYRLTEAFRVPDASPASMHRVMERISSEKCS-LQKYF--ELNSVSYDLSECHAD--CRVDHVCALREVDYDAYEKCV 429          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Zebrafish
Match: smpdl3a (sphingomyelin phosphodiesterase acid like 3A [Source:ZFIN;Acc:ZDB-GENE-050327-61])

HSP 1 Score: 145.976 bits (367), Expect = 1.114e-37
Identity = 103/345 (29.86%), Postives = 167/345 (48.41%), Query Frame = 1
Query:  163 FWHVCDVHLNLSY----------------KSFGRKQFGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRH---RTVSQSDFNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDPKSQ-----WCRILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFYLSGLG--SVNPSVRLYHWRTDPAD-RKYEQYHAKLNDVQTKTLS-WSLEY 1113
            FWH+ D+HL+ +Y                 +     FGD+  DSP+ L+ SAF  MK++   P+FII  GD+  H     +S       + +++  +   FP   + P+LGNHD  P + F P S+         L   WL     N   + T  KG +YS  I       +++ LNT ++YS N     T N  DP  QF WL + L  SR S  KV++I H+P G   ++      +R  +N + +KI ++++++++  F+ H H D+  ++ D   KPV  +F++P+++P   S +   S NP VR Y ++ D        Q++  L +   +  S W LEY
Sbjct:   36 FWHISDLHLDPTYHVTEDHTKVCFSSKGVPALDPGVFGDFLCDSPYQLILSAFSYMKQVDLQPEFIIWTGDSPPHVPKEELSTDVVINVIANMTRTIQQFFPQIPVYPALGNHDYWPQDQF-PTSENAIYDAVAKLWSPWL-----NPAAVATLQKGGFYSLVIKPG---LRLLSLNTNLYYSPNE---VTVNMSDPAGQFQWLQETLELSRQSMEKVYVIAHVPIGYLPFAKNT-TAMRENYNEQLVKIFRNYSEVVEGQFYGHTHRDSIMVLLDQQGKPVNSIFVTPAVTPIK-SQIEPFSNNPGVRAYLYQPDSYTLLDIWQFYLNLTEANLEQRSGWKLEY 366          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Zebrafish
Match: smpd1 (sphingomyelin phosphodiesterase 1 [Source:ZFIN;Acc:ZDB-GENE-110411-222])

HSP 1 Score: 112.079 bits (279), Expect = 2.074e-25
Identity = 106/407 (26.04%), Postives = 179/407 (43.98%), Query Frame = 1
Query:  196 SYKSFGRKQFGDY-KSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRHRTVSQSDFNKSLTDVS--DELLHNFPSS--IILPSLGNHDVNPANFFDP-------KSQWC-RILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHN--DKPVIPLFISPSISPFYLSGLGSVNPSVRLYHWRTDPADRK-----YEQYHAKLNDVQTKTL------SWSLEYSSNSLIPGLSAF---HLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSC 1329
            S++  G   +G Y K D P   V++  + + K  P  D++   GD   H   SQ+  N+ L ++     L+H        + P++GNH+  P N F P        S+W    + ++W  +    +LE  T  +G +YS  +       +++ LN    +    + +   NS DP +Q  WL + L ES N   KV +IGHIPPG    S          ++  +  I+  +   I   FF H HTD F++ YD     +P+   FI+PS++ F      ++NP  R+Y+   +  D       +E +   L     + L      SW+L Y ++    GLS      +  L+     +D + F +F  ++L  + H    C +  +C+ +IIC + +  Y  L  C
Sbjct:  286 SWRHAGAGYWGTYSKCDLPLRTVENLLENVAKSGPW-DWVYWTGDIPAHNVWSQTR-NQQLNELVTISRLIHKHLGRNVTVYPAVGNHESTPVNSFPPPFVHGNHSSRWLYETMAKEWAPWLPEEALE--TIRRGGFYSVEVEPG---LRLVSLNMN--FCSRENYWLMVNSTDPADQLQWLIQILQESENKGEKVHIIGHIPPGFCLSS----------WSWNYYHIVNRYESTITGQFFGHTHTDEFQMFYDEETLTRPLSVAFIAPSVTTFV-----NLNPGYRVYYVDGNYPDSSRMVLDHETFILNLTLANNRPLKPDPRPSWTLLYRASEAY-GLSTLFPSDMEALIKHMVNDD-RIFQQF--WYLFHKGHVSKPCKD--TCKTSIICFLHSGRYDLLTQC 662          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Zebrafish
Match: smpdl3a (sphingomyelin phosphodiesterase acid like 3A [Source:ZFIN;Acc:ZDB-GENE-050327-61])

HSP 1 Score: 84.7297 bits (208), Expect = 2.906e-18
Identity = 47/153 (30.72%), Postives = 82/153 (53.59%), Query Frame = 1
Query:  667 NSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFYLSGLG--SVNPSVRLYHWRTDPAD-RKYEQYHAKLNDVQTKTLS-WSLEY 1113
            N  DP  QF WL + L  SR S  KV++I H+P G   ++      +R  +N + +KI ++++++++  F+ H H D+  ++ D   KPV  +F++P+++P   S +   S NP VR Y ++ D        Q++  L +   +  S W LEY
Sbjct:    1 NMSDPAGQFQWLQETLELSRQSMEKVYVIAHVPIGYLPFAKNT-TAMRENYNEQLVKIFRNYSEVVEGQFYGHTHRDSIMVLLDQQGKPVNSIFVTPAVTPIK-SQIEPFSNNPGVRAYLYQPDSYTLLDIWQFYLNLTEANLEQRSGWKLEY 151          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Xenopus
Match: ak9 (adenylate kinase 9 [Source:Xenbase;Acc:XB-GENE-994660])

HSP 1 Score: 192.971 bits (489), Expect = 2.287e-54
Identity = 138/444 (31.08%), Postives = 218/444 (49.10%), Query Frame = 1
Query:   97 MKNTFLILFFLVLEETQCFKGVFWHVCDVHL--NLSYKSFGRK--------------QFGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRHRTVSQSDFNKSLTDV---SDELLHNFPSSIILPSLGNHDVNPANFFDP--KSQWCRILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPF--YLSGL--GSVNPSVRLYHWRTDPADRKYEQ----YHAKLNDVQTKTLSWSLEY--SSNSLIPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCLK 1335
            MK  F +L    +  +    G FWH+ D+HL  N S  S  RK              Q+G+Y  DSP  L+ S+   MK I PNPDFI+  GD+  H    Q   +  L  +   ++ +   FP++ +  +LGNHD +P +   P   S + RI  E W  +  N SL   +F KG YYS  +       ++I+LNT ++Y  NS    T N  DP +QF WL  +L  +     KV+++GH+PPG  E         R  FN ++++I+Q    +I   FF H HTD+F++ Y  +  PV  +FI+P ++P+   L G+  G+ NP +R+  +     DR+  Q    Y+  L      +  W  EY  +    IP  SA  ++++V   +  DS +  K++ Y  +   ++   C  N +CR + +C I+ +D+ K   C+K
Sbjct:    1 MKAFFFLLLAGSVRLSTTELGYFWHLTDLHLDPNYSVTSDPRKVCPSAGDQLVPDAGQWGNYLCDSPRILINSSINAMKSILPNPDFILWTGDDTPHVPNEQLGEDAVLEIIRWLTNLIQQTFPTTKVYSALGNHDFHPKSQLPPHNNSIYDRIS-EFWSPWLKNESLP--SFRKGAYYSEELKDVGAAGRMIVLNTNLYYDSNS---LTANMKDPGDQFQWLEDQLNNANLKGEKVYIVGHVPPGYFEKKRDK-PWFREEFNKRYIEIIQKHHRVIQGQFFGHHHTDSFRMFYSDSGTPVSSMFIAPGVTPWKTTLPGVENGANNPGIRVVEY-----DRQNLQDIVTYYLNLTYANKVSPRWEKEYRLTEAYQIPDCSAQSMHDVVKKISN-DSCYLQKYYKY--NSVSYDLEAC--NKTCRVDHVCAIREVDFNKYKECVK 427          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Xenopus
Match: smpdl3a (sphingomyelin phosphodiesterase acid-like 3A [Source:NCBI gene;Acc:595006])

HSP 1 Score: 170.629 bits (431), Expect = 2.460e-46
Identity = 136/429 (31.70%), Postives = 206/429 (48.02%), Query Frame = 1
Query:  136 EETQCFKGVFWHVCDVHLNLSY-----------KSFGRKQ-----FGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRHRTVSQSDFNKSLTDVSDELLHN----FPSSIILPSLGNHDVNPANFFDPK-SQWCRILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITA---KVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFYLSGL--GSVNPSVRLYHW-RTDPADRKYEQYHAKLNDVQTKTL-SWSLEY--SSNSLIPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCL 1332
            EET    G FWH+ D+HL+ SY            S G K      FGD+  DSP+ L+ SA Q +K  +   DF+I  GD+  H  V +    K + DV   +        P  ++ P+LGNHD  P +    K S+    + E W  + +  +L   TF KG YYS+ I  +N +A   ++I LNT ++Y+ N     T N  DP NQF WL   L  SR +  KV++I H+P G   ++  +   +R  FN + +KI ++++D+I A F+ H H D+  ++ D  +KPV  +F++P+++P   S L   S NP  RLY +  TD        Y   L +   K   SW+LEY  +    I  L    L  LV  F + +S  F  ++  +L       +    +  C+   IC IQ +D      C+
Sbjct:   30 EET---AGQFWHISDLHLDFSYHITEDRTKVCLSSKGAKASNPGIFGDFVCDSPYELILSAIQYIKDSHQKVDFMIWTGDSPPHIPVKELS-TKIVIDVIGNMTSTIRSLLPDLLVFPALGNHDYWPQDQLPVKESEVYTAVAEFWKPWLTEEAL--STFRKGGYYSQ-IYKSNKSAHSLRIISLNTNLYYTPNK---VTVNMTDPANQFEWLEDTLKISRQNNEKVYIIAHVPVGYLPFA-RLTPAMRETFNERLVKIFRNYSDVITAQFYGHTHRDSIMVLLDEKEKPVGSVFVTPAVTPIR-SALETDSNNPGFRLYQYDTTDYHLLDLWHYFLNLTEANLKNESSWNLEYIMTKTYQIKDLQPESLEGLVKRFQQPESIEFLYYYKNYLVSF---DSRVGCDPLCKLQQICAIQYVDEESYTKCI 443          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Xenopus
Match: smpdl3a (sphingomyelin phosphodiesterase acid-like 3A [Source:NCBI gene;Acc:595006])

HSP 1 Score: 168.703 bits (426), Expect = 7.935e-46
Identity = 132/420 (31.43%), Postives = 202/420 (48.10%), Query Frame = 1
Query:  163 FWHVCDVHLNLSY-----------KSFGRKQ-----FGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRHRTVSQSDFNKSLTDVSDELLHN----FPSSIILPSLGNHDVNPANFFDPK-SQWCRILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITA---KVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFYLSGL--GSVNPSVRLYHW-RTDPADRKYEQYHAKLNDVQTKTL-SWSLEY--SSNSLIPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCL 1332
            FWH+ D+HL+ SY            S G K      FGD+  DSP+ L+ SA Q +K  +   DF+I  GD+  H  V +    K + DV   +        P  ++ P+LGNHD  P +    K S+    + E W  + +  +L   TF KG YYS+ I  +N +A   ++I LNT ++Y+ N     T N  DP NQF WL   L  SR +  KV++I H+P G   ++  +   +R  FN + +KI ++++D+I A F+ H H D+  ++ D  +KPV  +F++P+++P   S L   S NP  RLY +  TD        Y   L +   K   SW+LEY  +    I  L    L  LV  F + +S  F  ++  +L       +    +  C+   IC IQ +D      C+
Sbjct:   12 FWHISDLHLDFSYHITEDRTKVCLSSKGAKASNPGIFGDFVCDSPYELILSAIQYIKDSHQKVDFMIWTGDSPPHIPVKELS-TKIVIDVIGNMTSTIRSLLPDLLVFPALGNHDYWPQDQLPVKESEVYTAVAEFWKPWLTEEAL--STFRKGGYYSQ-IYKSNKSAHSLRIISLNTNLYYTPNK---VTVNMTDPANQFEWLEDTLKISRQNNEKVYIIAHVPVGYLPFA-RLTPAMRETFNERLVKIFRNYSDVITAQFYGHTHRDSIMVLLDEKEKPVGSVFVTPAVTPI-RSALETDSNNPGFRLYQYDTTDYHLLDLWHYFLNLTEANLKNESSWNLEYIMTKTYQIKDLQPESLEGLVKRFQQPESIEFLYYYKNYLVSF---DSRVGCDPLCKLQQICAIQYVDEESYTKCI 419          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Xenopus
Match: SMPD1 (sphingomyelin phosphodiesterase 1 [Source:NCBI gene;Acc:100487433])

HSP 1 Score: 102.064 bits (253), Expect = 2.743e-22
Identity = 102/394 (25.89%), Postives = 167/394 (42.39%), Query Frame = 1
Query:  211 GRKQFGDY-KSDSPFSLVKSAFQQMKKIYPNPDFIILNGD----NVRHRT-VSQSDFNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDP-------KSQWC-RILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHN--DKPVIPLFISPSISPFYLSGLGSVNPSVRLYHWRTDPADRKYEQYHAKLNDVQTKTLS-------------WSLEYSSNSLIPGLSAFHLN-ELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQN 1302
            G   +G Y K D P   ++S  +Q+    P    +   GD    NV  +T   Q D  ++LT +  + L   P   + P++GNH+  P N F P        S W    + ++W  +   ++L   T     +Y+  I       +++ LN    +    + +   N  DP  Q  WL + L E+     KV +IGHIPPG    S          ++  + +I+  +   I A FF H H D F++ YD     +PV   FISPS++ F      ++NP  R+Y       D +Y +    + D +T  L+             W+L Y +       SAF  + EL++    +D + F  F+  H  G  H    C EN  C+  ++C +++
Sbjct:  127 GAGYWGTYSKCDLPLHTIESLLRQVSAQGPY-QAVYWTGDIPAHNVWQQTRADQLDALRTLTGLIRKYLGAVP---VYPAVGNHESTPVNSFPPPYVQGNLSSHWLYHSMAQEWHHWLPQSALS--TLRTAGFYTVPI---GPRLRLVSLNMN--FCDLGNFWLLINYTDPAGQLQWLVEVLQEAEEKGEKVHIIGHIPPGLCLKS----------WSWNYYRIVNRYESTIAAQFFGHTHLDEFEMFYDEETLTRPVSVAFISPSVTTFI-----NLNPGYRVYQ-----IDGEYPESSHMVLDHETYILNLTEANARPGQDPRWTLLYRALETYGMKSAFPADWELLTRRFLQDERLFQTFWYLHHKG--HVDEVCQEN--CKTTLLCALRS 485          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Mouse
Match: Smpdl3b (sphingomyelin phosphodiesterase, acid-like 3B [Source:MGI Symbol;Acc:MGI:1916022])

HSP 1 Score: 179.489 bits (454), Expect = 1.630e-49
Identity = 123/430 (28.60%), Postives = 208/430 (48.37%), Query Frame = 1
Query:  157 GVFWHVCDVHLNLSYK----------SFGRKQ------FGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRH---RTVSQSDFNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDPKSQWCRI---LLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPF--YLSGL--GSVNPSVRLYHW-RTDPADRKYEQYHAKLNDVQTK-TLSWSLEY--SSNSLIPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCLKNCPHKPV 1356
            G FWH+ D+HL+ +Y           S G +       +GDY  DSP++L+ S+   MK+I P PDFI+  GD+  H    ++ ++     +  +++ +   FP + +  +LGNHD +P N F  +S   RI   + E W  + SN S  +  F +G +YS ++   +   +V++LNT ++YS N  T       DP  QF WL   L  +      V++IGH+PPG  E +       R  FN ++LK++Q    +I   FF H HTD+F++ YD+   P+  +F++P ++P+   L G+  G+ NP +R++ + R     +    Y   L     + T  W  EY  +    +P  S   ++  ++    E      +++ Y+     H    C +  SCR   +C IQ++ +    +CL     K V
Sbjct:   21 GRFWHISDLHLDPNYTVSKDPLQVCPSAGSQPVLNAGPWGDYLCDSPWALINSSLYAMKEIEPKPDFILWTGDDTPHVPNESLGEAAVLAIVERLTNLIKEVFPDTKVYAALGNHDFHPKNQFPAQSN--RIYNQVAELWRPWLSNESYAL--FKRGAFYSEKLPGPSRAGRVVVLNTNLYYSNNEQT---AGMADPGEQFRWLGDVLSNASRDGEMVYVIGHVPPGFFEKTQNK-AWFRESFNEEYLKVIQKHHRVIAGQFFGHHHTDSFRMFYDNTGAPINVMFLTPGVTPWKTTLPGVVDGANNPGIRIFEYDRATLNLKDLVTYFLNLRQANVQETPRWEQEYRLTEAYQVPDASVSSMHTALTRIASEPHI-LQRYYVYNSVSYNHLT--CED--SCRIEHVCAIQHVAFNTYATCLHGLGAKLV 437          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Mouse
Match: Smpdl3a (sphingomyelin phosphodiesterase, acid-like 3A [Source:MGI Symbol;Acc:MGI:1931437])

HSP 1 Score: 169.474 bits (428), Expect = 5.638e-46
Identity = 128/422 (30.33%), Postives = 202/422 (47.87%), Query Frame = 1
Query:  157 GVFWHVCDVHLNLSY-----------KSFGRKQ-----FGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRHRTV---SQSDFNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFD-PKSQWCRILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFYLSGL---GSVNPSVRLYHWRTDPADRK---YEQYHAKLNDVQTKTLS-WSLEY--SSNSLIPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCLK 1335
            G FWHV D+HL+ +Y            S G        FGD   DSP+ L+ SAF  +K       F+I  GD+  H  V   S     K +T+++  + + FP+  + P+LGNHD  P +      S+    + + W  +    +  I T  KG +YS+++  +N   ++I LNT ++Y  N     T N  DP NQF WL   L  S  +  KV++I H+P G   Y+ T    +R  +N K L I + ++ +I   F+ H H D+  ++ D N  P+  +F++P+++P  + G+    + NP VRL+ ++  P D       QY+  L +   K  S W+LEY  +    +  L    L  LV  F  +DSK F K++ Y+          C ++  C+   +C I N+D    D CLK
Sbjct:   35 GQFWHVTDLHLDPTYHITDDRTKVCASSKGANASNPGPFGDVLCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTGTVIKVITNMTMTVQNLFPNLQVFPALGNHDYWPQDQLPIVTSKVYSAVADLWKPWLGEEA--ISTLKKGGFYSQKVA-SNPGLRIISLNTNLYYGPN---IMTLNKTDPANQFEWLENTLNSSLWNKEKVYIIAHVPVGYLPYA-TDTPAIRQYYNEKLLDIFRRYSSVIAGQFYGHTHRDSLMVLSDKNGNPLNSVFVAPAVTP--VKGVLQKETNNPGVRLFQYK--PGDYTLLDMVQYYLNLTEANLKGESNWTLEYVLTQAYSVADLQPKSLYALVQQFATKDSKQFLKYYHYYFVSY-DSSATCDQH--CKTLQVCAIMNLDSMSYDDCLK 442          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Mouse
Match: Smpd1 (sphingomyelin phosphodiesterase 1, acid lysosomal [Source:MGI Symbol;Acc:MGI:98325])

HSP 1 Score: 98.9821 bits (245), Expect = 2.987e-21
Identity = 99/384 (25.78%), Postives = 156/384 (40.62%), Query Frame = 1
Query:  211 GRKQFGDY-KSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRHRTVSQS--DFNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDP-------KSQWC-RILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHN--DKPVIPLFISPSISPFYLSGLGSVNPSVRLYHWRTD-PADR----KYEQYHAKLNDVQTK--TLSWSLEYSSNSL--IPGLSAFHLNELVSDFTKEDSKHFDKF-FTYHLSGRPHEQNECSENISCRCNIICG 1293
            G   +G+Y K D P   ++S  + +    P  + +   GD   H    QS  D  ++LT ++D +        + P++GNH+  P N F P        SQW    + + W  +   ++L   T   G +Y+          ++I LN    +    + +   NS DP  Q  WL +EL  + N   KV +IGHIPPG          H    ++  + KI+  + + +   FF H H D F+I YD     +P+   F++PS + F      ++NP  R+Y    + P        +E Y   L        T SW   Y +     +P       + LV    ++D + F  F F YH    P E   C     CR   +C 
Sbjct:  238 GAGFWGEYSKCDLPLRTLESLLKGLGPAGPF-EMVYWTGDIPAHDVWQQSRQDQLRALTTITDLVRKFLGPVPVYPAVGNHESTPVNGFPPPFIKGNQSSQWLYEAMAKAWEPWLPADAL--HTLRIGGFYA---LTPRPGLRLISLNMN--FCSRENFWLLINSTDPAGQLQWLVEELQAAENRGDKVHIIGHIPPG----------HCLKSWSWNYYKIIARYENTLAGQFFGHTHVDEFEIFYDEETLSRPLAVAFLAPSATTFI-----NLNPGYRVYQIDGNYPGSSHVVLDHETYILNLTQANAAGGTPSWKRLYRARETYGLPDAMPASWHNLVYRM-RDDEQLFQTFWFLYHKGHPPSE--PC--GTPCRLATLCA 593          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. UniProt/SwissProt
Match: sp|Q92485|ASM3B_HUMAN (Acid sphingomyelinase-like phosphodiesterase 3b OS=Homo sapiens OX=9606 GN=SMPDL3B PE=1 SV=2)

HSP 1 Score: 193.356 bits (490), Expect = 6.686e-54
Identity = 126/450 (28.00%), Postives = 217/450 (48.22%), Query Frame = 1
Query:   97 MKNTFLILFFLVLEETQCFKGVFWHVCDVHLNLSYK----------SFGRKQ------FGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRH---RTVSQSDFNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDPKSQ-WCRILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPF--YLSGL--GSVNPSVRLYHW-RTDPADRKYEQYHAKLNDVQTK-TLSWSLEYSSNSL--IPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCLKNCPHKPVSQ 1362
            M+    ++F       +   G FWH+ D+HL+  YK          S G +       +GDY  DSP++L+ S+   MK+I P PDFI+  GD+  H     + ++   + +  ++  +   FP + +  +LGNHD +P N F   S      + E W  + SN S+ +  F KG +Y  ++   +   ++++LNT ++Y+ N+    T +  DP  QF WL   L ++  +   V+++GH+PPG  E +       R GFN K+LK+++    +I   FF H HTD+F+++YD    P+  +FI+P ++P+   L G+  G+ NP++R++ + R   + +    Y   L+    + T  W LEY       +P  SA H    V D    D     +++ Y+     +    C E  +C    +C ++ +D     +CL      PV Q
Sbjct:    1 MRLLAWLIFLANWGGARAEPGKFWHIADLHLDPDYKVSKDPFQVCPSAGSQPVPDAGPWGDYLCDSPWALINSSIYAMKEIEPEPDFILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDFHPKNQFPAGSNNIYNQIAELWKPWLSNESIAL--FKKGAFYCEKLPGPSGAGRIVVLNTNLYYTSNA---LTADMADPGQQFQWLEDVLTDASKAGDMVYIVGHVPPGFFEKTQNK-AWFREGFNEKYLKVVRKHHRVIAGQFFGHHHTDSFRMLYDDAGVPISAMFITPGVTPWKTTLPGVVNGANNPAIRVFEYDRATLSLKDMVTYFMNLSQANAQGTPRWELEYQLTEAYGVPDASA-HSMHTVLDRIAGDQSTLQRYYVYN--SVSYSAGVCDE--ACSMQHVCAMRQVDIDAYTTCLYASGTTPVPQ 439          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. UniProt/SwissProt
Match: sp|P58242|ASM3B_MOUSE (Acid sphingomyelinase-like phosphodiesterase 3b OS=Mus musculus OX=10090 GN=Smpdl3b PE=1 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.140e-48
Identity = 123/430 (28.60%), Postives = 208/430 (48.37%), Query Frame = 1
Query:  157 GVFWHVCDVHLNLSYK----------SFGRKQ------FGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRH---RTVSQSDFNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDPKSQWCRI---LLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPF--YLSGL--GSVNPSVRLYHW-RTDPADRKYEQYHAKLNDVQTK-TLSWSLEY--SSNSLIPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCLKNCPHKPV 1356
            G FWH+ D+HL+ +Y           S G +       +GDY  DSP++L+ S+   MK+I P PDFI+  GD+  H    ++ ++     +  +++ +   FP + +  +LGNHD +P N F  +S   RI   + E W  + SN S  +  F +G +YS ++   +   +V++LNT ++YS N  T       DP  QF WL   L  +      V++IGH+PPG  E +       R  FN ++LK++Q    +I   FF H HTD+F++ YD+   P+  +F++P ++P+   L G+  G+ NP +R++ + R     +    Y   L     + T  W  EY  +    +P  S   ++  ++    E      +++ Y+     H    C +  SCR   +C IQ++ +    +CL     K V
Sbjct:   21 GRFWHISDLHLDPNYTVSKDPLQVCPSAGSQPVLNAGPWGDYLCDSPWALINSSLYAMKEIEPKPDFILWTGDDTPHVPNESLGEAAVLAIVERLTNLIKEVFPDTKVYAALGNHDFHPKNQFPAQSN--RIYNQVAELWRPWLSNESYAL--FKRGAFYSEKLPGPSRAGRVVVLNTNLYYSNNEQT---AGMADPGEQFRWLGDVLSNASRDGEMVYVIGHVPPGFFEKTQNK-AWFRESFNEEYLKVIQKHHRVIAGQFFGHHHTDSFRMFYDNTGAPINVMFLTPGVTPWKTTLPGVVDGANNPGIRIFEYDRATLNLKDLVTYFLNLRQANVQETPRWEQEYRLTEAYQVPDASVSSMHTALTRIASEPHI-LQRYYVYNSVSYNHLT--CED--SCRIEHVCAIQHVAFNTYATCLHGLGAKLV 437          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. UniProt/SwissProt
Match: sp|P70158|ASM3A_MOUSE (Acid sphingomyelinase-like phosphodiesterase 3a OS=Mus musculus OX=10090 GN=Smpdl3a PE=1 SV=2)

HSP 1 Score: 169.474 bits (428), Expect = 3.944e-45
Identity = 128/422 (30.33%), Postives = 202/422 (47.87%), Query Frame = 1
Query:  157 GVFWHVCDVHLNLSY-----------KSFGRKQ-----FGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRHRTV---SQSDFNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFD-PKSQWCRILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFYLSGL---GSVNPSVRLYHWRTDPADRK---YEQYHAKLNDVQTKTLS-WSLEY--SSNSLIPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCLK 1335
            G FWHV D+HL+ +Y            S G        FGD   DSP+ L+ SAF  +K       F+I  GD+  H  V   S     K +T+++  + + FP+  + P+LGNHD  P +      S+    + + W  +    +  I T  KG +YS+++  +N   ++I LNT ++Y  N     T N  DP NQF WL   L  S  +  KV++I H+P G   Y+ T    +R  +N K L I + ++ +I   F+ H H D+  ++ D N  P+  +F++P+++P  + G+    + NP VRL+ ++  P D       QY+  L +   K  S W+LEY  +    +  L    L  LV  F  +DSK F K++ Y+          C ++  C+   +C I N+D    D CLK
Sbjct:   35 GQFWHVTDLHLDPTYHITDDRTKVCASSKGANASNPGPFGDVLCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTGTVIKVITNMTMTVQNLFPNLQVFPALGNHDYWPQDQLPIVTSKVYSAVADLWKPWLGEEA--ISTLKKGGFYSQKVA-SNPGLRIISLNTNLYYGPN---IMTLNKTDPANQFEWLENTLNSSLWNKEKVYIIAHVPVGYLPYA-TDTPAIRQYYNEKLLDIFRRYSSVIAGQFYGHTHRDSLMVLSDKNGNPLNSVFVAPAVTP--VKGVLQKETNNPGVRLFQYK--PGDYTLLDMVQYYLNLTEANLKGESNWTLEYVLTQAYSVADLQPKSLYALVQQFATKDSKQFLKYYHYYFVSY-DSSATCDQH--CKTLQVCAIMNLDSMSYDDCLK 442          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. UniProt/SwissProt
Match: sp|Q92484|ASM3A_HUMAN (Acid sphingomyelinase-like phosphodiesterase 3a OS=Homo sapiens OX=9606 GN=SMPDL3A PE=1 SV=2)

HSP 1 Score: 168.318 bits (425), Expect = 9.341e-45
Identity = 129/420 (30.71%), Postives = 195/420 (46.43%), Query Frame = 1
Query:  157 GVFWHVCDVHLNLSY-----------KSFGRKQ-----FGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRHRTV---SQSDFNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDP-KSQWCRILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFY-LSGLGSVNPSVRLYHWRTDPADRK---YEQYHAKLNDVQTKTLS-WSLEY--SSNSLIPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCLK 1335
            G FWHV D+HL+ +Y            S G        FGD   DSP+ L+ SAF  +K       F+I  GD+  H  V   S       +T+++  +   FP+  + P+LGNHD  P +      S+    +   W  +    +  I T  KG +YS+++T N    ++I LNT ++Y  N     T N  DP NQF WL   L  S+ +  KV++I H+P G    S  +   +R  +N K + I Q ++D+I   F+ H H D+  ++ D    PV  LF++P+++P   +    + NP +RL+ +  DP D K     QY+  L +   K  S W LEY  +    I  L    L  L   FT  DSK F K++ Y         +  + + +C+   IC I N+D      CLK
Sbjct:   38 GQFWHVTDLHLDPTYHITDDHTKVCASSKGANASNPGPFGDVLCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTDTVINVITNMTTTIQSLFPNLQVFPALGNHDYWPQDQLPVVTSKVYNAVANLWKPWLDEEA--ISTLRKGGFYSQKVTTNP-NLRIISLNTNLYYGPN---IMTLNKTDPANQFEWLESTLNNSQQNKEKVYIIAHVPVGYLPSSQNI-TAMREYYNEKLIDIFQKYSDVIAGQFYGHTHRDSIMVLSDKKGSPVNSLFVAPAVTPVKSVLEKQTNNPGIRLFQY--DPRDYKLLDMLQYYLNLTEANLKGESIWKLEYILTQTYDIEDLQPESLYGLAKQFTILDSKQFIKYYNYFFVSY---DSSVTCDKTCKAFQICAIMNLDNISYADCLK 445          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. UniProt/SwissProt
Match: sp|Q3ZC91|ASM3A_BOVIN (Acid sphingomyelinase-like phosphodiesterase 3a OS=Bos taurus OX=9913 GN=SMPDL3A PE=2 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.132e-44
Identity = 129/424 (30.42%), Postives = 198/424 (46.70%), Query Frame = 1
Query:  157 GVFWHVCDVHLNLSYKSFGRKQ----------------FGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRHRTVSQSDFNKSL---TDVSDELLHNFPSSIILPSLGNHDVNPANFFDP-KSQWCRILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPF--YLSGLGSVNPSVRLYHWRTDPADRK---YEQYHAKLNDVQTKTLS-WSLEYSSNSL--IPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNI--ICGIQNIDYTKLDSCLKN 1338
            G FWHV D HL+ +Y   G                   FGD   DSP+ L+ SA   +K       F+I  GD+  H  V +   +K +    +++  +   FP+  + P+LGNHD  P +      S+    +   W  + + ++  I T  KG +Y+++++ NN   ++I LNT ++Y  NS    T N  DP NQF WL   L  S+ +  KV++I H+P G   Y+  +   +R   N K + I + ++DII   F+ H H D+  ++ D   KPV  LF++P+++P    L  L + NP VRL+ +  DP D K     QY+  L D   K  S W LEY+      I  L    L +L   F  ++SK F K++ Y          + S     +C I  IC I N+D      C + 
Sbjct:   35 GQFWHVTDFHLDPTYHITGDHTKVCASSKGAEASDPGPFGDVMCDSPYRLIFSALDFIKNSGQKVSFMIWTGDSPPHVPVLELSTDKVINVTANITTTIQRLFPNLQVFPALGNHDYWPQDQLPVVNSKVYNAVANLWKPWLTEDA--ITTLRKGGFYTQKVS-NNPKLRIISLNTNLYYGPNS---VTLNQTDPANQFEWLENTLNISQQNKEKVYIIAHVPVGYLPYARGI-SAMRKYHNEKLIDIFRKYSDIIAGQFYGHTHRDSIMVLSDKKGKPVNSLFVAPAVTPVRSVLERLTN-NPGVRLFQY--DPRDYKLLDMLQYYLNLTDANLKGESNWKLEYNLTQAYDIQDLQPKSLYKLAKQFAIQESKQFIKYYKYFFVSY-----DSSVICQGKCKIFQICAIMNLDVISYTDCFRQ 443          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. TrEMBL
Match: A0A5K3FBP9 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 2.957e-73
Identity = 150/423 (35.46%), Postives = 225/423 (53.19%), Query Frame = 1
Query:  157 GVFWHVCDVHLNLSYKSFG-RKQFGDYKSDSPFSLVKSAFQQMKKI-YPNPDFIILNGDNVRHRTVSQSDFNKSLTDVSDELLHNFPSSI---ILPSLGNHDVNPANFF------DPKSQWCRILL---EKWLKFFSN-NSLEIQTFTKGCYYSRRITVN---NITAK---VIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFYLSGLGSVNPSVRLYHWRTDPADRKYEQYHAKLNDVQTKTLSWSLEYSSNSLIPGLSAFHLNELVSDFTK--EDSKHFDKFFTYHLSGRPHEQNECSENISCR-CNIICGIQNIDYTKLDSCLKNCPHKP 1353
            G FW + DVHL+L Y+  G    FGD   DSP  L+ SA Q  +KI    PDF++ +GD+  H   S++DF +++  V+  L   FPS     ++PSLGNHDV P +        + + +WC  L    E W  + +     +   F+ GC++SR + +N   N T K   VI LN +++   NS      N  DPL QF WL  +L  +R+   K  +I H P GA E SP  FRH+   +N + + I+ DFAD+I  G F HQH D+F++V+     P++PLF SPS+SP YL+ LGS NP +R Y++    A  +   Y     ++     SW LEY++     GL+      L     +  +D+  +  ++ + L G+PH+   C E  S R C  +C ++++ Y+ LDSCL+ C  KP
Sbjct:   28 GHFWQLTDVHLDLDYERHGCSGDFGDCDCDSPRQLLVSALQATRKIAVAEPDFVVFSGDSTAHAIESETDFERAMKVVATSLKETFPSHRNIPVIPSLGNHDVFPESSMSVNEVDENRRRWCTRLGSDPELWADWVTGPKDADASRFSDGCFFSRLLRINSTANGTQKHLLVISLNGLLYSRRNSQA--DPNVTDPLGQFQWLLSKLQSARDEKQKAIIIMHFPLGAPENSPVQFRHMYDVYNERLIGILTDFADVISFGLFGHQHVDSFRVVFSKTGDPLLPLFYSPSVSPMYLNALGSFNPRIRFYNYTFGSATPRILDYQQFYVNISADQPSWRLEYAARQAY-GLADLSPQSLAGLLARLGDDAAIWCSYWNHELGGQPHDSGPCPELHSKRHCRHLCTMRHLSYSVLDSCLELCSSKP 447          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. TrEMBL
Match: A0A0V0JC01 (Acid sphingomyelinase-like phosphodiesterase 3b OS=Schistocephalus solidus OX=70667 GN=ASM3B PE=4 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 1.418e-70
Identity = 154/427 (36.07%), Postives = 234/427 (54.80%), Query Frame = 1
Query:  151 FKGVFWHVCDVHLNLSYKSFGRKQFGDYKSDSPFSLVKSAFQQMKKIYPNP-DFIILNGDNVRH-RTVSQSDFNKSLTDVSDELLHNFPSS--IILPSLGNHDVNPANFFD---PKSQ----WC------RILLEKWLKF--------FSNNSLEIQTFTKGCYYSRRITVNNITAKVII-LNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFYLSGLGSVNPSVRLYHW-RTDPADRKYEQYHAKLNDVQTKTLSWSLEYS--SNSLIPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISC-RCNIICGIQNIDYTKLDSCLKNC 1341
            F+G FWHV D H++ +Y   G    G+Y+ DSP SL  SA    +++   P DF+I +GD+V H  ++S++ F   +   +  L   FP +   I+P LGNHD +P+N  +   P +Q    WC      R L   W+           + NS E+  FT GC++SRR+ ++  ++ V+I +N M+WYS N     +    DP+ QFAWL   L  +R S TKV LI H PPGA+E SP  +RH    +N +FL ++ D ADI+  G FAHQHTD F+++   +D+P +PL   PSISP+ L GLG+ NP +R++ + R       Y+Q    L+  +    +W+ EYS      +P  SA  L+ L++DF   +  ++ +++ + L G PH   +C +  S  RC  +C +  + YT LD CL  C
Sbjct:   36 FRGSFWHVTDPHIDPNYSCQG--SLGNYECDSPLSLWISALNNTRQLRQQPPDFVIFSGDSVAHTESLSRAKFLDVMRSAAKRLRALFPDNQIPIIPVLGNHDTHPSNVLEVNEPAAQKRHEWCGLLATDRDLWADWIALGQPDPAPNATRNSSEV--FTSGCFFSRRLNISGGSSLVLISVNGMLWYSNNRKADASL--PDPVGQFAWLEATLSRARESNTKVLLICHFPPGATENSPEKYRHFFEKYNQRFLDLLLDNADILIGGLFAHQHTDTFRVL-KKDDRPALPLLFGPSISPWRLGGLGAFNPRIRVFQYVRRSLRLTDYQQLFLNLSAAEP---TWAEEYSFRQEYRLPDTSAGSLSALLTDFVHSEG-NWTRYWFHQLGGLPHGSGDCPQLGSLHRCQHLCAMFYLSYTYLDRCLIGC 451          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. TrEMBL
Match: A0A075A8F6 (Uncharacterized protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_14569 PE=4 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 1.558e-68
Identity = 151/447 (33.78%), Postives = 232/447 (51.90%), Query Frame = 1
Query:  157 GVFWHVCDVHLNLSY--KSFGRKQFGDYKSDSPFSLVKSAFQQMKKI-------YPNPDFIILNGDNVRH-RTVSQSDFNKSLTDVSDELLHNFPSS--IILPSLGNHDVNPANFFDP------KSQWCR------ILLEKWLKF-----FSNNSLEIQ-----------TFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFYLSGLGSVNPSVRLYHW-RTDPADRKYEQYHAKLNDVQTKTLSWSLEYSSNS--LIPGLSAFHLNELVSDFTKEDSKH--FDKFFTYHLSGRPHEQNE------CSENIS-CRCNIICGIQNIDYTKLDSCLKNC 1341
            G FW + D+HL+L Y      + ++GD K DSP  LV+SA    K +          PDF+I +GDN  H    ++    +++  VSD +   F +    +LP LGNHDV PAN   P      +  WC       +L   W+       F N    IQ            F++GC++S  + +      ++ +N ++WY  N        S DPL QF WLN     +R+S  K+ L+ H PPGASE +P  F+ L+ GFN  F++++Q  AD++ AG FAH H D+F+++ D    PV+ LF +PS+SP  LSGLGS NP +RLY + R+D     Y QY     ++   +  W +EY ++   L+  LS   LN L+++F  +D++   + +++ + L GRPHE +       C    S CRC  +C ++++D T + SCL +C
Sbjct:   28 GFFWQLTDLHLDLRYNLTQDCQGRYGDPKCDSPLDLVQSAISVTKTLPMFESDDRQLPDFVIWSGDNGPHAHHFTRDQLYQTIQVVSDRMQQVFRTDKVYVLPVLGNHDVTPANHMSPDPLDADRLAWCHNLSSNPLLWGPWIHLANRSSFINPDRSIQRDLPSPLPPPANFSRGCFFSHLLHLPTSDLLLVSVNGLIWYRENP--LLVHASPDPLQQFDWLNATFAWARSSKCKILLVSHFPPGASENTPRRFKFLQSGFNKHFVQLLQANADVLMAGLFAHTHVDSFRVLSDQTGHPVLSLFTAPSVSPLRLSGLGSFNPRIRLYRYRRSDTTLLGYRQY---FLNISQSSPQWQVEYDTSDAYLLSDLSPIALNRLLNEFEHDDTQDGVWSRYWNHELGGRPHEPSTLIPDGLCPRAQSVCRCEHLCPMRHVDLTAMQSCLDSC 469          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. TrEMBL
Match: A0A5J4NSB3 (Sphingomyelin phosphodiesterase acid-like 3 OS=Paragonimus westermani OX=34504 GN=DEA37_0003707 PE=4 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 8.025e-66
Identity = 151/455 (33.19%), Postives = 236/455 (51.87%), Query Frame = 1
Query:   97 MKNTF---LILFFLV--LEETQCFKGVFWHVCDVHLNLSYKSFGRKQ-FGDYKSDSPFSLVKSAFQQMKKIY---PNPDFIILNGDNVRHRTVSQSDFNKSLTDVSDEL--LHNFPSSIILPSLGNHDVNPANFFDPKSQ------WCR------ILLEKWLKF--FSNNSLE---IQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFYLSGLGSVNPSVRLYHW-RTDPADRKYEQYHAKLNDVQTKTLSWSLEYSSNSL--IPGLSAFHLNELVSDFTKED--SKHFDKFFTYHLSGRPHEQ------NECSENIS-CRCNIICGIQNIDYTKLDSCLKNC 1341
            MKN +   L+LF +V  L ++    G FWH+ D H+NLSYK       +G+Y  D+   +  SA + +  +      PDFI+  GD   H+ VS  +   SLT +S++    +   + II+P +GNHDV P N   P ++      WC        L + W++F   S N L       F K CY S  +        V+ LN++VWY+ N      ++ +DPL+QF W+   L  +R    KVF+  H+P GA E+SP  +RHL+P +N K + I++ + D+I     +HQH D F+++ +    PV  +F+ PS+   +L  +GS NP +R Y + R       YEQY   + D+  +  +W LEY +     +  L+A  L  L+ + T+ D   K + +++ + L GRPH++       EC E  S CRC  IC I+++D  +LD+CLK C
Sbjct:   14 MKNIYWASLLLFGVVCCLTQSSGDIGTFWHLTDFHVNLSYKVENDSGLWGNYSQDAGPLVAFSAIKHVSDMVFSSDKPDFILWGGDAASHQNVSLENVTGSLTYLSEQFRKAYGLKNLIIIPVVGNHDVFPVNEMSPITEDYNRYWWCEQLATNEKLWKTWIEFAKLSVNGLPDLPKPDFDKFCYQSWLLKTEP-PVLVLALNSLVWYTNNP--LVNESIEDPLDQFKWIRDSLNWARARHAKVFITMHVPAGAPEFSPDTYRHLKPKYNKKLVSILRGYFDVIITTLASHQHIDTFRVILNEKYHPVGTIFLGPSVDHLHLDAIGSTNPRIRKYTYNRKTGKIIDYEQY---MLDLSQQGPNWKLEYQAKETYKLQNLNATELAHLLDEVTENDDPKKKWTEYWYHQLGGRPHDKTRISPTGECPEAKSVCRCQQICAIRHVDTEQLDACLKVC 462          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. TrEMBL
Match: A0A5J4N8I2 (Sphingomyelin phosphodiesterase acid-like 3 OS=Paragonimus westermani OX=34504 GN=DEA37_0005666 PE=4 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 1.167e-65
Identity = 154/445 (34.61%), Postives = 233/445 (52.36%), Query Frame = 1
Query:  157 GVFWHVCDVHLNLSYKSFG-RKQFGDYKSDSPFSLVKSAFQQMKKIYP---NPDFIILNGDNVRHRT-VSQSDFNKSLTDVSDELLHNFPSS--IILPSLGNHDVNPANFFDPKS------QWCRILLEK------WLKFFSNNSLEIQT--------------FTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFYLSGLGSVNPSVRLYHW-RTDPADRKYEQYHAKLNDVQ---TKTLSWSLEYSSNSL--IPGLSAFHLNELVSDFTKEDS--KHFDKFFTYHLSGRPHEQNE--------CSENIS-CRCNIICGIQNIDYTKLDSCLKNC 1341
            G FW + D+H+NL+Y + G    FGDY+ DSP  L  SA +   +  P    PDF++ +GDN  H T +S  +    +  +S +L   FP     +LP+LGNHDV PAN+  P         WC  L         W+   ++NS +I++              F+ GC+YS  + +      ++ LN ++WYS N      ++  DP +Q  WLN  L  +R    KV L+ H PPGASE +P  F+ LR  FN   + I++  AD+   G FAH H D+F+++YDH   P++ LF +PSI+P +LSGLG+ NP +RLY + R++     Y QY   L+D Q    ++ +W LEY +     +  LSA  L+ L+  F  +DS    + +++ + L GRPHE           C    S CRC  +C ++ +D  +LD+CL+ C
Sbjct:   53 GYFWQLTDMHVNLNYNNSGCHGPFGDYECDSPLKLALSAIRATTQFMPKDHQPDFVVWSGDNGPHTTYLSLDELESGIRHISVQLQSVFPPDQVYVLPTLGNHDVVPANYMQPTPGDPASLAWCHKLASNPQLWGPWIHLANSNS-QIKSDPDASSMSAPPFANFSTGCFYSHLLRLPGSRLLLLSLNGLLWYSGNP--LAGRDGPDPRDQLEWLNVSLDWARREGVKVLLVSHFPPGASENTPIQFKFLRAEFNGPLVSILRANADVFMGGLFAHTHVDSFRVLYDHEGHPLLSLFTAPSITPLHLSGLGTFNPRIRLYRYKRSEGLLLGYSQYFLNLSDPQLRENRSANWRLEYDTVDAYNLSNLSASSLSTLLDQFAHDDSLTGAWSQYWLHELGGRPHETKSDLLTPDGLCPRARSQCRCEHLCPMRYLDLAELDTCLRGC 494          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Cavefish
Match: smpdl3b (sphingomyelin phosphodiesterase acid like 3B [Source:NCBI gene;Acc:103027922])

HSP 1 Score: 191.045 bits (484), Expect = 6.410e-54
Identity = 130/450 (28.89%), Postives = 216/450 (48.00%), Query Frame = 1
Query:  112 LILFFLVLEETQCFKGVFWHVCDVHLNLSYKSFGRK----------------QFGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRHRTVSQSDFNK--------SLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDP---------KSQWCRILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRH---LRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPF--YLSGL--GSVNPSVRLYHWRTDPADRK-YEQYHAKLNDVQTKTLSWSLEYSSNSL--IPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCL 1332
            L+  F V  + +   G FWH+ D+H + +Y   G                  +FGDY  DSP+ L+ S+   M+ I P+PDFII  GD+  H  V   D  +        +LT +  EL   FPS+ +  +LGNHD +P +   P         + QW     E WL   S +     TF KG YY+ ++ +N    +V++LNT ++Y  N     T+N +DP +QF W ++ L E+  +  KV+++GH+PPG  E      RH    RP FN  +L+++Q   DII   FF H HTD+F++ YD    P+  +F++P ++P+   L G+  G+ NP +R++ +       K    Y+  L         W  EY       +P  S   ++ ++      D+ +  K+  Y  +   +++  C  +  CR + +C ++ +D+   + C+
Sbjct:    9 LLSVFTVSGQGKVLTGSFWHITDLHWDPTYSLNGNSASVCNSSGNRPTPDAGKFGDYLCDSPWDLINSSMHAMRDILPDPDFIIWTGDDTPH--VPNEDLGEEAVLRIIGNLTQIIKEL---FPSTKVYSALGNHDYHPKSQLPPEQNSIYEQIQKQW-----ESWLDPASRD-----TFKKGGYYTEKL-LNQTGLRVLVLNTNLYYDQNK---ITENINDPADQFRWADQVLSEAAKNMEKVYIVGHVPPGFFEKK----RHKPWFRPQFNKHYLELIQKHHDIIIGQFFGHHHTDSFRLFYDKAGIPISAMFLTPGVTPWKTTLPGVDDGANNPGIRVFEYDEKTLLVKDMITYYLNLTHANIARARWEKEYRLTEAFGVPDASPASMHHVLEQIAG-DNCYLQKY--YDFNSVNYDRTACGAD--CRVDHVCAMREVDFDAYELCV 430          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Cavefish
Match: smpdl3a (sphingomyelin phosphodiesterase acid like 3A [Source:NCBI gene;Acc:103046912])

HSP 1 Score: 175.637 bits (444), Expect = 2.917e-48
Identity = 129/424 (30.42%), Postives = 199/424 (46.93%), Query Frame = 1
Query:  157 GVFWHVCDVHLNLSY-------------KSFGRKQ---FGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRHRTVSQSDFNKSLTDVSDELLHN----FPSSIILPSLGNHDVNPANFFDPKSQWCRILLEK-WLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFYLSGLG-SVNPSVRLYHWRT-DPADRKYEQYHAKLNDVQTKTL-SWSLEYSSNS--LIPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCR--CNI--ICGIQNIDYTKLDSCLKN 1338
            G FWH+ D+HL+ +Y             K F  K    FGD+  DSP+ L+ SAF  MK +   P+FII  GD+  H    +     ++  V+  + H     FP   + P+LGNHD  P +    K+      + K W  + S+ +L   T  +G +YS+ I       +V+ LNT  +Y+ N     T+N  DP  QF WL   L  S+ S  KV++I H+P G   Y+      +R   N K + I + ++ II   F+ H H D+  ++ D   KPV  +F++P+++P    G   S NP VR+Y + T D   +   QY+  L +   K   +WSLEY+      I  +    L+EL   F    SK F K+FT+ +          S+ I+C   C +  +C +  +D      C+K 
Sbjct:   37 GKFWHISDLHLDPTYHITTDPSKVCFSSKGFPVKNPGLFGDFLCDSPYQLILSAFSHMKHVEQQPEFIIWTGDSPPHVPPEELS-TDAVISVTSNMTHTIRQFFPQLPVYPALGNHDYWPQDQLPAKTNAVYEAVAKLWAPWLSSEALA--TLREGGFYSQLIKPG---LRVVSLNTNFYYTPNK---ATENLTDPGGQFKWLQDTLELSKQSLEKVYVIAHVPIGYLPYAKDT-TAMREHHNEKLVDIFRSYSSIIQGQFYGHTHRDSIMVLLDQQGKPVNSIFVTPAVTPIKSPGEPFSNNPGVRMYLFDTQDYGLQDLWQYYLNLTEANKKEQPNWSLEYTMTEAFAIKDIQPQSLHELALKFEAPQSKDFQKYFTHFMVSY-------SDTITCEGVCKMVQVCSVHYLDRDSYSQCMKK 443          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Cavefish
Match: smpd1 (sphingomyelin phosphodiesterase 1 [Source:ZFIN;Acc:ZDB-GENE-110411-222])

HSP 1 Score: 54.299 bits (129), Expect = 2.542e-7
Identity = 44/172 (25.58%), Postives = 80/172 (46.51%), Query Frame = 1
Query:  850 FADIIDAGFFAHQHTDAFKIVYDHN--DKPVIPLFISPSISPFYLSGLGSVNPSVRLYHWRTDPADRKYEQYHAKLNDVQTKTLS--------WSLEYSSNSL--IPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSC 1329
            +   I   FF H H D F++ YD     +PV   +I+PS++ +      ++NP  R+Y+      D  Y      + D  T  L+        WSL Y +++   +P L   + + L+ +F  +D + F KF  ++L  + H    C +  +C+ ++IC +++  Y  L  C
Sbjct:  259 YESTITGQFFGHTHVDQFQMFYDQETMTRPVGVAYIAPSVTTYI-----NLNPGYRVYY-----VDGNYPGSSRIVLDYDTFILNLTLANDPVWSLLYRASTAYDMPILFPSNWDALIKNFLTDD-RVFQKF--WYLMHKGHVSEPCKD--TCKTSLICFLRSGRYDLLQQC 415          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Cavefish
Match: smpd1 (sphingomyelin phosphodiesterase 1 [Source:ZFIN;Acc:ZDB-GENE-110411-222])

HSP 1 Score: 50.8322 bits (120), Expect = 3.154e-6
Identity = 43/169 (25.44%), Postives = 79/169 (46.75%), Query Frame = 1
Query:  850 FADIIDAGFFAHQHTDAFKIVYDHN--DKPVIPLFISPSISPFYLSGLGSVNPSVRLYHWRTDPADRKYEQYHAKLNDVQTKTLS--------WSLEYSSNSL--IPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKL 1320
            +   I   FF H H D F++ YD     +PV   +I+PS++ +      ++NP  R+Y+      D  Y      + D  T  L+        WSL Y +++   +P L   + + L+ +F  +D + F KF  ++L  + H    C +  +C+ ++IC +++  Y  L
Sbjct:  259 YESTITGQFFGHTHVDQFQMFYDQETMTRPVGVAYIAPSVTTYI-----NLNPGYRVYY-----VDGNYPGSSRIVLDYDTFILNLTLANDPVWSLLYRASTAYDMPILFPSNWDALIKNFLTDD-RVFQKF--WYLMHKGHVSEPCKD--TCKTSLICFLRSGRYDLL 412          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Sea Lamprey
Match: smpdl3b (sphingomyelin phosphodiesterase acid like 3B [Source:ZFIN;Acc:ZDB-GENE-041008-132])

HSP 1 Score: 143.28 bits (360), Expect = 2.105e-37
Identity = 113/424 (26.65%), Postives = 193/424 (45.52%), Query Frame = 1
Query:  157 GVFWHVCDVHLNLSYKS---------------FGRKQFGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRH---RTVSQSDFNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDP--KSQWCRILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPG-ASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPF--YLSGL--GSVNPSVRLYHWRTDPADRKYEQYHAKLNDVQTKTLS-----WSLEYS--SNSLIPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCL 1332
            G FWH+ D+H++ +Y+                      G Y+ D+P++L+ SA   MK+I  NPDFI+  GD+  H     + +    + + +++D +   FP   +  +LGNHD +P N   P   S + R+    W  + +  SL   TF KG YYS ++ V     ++++LNT ++Y+ N  T       DP  QF WL+K L  +  +  KVF+IGH+PPG  SE      R  R  +  K   + +    +  +    +        +       V  + I+P I+P+   L G+  G+ NP +R++ +  D A  + +       D+QT         WS EYS   +  +P  S   L+ L+      D   F K+  Y+ +   +++  C  + +CR +  C I  +D+   + C+
Sbjct:   22 GKFWHITDLHVDPAYQVTDNSTAVCPSSRDPVLNPGPLGHYQCDAPWALIHSALNNMKRILKNPDFILWTGDDTPHVPDSALGEEAVLEIIKNLTDIITAAFPGVTVYSALGNHDFHPKNQLPPHNNSIYSRV-GSMWQHWMAPESL--GTFHKGAYYSEKL-VGRAGQRIVVLNTNLYYASNVQTAGLA---DPAGQFDWLDKVLTNASANKEKVFIIGHVPPGMXSETREGSGR--RECYCDKHYSVARLPHRVTTSAQSGYTRGGGRGELVRGAGNAVSSMLIAPGITPWKTTLPGVDDGANNPGIRVFEY--DKATLQLQDMLTHYIDLQTANSGNLDPVWSQEYSLRLDFSVPDASTAALDSLLQKM-NADPDLFQKY--YNFNSVSYDKRAC--DAACRDDHYCAIGEVDFDAYEGCV 429          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Sea Lamprey
Match: smpd1 (sphingomyelin phosphodiesterase 1 [Source:ZFIN;Acc:ZDB-GENE-110411-222])

HSP 1 Score: 93.5893 bits (231), Expect = 1.692e-20
Identity = 89/387 (23.00%), Postives = 163/387 (42.12%), Query Frame = 1
Query:  211 GRKQFGDYKS-DSPFSLVKSAFQQMKKIYPNPDFI--ILNGDNVRHRTVSQSDFNK--SLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDP-------KSQWCRILLEK-WLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHN--DKPVIPLFISPSISPFYLSGLGSVNPSVRLYHWRTDPAD--RKYEQYHAKLNDVQTKTL----SWSLEYSSNSL--IPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQN 1302
            G  ++GDY++ D P   V+S  +  ++             GD   H    Q++ ++  +LT V++ +     ++ + P++GNH+ +P N F P        S W    + K W  +  +++L    F  G +Y+    +     +V+ LN    +    + +   N  DP  Q  W    L  + N+  KV +IGHI PG            R  ++  +  I+  +   I A FF H HTD F++ YD     +P+   ++SPS++ ++      +NP  R+Y    D  D  R    +H    D++        +W L YS+     +  L     + L+     +D+      F +HL  + H    C     C+  ++C +++
Sbjct:  126 GAGKWGDYRACDVPLRTVQSMLEHTQREGRGTGVTHAYWTGDIPAHNVWEQTEQDQLQALTTVTELIRKYLGNTTVYPAVGNHESSPVNSFPPPSAPGHHSSAWLYDAMAKAWSHWLPSDALVTLRF--GGFYT---ALAKPGLRVVSLNMN--FCSVENFWLAINDTDPAGQLQWFVDVLQAAENNGEKVHVIGHIAPGLC----------RKTWSWNYYHIINRYESTIAAQFFGHVHTDQFEMFYDEETLSRPLGVAYLSPSVTTYW-----DLNPGYRVYEIDGDRKDSTRAVLDHHTFYLDLEEANRLDRPTWRLLYSARKAYGMEALGPADWDALLHRMQDDDA--LFAIFWWHLH-KGHSSEPCIG--MCKVAMLCALRS 485          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Yeast
Match: PPN1 (Dual endo- and exopolyphosphatase with a role in phosphate metabolism; acts as both an endopolyphosphatase cleaving long chains of polyphosphate distributively to generate shorter polymer chains and as an exopolyphosphatase catalyzing the hydrolysis of terminal phosphate from polyphosphate; localizes to the vacuole, nucleus and cytosol; functions as a homodimer; relocalizes from vacuole to cytoplasm upon DNA replication stress [Source:SGD;Acc:S000002860])

HSP 1 Score: 72.4034 bits (176), Expect = 9.481e-14
Identity = 78/288 (27.08%), Postives = 117/288 (40.62%), Query Frame = 1
Query:  157 GVFWHVCDVHLNLSY-----------------KSFGRKQFGDYKS--DSPFSLVKSAFQQMKK-IYPNPDFIILNGDNVRH-------RTVSQS-DFNKSLTDVSDELL--------HNFPSSIILPSLGNHDVNPANFF--DPKSQWCRILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFA-WLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAF 903
            G F H+ D+H +  Y                 K     +FG   S  DSP  L++   + +K+ +    DF+I  GDN+RH       RT +Q  D N  + D   EL          +F  S+I PSLGN+DV P N F   P  Q  R     W  F      + +TF +   +   +    +   V+ +NT+  +  N       +  +P  Q   W    L E R+   KV+L GH+PP A  +  + +         KF     ++ DII  G + H + D F
Sbjct:   95 GRFLHITDIHPDPYYVEGSSIDAVCHTGKPSKKKDVAPKFGKAMSGCDSPVILMEETLRWIKENLRDKIDFVIWTGDNIRHDNDRKHPRTEAQIFDMNNIVADKMTELFSAGNEEDPRDFDVSVI-PSLGNNDVFPHNMFALGPTLQ-TREYYRIWKNFVPQQ--QQRTFDRSASFLTEVIPGKLA--VLSINTLYLFKANPLVDNCNSKKEPGYQLLLWFGYVLEELRSRGMKVWLSGHVPPIAKNFDQSCYD--------KFTLWTHEYRDIIIGGLYGHMNIDHF 368          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Nematostella
Match: EDO31208 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYL6])

HSP 1 Score: 119.783 bits (299), Expect = 9.345e-30
Identity = 101/360 (28.06%), Postives = 162/360 (45.00%), Query Frame = 1
Query:  292 YPNPDFIILNGDNVRHRTVSQSDFN--KSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDPKS-------QWCRILLEK----WLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDK--PVIPLFISPSISPFYLSGLGSVNPSVRLYHWRTDPADRK-----YEQYHAKLNDVQTKTLSWSLEYSSN------SLIPGLSAFHLNELVSDFTKEDS------KHFDKFFTYHLSGRPHEQNECSENISCR 1275
            Y   D+++  GD   H   +QS     KSL +  D +LH  P   + P++GNH+ +P N F P S        W R  L K    WL  ++     + T  KG +YS  ++      +++ +N    Y  N + +   +S DP  Q  WL   L ES ++  KV +IGHIPPG+S+            F+  +  I+  +   + A FF H H+D F++ YD   +  P+   F+ PS++P+        NP  R+Y    D  +       +E Y   L +     + W+LEY++       SL+P  SA+H  +L+   TK+ S      K+F K     + G   +   C ++  CR
Sbjct:    1 YSQVDYVLWTGDIPPHNIWNQSRNAQLKSLDNAVDLILHYLPGVKVFPAIGNHEGSPVNSFPPPSITDENSNSWLRNELAKDWGNWLPEYT-----MSTIKKGAFYSVLVSKG---LRIVSINMN--YCNNMNWWLLLDSIDPAGQLQWLVDTLQESEDNGEKVHIIGHIPPGSSD--------CLKAFSWNYYSIINRYQSTVTAQFFGHTHSDEFEVFYDEKTRRIPISFAFLGPSVTPYQFH-----NPGYRIYDIDGDYDNSSRVVLNHETYILDLIEANKGEVQWTLEYNAKDAYKMPSLLP--SAWH--DLLIRMTKDPSLVELAYKYFYKSSPESIHGGKCDSPSCQKSFICR 333          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Nematostella
Match: EDO46874 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNK9])

HSP 1 Score: 86.6557 bits (213), Expect = 6.134e-18
Identity = 81/341 (23.75%), Postives = 144/341 (42.23%), Query Frame = 1
Query:  223 FGDYKSDSPFSLVKSAFQQMKKIYP-NP-DFIILNGDNVRHRT--------VSQSDFNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFF--DPKSQWCRILLEKWLKFF------------SNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSD----DPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQD-FADIIDAGFFAHQHTDAFKIVYDHNDKPVIP---LFISPSISPFYLSGLGSVNPSVRLYHWRTDP-ADRKYEQYHAKL-NDVQTKTLSWSLEYSSNSLIPGLS 1143
             G    DSP SL+ S  + MK  +  NP DF+++ GD   HRT          +     S+  ++ E+ + FP   + P  GN+D  P N    + + Q+    L+ +L               +      +TF  G YY   I    +   ++ LN+M WY  ++H+ +  +S         QF WL  +L +++    KV +  H+PPG   YS           + +F +++   + +++ A  + H H D  ++     D+  +      ++PS+SP + +     NPS R ++   D      Y+QY   +    Q ++  W L+Y  +   P  S
Sbjct:  161 LGRVGCDSPMSLMTSWLKHMKSTHEKNPADFLLITGDFNAHRTDESYFPHGSGRQRLLSSIKSITLEIHNAFPDLPVFPLFGNNDFQPHNTLPSNEQDQFYSQALDLFLPMILCDKCSPDRNRPTTQQELRETFVNGGYYKVDIAGGRMV--LLALNSMYWY-VDAHSDSESDSTYIQTKAAQQFNWLEGQLEQAKQQGKKVIITSHVPPGIDSYSNNPL--WLDDASRRFTELVAGRYHEVVAAQLYGHVHRDDIRLQAIQGDEESVNRSFALLTPSVSPIFAN-----NPSYRQFYLHPDQLVLLDYDQYFMDIVMATQFQSAQWQLDYRFSERYPSTS 491          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Nematostella
Match: EDO46993 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNV6])

HSP 1 Score: 85.8853 bits (211), Expect = 1.189e-17
Identity = 106/454 (23.35%), Postives = 181/454 (39.87%), Query Frame = 1
Query:  163 FWHVCDVHLNLSY-----------KSFGRKQFGDYKS-------DSPFSLVKSAFQQMKKIY--PNPDFIILNGDNVRHRTVSQSDFNKSLTDVSDELLHN-----------FPSSIILPSLGNHDVNPANFFDPKS---QWCRILLEKWLKFFSNNSLEIQ------------TFTKGCYYSRRITVNNITAKVIILNTMVW------YSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLK-IMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIP-----LFISPSISPFYLSGLGSVNPSVR-LYHWRTDPADRKYEQYHAKL-NDVQTKTLSWSLEYSSNSLIPGLSAFHLNELVSDFTKE--DSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCLKN 1338
            F  V D+HL+  Y           +  G     +YK+       DSP  L+ S  + M+ +Y     DF+I+ GD   H+T   S   K  T  S+ +LHN           FP   + P LGN+D    ++  P +   QW    LE +      ++   Q            TF  G YY   I    +   ++ILN+M W       S+N      +       Q  WL ++L  ++  + KVF+ GHIPPG   +              ++   I+  ++DI+   FFAH H D FK+   +  + +         ++PS+S  Y +     NP+ R +Y  R + A   Y+Q+   +    +    +W L+Y  +   P  + +   + + +  +   +  H + + TY  S     Q         R  + C ++++  ++ D C  N
Sbjct:   91 FLMVSDLHLDSYYDASVASKPTFCRGVGNYSTANYKAPYGRVGCDSPEILIDSLVKGMRSVYDEKGADFMIITGDMSSHKT-DASYLPKGKT--SERVLHNIKLASAKIHNAFPKIPVFPMLGNNDFE-GHYVLPNTSHDQWYNKTLEVFAPMILCSNCSTQDTAATTMAELKTTFLDGGYYKVHIADGRMI--LLILNSMYWNPYAVEKSYNVQVIAKR-------QLDWLEQQLEFAKKESKKVFIAGHIPPGIDPFGDKGTPFWMENCTARYTNMIVGKYSDIVAGQFFAHIHQDDFKLQMFNTSQHLTGSKTSFALLNPSVSVVYAN-----NPAFRQVYLDRKELAILDYDQHFLDIVMATEFNAPNWQLDYRFSEHYPSANKYINTDRILELNQNLINQSHENAWATYVFSRAVRYQASSYS----RFGLYCAMRHVIKSEYDKCRSN 522          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Medaka
Match: smpdl3b (sphingomyelin phosphodiesterase acid like 3B [Source:NCBI gene;Acc:101169562])

HSP 1 Score: 189.504 bits (480), Expect = 2.321e-53
Identity = 126/444 (28.38%), Postives = 220/444 (49.55%), Query Frame = 1
Query:   97 MKNTFLILFFLVLEETQCFKGVFWHVCDVHLNLSYK----------SFGRK------QFGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRHRTVSQSDFNKS-----LTDVSDELLHNFPSSIILPSLGNHDVNPANFF--DPKSQWCRI--LLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPF--YLSGL--GSVNPSVRLYHWRTDPADRK-YEQYHAKLNDVQTKTLSWSLEY--SSNSLIPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCL 1332
            M  T   L  L+ +      G FWH+ D+H + +Y+          S G++      +FGDY  DSP+ L+ S+   MK I P+PDFII  GD+  H  V   D  +      +++++  +   FP + +  +LGNHD +P +     P + + R   L   WL+  S      QTF KG YY+ ++ +N    ++++LNT ++Y  N     TQN DDP +QF W ++ L E+     KV++IGH+PPG  E   +      P +N ++L +++    +I   FF H HTD+F++ Y+ +  P+  +F+SP ++P+   L G+  G+ NP +R++ + TD    K    Y+  L         W  EY  + +  +P  S   +++ +     E   +  K+  Y  +   ++  +C  +  CR + +C  + +D+ + + CL
Sbjct:    1 MTATSFFLSCLLFKGALALTGSFWHITDLHWDPTYEVTDQPELVCASSGKRPALSAGRFGDYVCDSPWHLINSSVYAMKSILPDPDFIIWTGDDTPH--VPNEDLGEEAVINIISNLTSAITEIFPHTKVYSALGNHDFHPKSQLPAGPNTIYNRTAELWNHWLELESK-----QTFKKGGYYTEKL-LNRNGYRMLVLNTNLYYDQNQ---VTQNMDDPADQFNWADQILTEAAAIKEKVYIIGHVPPGFFEKKRSK-PWFAPKYNRRYLDLIEKHHSVILGQFFGHHHTDSFRMFYNKDRLPISTMFLSPGVTPWETTLPGVVNGANNPGIRVFEYDTDTLLVKDVVTYYLNLTHANAARGRWEKEYRLTESFRVPDASPASMHQTLERLANEHC-YLQKY--YEFNSVSYDLTDCGSD--CRVDHVCAAREVDFDRYEDCL 427          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Medaka
Match: smpdl3a (sphingomyelin phosphodiesterase acid like 3A [Source:NCBI gene;Acc:101171626])

HSP 1 Score: 148.673 bits (374), Expect = 9.638e-39
Identity = 109/384 (28.39%), Postives = 187/384 (48.70%), Query Frame = 1
Query:  157 GVFWHVCDVHLNLSYK--------SFGRKQ--------FGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRH---RTVSQSDFNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDPKSQWC-RILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTV--FRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFY-LSGLGSVNPSVRLYHWRT-DPADRKYEQYHAKLNDVQTKTLS-WSLEYSSNSLIPGLSAFH---LNELVSDFTKEDSKHFDKFFTYHL 1224
            G FWH+ D+HL+ +Y          F  K         +GD+  DSP+SL++SAF  M  +    DFII  GD+  H     +S     + + +++  +  +FP+  + P+LGNHD  P +     +    +   E W  +  + +L   T ++G +YS+ +       +++ LNT+++Y  +     T+N  DP  QF WL + L  +  +  K+++IGH+P G   Y P V     ++   N + + I + +A +I   F+ H H D+  ++ D   KPV  LF+SP+++P   +  L S NP  R+Y + + D +     QY+  L +   K  S W LEY       GL+      L +L   F +  +K FD +F++ +
Sbjct:   32 GRFWHITDLHLDPTYHLAPDPTKVCFSSKGVPAAHAGIYGDFLCDSPYSLIQSAFAHMAPLTQPQDFIIWTGDSPPHVPPDELSTDMVIQVIGNMTHTIREHFPNLTVYPALGNHDYWPQDQMPASTNAIYKAAAELWKPWLQSEAL--LTLSEGGFYSQLVKPG---LRLVSLNTILYYGPDQ---VTKNMSDPAGQFQWLQETLESAAQNLEKIYIIGHVPVG---YLPFVKNTTAIQKRHNERLVSIFRKYAHVIAGHFYGHTHRDSIMVLLDQRGKPVNSLFVSPAVTPIKNVLELYSNNPGFRMYLYNSQDYSMLDIWQYYLNLTEANEKQKSDWRLEYIMTEAF-GLTDLQPQSLLQLGLSFLEPQTKAFDTYFSHFM 403          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Medaka
Match: smpd1 (sphingomyelin phosphodiesterase 1 [Source:NCBI gene;Acc:101174765])

HSP 1 Score: 101.293 bits (251), Expect = 4.060e-22
Identity = 102/407 (25.06%), Postives = 168/407 (41.28%), Query Frame = 1
Query:  196 SYKSFGRKQFGDY-KSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRHRTVSQS-DFNKSLTDVSDELLHNF--PSSIILPSLGNHDVNPANFFDP-------KSQWC-RILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHN--DKPVIPLFISPSISPFYLSGLGSVNPSVRLY-----HWRTDPADRKYEQYHAKLNDVQ--------TKTLSWSLEYSSNSL--IPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSC 1329
            S++  G   +G Y K D P   V+S  +   +     D++   GD   H   SQ+ D       V   L+H    P+  + P++GNH+  P N F P        S W    + E+W  +    +L  +T   G +Y+  I       +V+ LN    +    + +   NS DP NQ  WL   L +S     KV +IGHIPPG    S          ++  +  I+  +   +   FF H H D F++ YD     + V   F++PS++ +      ++NP  R+Y     +  +      +  Y   L +V          K   W+L Y +     +P +     + L+  F   D + F KF  ++L  + H    C E  SC+  I+C +Q+    +L+ C
Sbjct:  207 SWRRRGAGYWGTYSKCDLPLRTVESLLENAARD-GRWDWVYWTGDIPAHNIWSQTRDQQLMELTVISRLVHKHLGPNVTVYPAVGNHESTPVNSFPPPFIHGNRSSGWLYAAMAEEWAPWLPEPAL--KTLRYGGFYTVEIQPG---LRVVSLNMN--FCARENFWLMVNSTDPANQLQWLVHILQDSEEKGEKVHIIGHIPPGLCLGS----------WSWNYYHIINRYESTVTGQFFGHTHLDEFQMFYDEETMTRAVGVAFVAPSVTTYV-----NLNPGYRVYIVDGNYKGSSRLVLDHATYILNLTEVNRPEVLGNPVKDPKWTLLYRATEAYGLPTMFPSDYDLLLRTFISND-RVFQKF--WYLRHKGHVSEVCKE--SCKTTILCFLQSGRSDQLEQC 585          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Planmine SMEST
Match: SMESG000078127.1 (SMESG000078127.1)

HSP 1 Score: 1081.63 bits (2796), Expect = 0.000e+0
Identity = 540/542 (99.63%), Postives = 541/542 (99.82%), Query Frame = 1
Query:   97 MKNTFLILFFLVLEETQCFKGVFWHVCDVHLNLSYKSFGRKQFGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRHRTVSQSDFNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDPKSQWCRILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFYLSGLGSVNPSVRLYHWRTDPADRKYEQYHAKLNDVQTKTLSWSLEYSSNSLIPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCLKNCPHKPVSQWXXXXXXXXXXXXXXXXXXXGANKVYCRGRRTASLTRDIYLAPYNGKNCEDIMSEHIDNIAENTFCDVPEYRGHIRNNSRTILTLNDGNEIVEKSQPSFSKFAVQSKNNKSQEKYDYTRM 1722
            MKNTFLILFFLVLEETQCFKGVFWHVCDVHLNLSYKSFGRKQFGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRHRTVSQSDFNKSLTDVSDELL NFPSSIILPSLGNHDVNPANFFDPKSQWCRILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFYLSGLGSVNPSVRLYHWRTDPADRKYEQYHAKLNDVQTKTLSWSLEYSSNSLIPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSE+ISCRCNIICGIQNIDYTKLDSCLKNCPHKPVSQWVMIVSVIIIFTIILIGVVIGANKVYCRGRRTASLTRDIYLAPYNGKNCEDIMSEHIDNIAENTFCDVPEYRGHIRNNSRTILTLNDGNEIVEKSQPSFSKFAVQSKNNKSQEKYDYTRM
Sbjct:    1 MKNTFLILFFLVLEETQCFKGVFWHVCDVHLNLSYKSFGRKQFGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRHRTVSQSDFNKSLTDVSDELLQNFPSSIILPSLGNHDVNPANFFDPKSQWCRILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFYLSGLGSVNPSVRLYHWRTDPADRKYEQYHAKLNDVQTKTLSWSLEYSSNSLIPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSESISCRCNIICGIQNIDYTKLDSCLKNCPHKPVSQWVMIVSVIIIFTIILIGVVIGANKVYCRGRRTASLTRDIYLAPYNGKNCEDIMSEHIDNIAENTFCDVPEYRGHIRNNSRTILTLNDGNEIVEKSQPSFSKFAVQSKNNKSQEKYDYTRM 542          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Planmine SMEST
Match: SMESG000055453.1 (SMESG000055453.1)

HSP 1 Score: 417.157 bits (1071), Expect = 1.145e-140
Identity = 205/425 (48.24%), Postives = 286/425 (67.29%), Query Frame = 1
Query:  109 FLILFFL--VLEETQCFKGVFWHVCDVHLNLSYKSFGRKQFGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRHRTVSQSDFNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDPKSQWCRILLEKWLKFFSNNSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFYLSGLGSVNPSVRLYHWRTDPADRKYEQYHAKLND----VQTKTLSWSLEYSSNSLIPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCLKNCPHKPVSQW 1365
             L LF++   +  +  F+G+FWH+ D+HLN+S+     + +GDYK+D+ F LV SA + MK IY NP FII NGDN  HR  ++S+F +SL +VS E+   FP++ ILP+LGNHDVNP++ F+  S WC  LL  W  F +++  E + F KGC+YSR I   N T K+I+LN+M+WY    H    ++  DPL+QF+WL  EL E+     +VF++ HIPPGASE+SP  FR     FN +FL+I+Q++++IIDAGFF HQH DAFKIVYD   KP IPLF+SPS+SP +L GLGS+NPS+RL+ W +  ++ KY+QYH  + +     +  TL+W LEY S +L  GLSA  L+    D +K++S +F++FFTYHLSGR H+    S N + RC I+CG++NIDYT LD CL  C  +  + W
Sbjct:    3 LLSLFYICAAIGSSLGFEGIFWHISDIHLNVSFNLGNNRWYGDYKNDASFPLVHSAIKAMKTIYHNPLFIIWNGDNAYHRIANRSNFLESLKNVSSEIRFYFPNANILPTLGNHDVNPSSLFNANSTWCEELLIFWKDFVNSSENETKRFLKGCFYSRTIKSGNDTVKIIVLNSMLWY---RHNKLVKDERDPLSQFSWLMNELEEAAMKKQRVFVVSHIPPGASEFSPKKFRFFHSKFNKRFLEILQNYSNIIDAGFFGHQHVDAFKIVYDTQGKPKIPLFLSPSVSPLHLKGLGSINPSIRLFFWNSSLSNCKYQQYHTTIPNELNNTKNNTLNWILEYDSKTLYSGLSAEDLDNFSLDLSKDNSIYFERFFTYHLSGRSHDSG-ASNNSTIRCQIVCGLRNIDYTNLDKCLVKCSDESSTFW 423          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Planmine SMEST
Match: SMESG000024647.1 (SMESG000024647.1)

HSP 1 Score: 403.675 bits (1036), Expect = 1.894e-135
Identity = 206/406 (50.74%), Postives = 270/406 (66.50%), Query Frame = 1
Query:  151 FKGVFWHVCDVHLNLSYKSFGRKQFGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRHRTVSQSDFNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDPKSQWCRILLEKWLKFFSNNS-LEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFYLSGLGSVNPSVRLYHWRTDPADRKYEQYHAKL---NDVQTK--TLSWSLEYSSNSLIPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCLKNCPHK 1350
            F+G FWH+CD+HLN S+      ++G+YK DS F+L +S+   MK  Y  PDFII+NGDN  H  +     N S+++V+ EL  +FP++ ILPS+GNHD+NPANF    S WC+   + W     N S  +I+TF KGC+Y+  I   N    +I+LN ++WY  NS+  T   + DPLNQF WL  +L  +R S  KVFL+ H+ PGA+E +P  F +  P FN +FLK++QD+AD+IDAGFFAHQHTDAFKIVY+ N++PVIPLF+SPS++PF L  LGSVNPSVRLY W    A  +Y QYH  L    ++ +K  T+ W LEY SN+L P LSA  L+  VS+F+   S  F  FF+YHLSG+PH+   C E  SCRC  ICGI+NIDYT LDSCL  C  K
Sbjct:   24 FQGTFWHICDIHLNNSFILNDINRYGNYKDDSTFALFQSSVLFMKSSYTYPDFIIVNGDNSYHGKIQDYQLNASISNVTGELRLHFPATAILPSMGNHDINPANFISVNSSWCQNFYKFWESVLPNISNSDIETFKKGCFYTHSIDTKNSKQMIIVLNAILWYQVNSYVKT---NSDPLNQFMWLKTKLQLARASMMKVFLVAHVSPGAAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYNSNNEPVIPLFLSPSVTPFNLWQLGSVNPSVRLYVWNGTSAGSRYHQYHTHLPPTGNINSKSVTIEWKLEYVSNTLFPNLSAKSLDGFVSEFSLSSSPSFKSFFSYHLSGQPHDDETCPETSSCRCRFICGIRNIDYTSLDSCLTKCASK 426          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Planmine SMEST
Match: SMESG000071517.1 (SMESG000071517.1)

HSP 1 Score: 365.925 bits (938), Expect = 3.804e-121
Identity = 184/415 (44.34%), Postives = 265/415 (63.86%), Query Frame = 1
Query:   97 MKNTFLILFFLVLEETQCFKGVFWHVCDVHLNLSYKSFGRKQFGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRHRTVSQSDFNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDPKSQWCRILLEKWLKFFSN-NSLEIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFYLSGLGSVNPSVRLYHWRTDPADRKYEQYHAKL-NDVQTKTLSWSLEYSSNSLIPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCLK 1335
            M     I    +   T  F+G FW +CD+HLN+S  ++     G+YKSDS   L+KSA  +MK IY NP+FII+NGDN+ H     + FN+++  VS+E+ + F S+I++PSLGNHD+ P N     S WC +    W K+ +N + +EI+   KGC+YSR I   N    V++LNT++WY+ N  T    N  DP +QF WL + +  ++N   K+FL+GHIPPG SEYS  +  HL   FN + + IMQ   + I AG FAHQH+DAFK+VY+  +KPV+P+F++PS++PF LS +GSVNPS RLY W T   +  Y+QYHA L +  + + L+W+ EYSS   + G+SA HL++L+SDF  ++S +F+KFF+YHLSG+ H+   C  +  CR   IC ++ +DY    SC K
Sbjct:    1 MVQLLWIFLGALFHLTVGFQGYFWDICDLHLNISNLNYSLANLGNYKSDSTILLMKSALIEMKSIYSNPEFIIVNGDNMFH---GDAKFNETIVMVSNEIFNIFSSAIVIPSLGNHDIMPRNVIQNYSPWCNVWYNIWEKYLNNLDPVEIENAKKGCFYSRTIQSKNGNVLVVVLNTLLWYTRNRLTL---NQLDPNDQFKWLEQRIQYAKNMKIKIFLVGHIPPGTSEYSSIIIEHLHSNFNSRLVDIMQSNYETIHAGIFAHQHSDAFKVVYNKTNKPVVPIFLAPSVTPFRLSTIGSVNPSFRLYKWSTTAENSSYDQYHAILPSSNEKQILAWTKEYSSLEFVAGISAGHLDKLLSDFASKNSTYFNKFFSYHLSGQSHDNAACPYDSQCRHQFICSMKYVDYPAFYSCWK 409          
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Planmine SMEST
Match: SMESG000024635.1 (SMESG000024635.1)

HSP 1 Score: 359.377 bits (921), Expect = 1.579e-118
Identity = 187/425 (44.00%), Postives = 251/425 (59.06%), Query Frame = 1
Query:   97 MKNTFLILFFLVLEETQCFKGVFWHVCDVHLNLSYKSFGRKQFGDYKSDSPFSLVKSAFQQMKKIYPNPDFIILNGDNVRHRTVSQSDFNKSLTDVSDELLHNFPSSIILPSLGNHDVNPANFFDPKSQWCRILLEKWLKFFSNNSL-EIQTFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFAWLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQDFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFYLSGLGSVNPSVRLYHWRTDPADRKYEQYHAKL----NDVQTKTLSWSLEYSSNSLIPGLSAFHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGIQNIDYTKLDSCLKNCPHKPV 1356
            M++ F  +  L    T+CF+G FW +CD+HLN+S  +     FGD++ DS   L++SAFQ+MKKIYP PDFII+NGDNV H  V                         L  L N +VN ++        C I  + W  FF N S  E++TF KGC+YS ++        ++ LNTM+WY  N++    +   DP NQF WL ++L   R +  K FLIGH+PPG  E+S  + +HL   +N K L IMQD+ D+IDAGFFAHQHTDAFK+V   + KP+IP+F SPS++PF L G+GS+NPS+RLY+W    A   Y QYH K+    N  +   LSWSLEY+S SLI GL+A  LN L+ DF +E+SK+FD FF YHLSG+ H    C     CRC  IC +Q+ID +    C   C  + +
Sbjct:    1 MQHLFCFIVLLSSRPTKCFEGAFWDICDLHLNISQPTDINGGFGDFRQDSSIGLIRSAFQEMKKIYPYPDFIIVNGDNVYHGNVG-----------------------FLEPLHNVNVNSSS--------CDIFYKVWSVFFQNASQSEVETFIKGCFYSIKVKSKGGNINIVALNTMLWYGRNNYVRALK---DPENQFIWLEEKLKIFRKNKEKAFLIGHVPPGILEHSTFIIKHLHSQYNEKLLWIMQDYVDVIDAGFFAHQHTDAFKLVLSSDKKPIIPIFHSPSVTPFNLRGIGSINPSIRLYYWNNSSAASYYHQYHTKIPIVTNISKNVDLSWSLEYNSKSLINGLTAEDLNNLLKDFDQENSKYFDLFFKYHLSGQDHYNLTCPWISKCRCQFICSMQDIDISTAVKCASKCVERDI 391          
The following BLAST results are available for this feature:
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMPDL3B1.392e-5428.00sphingomyelin phosphodiesterase acid like 3B [Sour... [more]
SMPDL3B7.227e-4830.03sphingomyelin phosphodiesterase acid like 3B [Sour... [more]
SMPDL3A1.945e-4530.71sphingomyelin phosphodiesterase acid like 3A [Sour... [more]
SMPDL3B9.246e-4226.01sphingomyelin phosphodiesterase acid like 3B [Sour... [more]
SMPDL3A1.177e-3531.13sphingomyelin phosphodiesterase acid like 3A [Sour... [more]
back to top
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZK856.53.305e-4128.13pep chromosome:WBcel235:V:10186012:10190157:-1 gen... [more]
ZK856.53.305e-4128.13pep chromosome:WBcel235:V:10186023:10190366:-1 gen... [more]
ZK856.53.305e-4128.13pep chromosome:WBcel235:V:10186023:10190131:-1 gen... [more]
asm-24.694e-2424.74Sphingomyelin phosphodiesterase 2 [Source:UniProt... [more]
asm-13.017e-2327.89Sphingomyelin phosphodiesterase 1 [Source:UniProt... [more]
back to top
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG320521.785e-3726.69gene:FBgn0044328 transcript:FBtr0347598[more]
CG320521.785e-3726.69gene:FBgn0044328 transcript:FBtr0347599[more]
CG320521.785e-3726.69gene:FBgn0044328 transcript:FBtr0332818[more]
CG33766.984e-2328.47gene:FBgn0034997 transcript:FBtr0072265[more]
CG33766.997e-2328.47gene:FBgn0034997 transcript:FBtr0072266[more]
back to top
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
smpdl3b2.685e-5327.79sphingomyelin phosphodiesterase acid like 3B [Sour... [more]
smpdl3a1.114e-3729.86sphingomyelin phosphodiesterase acid like 3A [Sour... [more]
smpd12.074e-2526.04sphingomyelin phosphodiesterase 1 [Source:ZFIN;Acc... [more]
smpdl3a2.906e-1830.72sphingomyelin phosphodiesterase acid like 3A [Sour... [more]
back to top
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ak92.287e-5431.08adenylate kinase 9 [Source:Xenbase;Acc:XB-GENE-994... [more]
smpdl3a2.460e-4631.70sphingomyelin phosphodiesterase acid-like 3A [Sour... [more]
smpdl3a7.935e-4631.43sphingomyelin phosphodiesterase acid-like 3A [Sour... [more]
SMPD12.743e-2225.89sphingomyelin phosphodiesterase 1 [Source:NCBI gen... [more]
back to top
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Smpdl3b1.630e-4928.60sphingomyelin phosphodiesterase, acid-like 3B [Sou... [more]
Smpdl3a5.638e-4630.33sphingomyelin phosphodiesterase, acid-like 3A [Sou... [more]
Smpd12.987e-2125.78sphingomyelin phosphodiesterase 1, acid lysosomal ... [more]
back to top
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q92485|ASM3B_HUMAN6.686e-5428.00Acid sphingomyelinase-like phosphodiesterase 3b OS... [more]
sp|P58242|ASM3B_MOUSE1.140e-4828.60Acid sphingomyelinase-like phosphodiesterase 3b OS... [more]
sp|P70158|ASM3A_MOUSE3.944e-4530.33Acid sphingomyelinase-like phosphodiesterase 3a OS... [more]
sp|Q92484|ASM3A_HUMAN9.341e-4530.71Acid sphingomyelinase-like phosphodiesterase 3a OS... [more]
sp|Q3ZC91|ASM3A_BOVIN1.132e-4430.42Acid sphingomyelinase-like phosphodiesterase 3a OS... [more]
back to top
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3FBP92.957e-7335.46Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0V0JC011.418e-7036.07Acid sphingomyelinase-like phosphodiesterase 3b OS... [more]
A0A075A8F61.558e-6833.78Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
A0A5J4NSB38.025e-6633.19Sphingomyelin phosphodiesterase acid-like 3 OS=Par... [more]
A0A5J4N8I21.167e-6534.61Sphingomyelin phosphodiesterase acid-like 3 OS=Par... [more]
back to top
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
smpdl3b6.410e-5428.89sphingomyelin phosphodiesterase acid like 3B [Sour... [more]
smpdl3a2.917e-4830.42sphingomyelin phosphodiesterase acid like 3A [Sour... [more]
smpd12.542e-725.58sphingomyelin phosphodiesterase 1 [Source:ZFIN;Acc... [more]
smpd13.154e-625.44sphingomyelin phosphodiesterase 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
smpdl3b2.105e-3726.65sphingomyelin phosphodiesterase acid like 3B [Sour... [more]
smpd11.692e-2023.00sphingomyelin phosphodiesterase 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PPN19.481e-1427.08Dual endo- and exopolyphosphatase with a role in p... [more]
back to top
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO312089.345e-3028.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468746.134e-1823.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469931.189e-1723.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
smpdl3b2.321e-5328.38sphingomyelin phosphodiesterase acid like 3B [Sour... [more]
smpdl3a9.638e-3928.39sphingomyelin phosphodiesterase acid like 3A [Sour... [more]
smpd14.060e-2225.06sphingomyelin phosphodiesterase 1 [Source:NCBI gen... [more]
back to top
BLAST of Acid sphingomyelinase-like phosphodiesterase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078127.10.000e+099.63SMESG000078127.1[more]
SMESG000055453.11.145e-14048.24SMESG000055453.1[more]
SMESG000024647.11.894e-13550.74SMESG000024647.1[more]
SMESG000071517.13.804e-12144.34SMESG000071517.1[more]
SMESG000024635.11.579e-11844.00SMESG000024635.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020584 ID=SMED30020584|Name=Acid sphingomyelinase-like phosphodiesterase|organism=Schmidtea mediterranea sexual|type=transcript|length=1795bp
TTTACTTTTATGAAAGTTTTATATTGTATATAATAATTTTTAATTATTTT
AAAGTATTTATCTGACAATAGTACTATGATTTTTGAATCACTTTAAATGA
AAAATACTTTTTTAATTTTATTTTTCCTAGTACTTGAAGAAACCCAATGT
TTTAAAGGTGTATTTTGGCATGTATGTGATGTACATTTAAATTTATCTTA
CAAGTCTTTCGGGCGTAAACAGTTTGGAGATTATAAAAGTGATTCTCCAT
TTAGTTTAGTTAAATCTGCATTTCAACAGATGAAAAAAATTTATCCGAAT
CCAGATTTTATTATTTTAAATGGCGATAATGTACGTCACAGAACTGTTAG
TCAATCAGATTTCAATAAATCTTTGACAGATGTCAGTGATGAATTGCTTC
ATAATTTCCCATCATCTATAATTTTGCCTTCATTGGGAAATCATGATGTC
AATCCAGCTAATTTTTTTGATCCAAAAAGTCAGTGGTGTCGAATTTTACT
TGAAAAATGGCTAAAGTTTTTCTCAAATAACAGTTTAGAAATTCAAACTT
TTACAAAAGGTTGTTATTATTCTCGTCGAATTACGGTGAATAATATAACG
GCAAAGGTAATAATTCTCAATACCATGGTATGGTATTCATTCAATTCCCA
TACATTCACAACTCAAAATTCAGACGATCCTCTTAATCAATTTGCTTGGT
TAAATAAAGAACTAATAGAGTCACGCAATAGTGCAACAAAGGTATTTCTC
ATTGGTCACATACCTCCGGGAGCTTCAGAATATAGTCCGACAGTATTTAG
ACATTTACGACCAGGATTCAACATGAAATTCTTAAAAATTATGCAAGACT
TTGCTGATATTATTGATGCAGGATTTTTCGCACATCAACACACAGATGCT
TTCAAAATCGTCTATGATCATAACGACAAACCTGTTATTCCTTTATTTAT
TTCTCCTTCAATCAGTCCTTTTTATCTATCAGGACTCGGTTCTGTTAATC
CTTCTGTACGCCTTTATCATTGGAGAACTGATCCTGCAGACAGAAAATAT
GAGCAGTACCATGCTAAATTAAATGACGTTCAAACAAAAACACTGAGCTG
GTCACTGGAATACAGTTCCAATTCTTTAATACCGGGTCTTTCTGCTTTTC
ATCTCAATGAACTCGTTTCAGATTTTACCAAGGAAGATTCTAAACATTTT
GATAAATTTTTCACTTATCACCTATCTGGTCGACCTCACGAACAAAACGA
ATGCTCAGAGAACATTTCTTGTCGTTGTAACATTATCTGTGGAATTCAAA
ACATAGATTACACAAAGTTGGATTCATGTTTAAAAAATTGTCCTCATAAA
CCCGTCAGTCAATGGGTAATGATCGTTTCGGTCATTATTATATTCACAAT
CATTCTCATTGGTGTTGTAATTGGTGCAAATAAAGTTTATTGTCGAGGGC
GCCGAACTGCTAGCTTGACTCGAGATATATATCTGGCACCGTATAACGGG
AAAAACTGTGAAGATATAATGTCAGAACACATCGATAATATTGCCGAAAA
CACGTTCTGTGATGTTCCCGAGTATCGGGGACACATTAGAAACAATTCGC
GCACAATTCTCACTCTCAATGACGGCAACGAAATTGTCGAAAAATCACAG
CCGTCGTTTTCTAAATTTGCTGTACAAAGCAAAAATAATAAATCTCAAGA
AAAATATGATTATACACGAATGTGATTCCCTTCTCAGTCCGGCTATCGTT
TGTGCGTGTGTGCGTGCGTGCGTGCGTGCGTGCGTTCGCACGTTT
back to top

protein sequence of SMED30020584-orf-1

>SMED30020584-orf-1 ID=SMED30020584-orf-1|Name=SMED30020584-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=543bp
MKNTFLILFFLVLEETQCFKGVFWHVCDVHLNLSYKSFGRKQFGDYKSDS
PFSLVKSAFQQMKKIYPNPDFIILNGDNVRHRTVSQSDFNKSLTDVSDEL
LHNFPSSIILPSLGNHDVNPANFFDPKSQWCRILLEKWLKFFSNNSLEIQ
TFTKGCYYSRRITVNNITAKVIILNTMVWYSFNSHTFTTQNSDDPLNQFA
WLNKELIESRNSATKVFLIGHIPPGASEYSPTVFRHLRPGFNMKFLKIMQ
DFADIIDAGFFAHQHTDAFKIVYDHNDKPVIPLFISPSISPFYLSGLGSV
NPSVRLYHWRTDPADRKYEQYHAKLNDVQTKTLSWSLEYSSNSLIPGLSA
FHLNELVSDFTKEDSKHFDKFFTYHLSGRPHEQNECSENISCRCNIICGI
QNIDYTKLDSCLKNCPHKPVSQWVMIVSVIIIFTIILIGVVIGANKVYCR
GRRTASLTRDIYLAPYNGKNCEDIMSEHIDNIAENTFCDVPEYRGHIRNN
SRTILTLNDGNEIVEKSQPSFSKFAVQSKNNKSQEKYDYTRM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004767sphingomyelin phosphodiesterase activity
GO:0046872metal ion binding
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005615extracellular space
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006685sphingomyelin catabolic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR029052Metallo-depent_PP-like
IPR004843Calcineurin-like_PHP_ApaH
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004843Calcineurin-like phosphoesterase domain, ApaH typePFAMPF00149Metallophoscoord: 23..266
e-value: 6.0E-13
score: 49.8
IPR029052Metallo-dependent phosphatase-likeGENE3DG3DSA:3.60.21.10coord: 38..338
e-value: 1.0E-10
score: 43.3
NoneNo IPR availablePANTHERPTHR10340SPHINGOMYELIN PHOSPHODIESTERASEcoord: 5..415
NoneNo IPR availablePANTHERPTHR10340:SF13SPHINGOMYELINASE PHOSPHODIESTERASE Ccoord: 5..415
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.732
NoneNo IPR availableSUPERFAMILYSSF56300Metallo-dependent phosphatasescoord: 23..312
NoneNo IPR availableTMHMMTMhelixcoord: 422..444