Dynein heavy chain axonemal

Overview
NameDynein heavy chain axonemal
Smed IDSMED30020574
Uniprot Best hitDynein heavy chain 1, axonemal OS=Mus musculus OX=10090 GN=Dnah1 PE=1 SV=1 (E=0)
Length (bp)12797
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynein heavy chain axonemal (SMED30020574) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein heavy chain axonemal (SMED30020574) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynein heavy chain axonemal (SMED30020574) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynein heavy chain axonemal (SMED30020574) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020574

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 23

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30020574SMESG000017294.1 SmedASXL_014192SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30020574SMESG000017294.1 dd_Smed_v4_13058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30020574SMESG000017294.1 dd_Smed_v4_13058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30020574SMESG000017294.1 dd_Smed_v4_6790_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30020574SMESG000017294.1 dd_Smed_v4_6790_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30020574SMESG000017294.1 dd_Smed_v4_6790_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30020574SMESG000017294.1 dd_Smed_v4_6790_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30020574SMESG000017294.1 dd_Smed_v4_6790_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30020574SMESG000017294.1 dd_Smed_v4_6790_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30020574SMESG000017294.1 dd_Smed_v6_6790_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neuronSMED30020574SMESG000017294.1 Contig40083uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30020574SMESG000017294.1 Contig40083newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
reproductive organSMED30020574SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021640.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000017296.1 SMESG000017295.1 SMESG000017294.1 SMESG000018675.1 Contig18951uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30020574SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021640.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000017296.1 SMESG000017295.1 SMESG000017294.1 SMESG000018675.1 Contig18951newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30020574SMESG000017294.1 dd_Smed_v4_13058_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30020574SMESG000017294.1 dd_Smed_v4_13058_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30020574SMESG000017294.1 dd_Smed_v4_13058_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30020574SMESG000017294.1 dd_Smed_v4_13058_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020574SMESG000017294.1 dd_Smed_v4_6790_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30020574SMESG000017294.1 dd_Smed_v4_6790_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30020574SMESG000017294.1 dd_Smed_v4_6790_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30020574SMESG000017294.1 dd_Smed_v4_6790_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ciliated epithelial cellSMED30020574SMESG000017294.1 dd_Smed_v4_6790_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein heavy chain axonemal vs. Ensembl Human
Match: DNAH1 (dynein axonemal heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:2940])

HSP 1 Score: 5353.1 bits (13885), Expect = 0.000e+0
Identity = 2623/4222 (62.13%), Postives = 3284/4222 (77.78%), Query Frame = 2
Query:  119 KYPEVKQRGYYSEILSDGAIEQLENVTHGPPEVQNLLSQTIHYENTPKVGTFEIPDQLNSNIDVH--GESTKIDIIIDFPEKSFEPKLQLMYFVAPGMIPRRVRLEREKRAYXXXXXXXXXXXXGNITSDYLIPKY----HPPNGKK-FDGSWAPYLFLETFDNEEYEIRNPDEWLAMGLEDGV--RKPVPGRALLPVTDDKHDVDIRDPSIDWTWQSVGVLDYDTDTKLWFVQKTDKSGRVIDDIGRPVIDGGLLPTGHFLEMSNQYWIPRIQLMFLAENPIKFSNRVIEAYQSRELHEALLRYHLYLDCMPMDGLGELDQSSLKRMIRLSKDETPILKKQKGLEDAVQSLEKEVMVDYWRSMNTIILHKLVGENPQKFNYITLPKPELPKVPMKGTIPMPKYDWDTKFEEFAFYSLLTKPEVVQAMCKSQYECLEARNKQLFHVPLAKHMRLEEFEQTQSQATQQVSLFLKDTWIDNLQKFIRTSLRDSKKGWFNIYETDFYVYTKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKG-LYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAE------------LHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            KYP +KQRG+YS+ILS G ++QL  V  GP   QNLL Q    + TP+VG+FE+P+     ++    G +T++    DFP +++EPK+Q+ + V PG  PR++ +ER K+ Y  L +E LL S+G I S+ L+P++    HP   ++  D  +  YL L+ FDNE+++ R P EW+ MGLE G   RKPVPG+ALLP  D     D +   + + W  VGVLDYD + KL+ V KTD+ G V D++GRP+++ G+   G       QYW+PRIQL+F AE+P  F+ RV++A   R+  EALL Y+LY+DCMP DG   + + SL + I+     TP ++K   + + + SL +EV +DY RSMN I    +V   P+ F+Y+TLPK E  +VP +G + +PKY +  + E+F F SLLT+PEV+ A+ K + EC +     LFH  L+K+  LEEFEQ QSQ   QV +FLKD+WI +L+  +R+SLRD  KGW+N+YET++ VY  SKL+K MELVKY +QD++R+L  DSL +F   I+D C + +       W +DL+ S   P+KNP+F++DLVLD++G HYSTPL+QF    +NLFDK I A   VPQLE+ +M+DI  + +PLLESVG+ EP V++LR  +   + KA+IP+++YA EY K+L L N DI      FL+ Y+ Q   A E++  V  HL EKEIL+  +P  IIIGPFYINT+NV+Q L+KKRKA+A ++LD+LA+ L K  D  CE F++I+RK+YE+PN+IEELAELREW+  IP+ L   +E I K + DY++++EF YNLS+DDFN KW    WP KI   I  V+Q  +EDEE+FRK+Q+ D   F EKL+ L + VA    + +I++AHE+ANEVRR+ KQL + Q  A+L+NNRER+F+ P+TNY+KLS++VK+F+P+ +LW   SDW++  +S MNDPL A+D+E +EK+V E +KTMHK VK F ++P+ QEVA  I+  IEEFKP+IPLIQGLRNPGMR RHWE LS+++ I++ PK+ LTF++CLEM LQDHIE ISK+AEVAGKEYAIEQAL+KM  EW  + F VL YK T TYILK  DE +QLLDDHIVMTQ+M FSPYKKPFE+RI  WE  L+ TQ+V++EWL CQR WLYLEPIFSSEDIN+QLPVE KRY TM+R+W+KIMK A++N  VI +C D R+L +L++CNK+L+ VQKGLSEYLETKR +FPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIA+L F++DLEIT M+S EGE++    S YP+ NVE+W+ E+E  M+ S+  II K +  Y  +PRT+WVL WPGQV IAGCQTYWT EV++ALE  +L+  L+ +L +QL  L A+VRG ++++ R  LSALIVIEVHA+DVV+ +I EN+ ++NDF+WISQLRYYW   +L IRAVNAEF YGYEYLGN+ RLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKA AIQ VVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQI TIQKAQQQR++RFMFEG+E+ L PSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYA+I EISL+SFGF++A  L+KKI TTFKLSSEQLSSQDHYDFGMRAVK+VISAAGNLKR+N +M+EELICLRAI+DVNVPKFL +DLKLF+GIVSDLFP IKEE  DYG L  +I+ A R   LKDV GF+ KCIQL+ETTVVRHGLMLVGPTGSGK+ CY VL +A++SLK Q S  G  ++ V+ YVLNPKSITMGQLYGEFDL+THEWTDGI S+ IR G   +  +K+WY+FDGPVDA+WIENMNTVLDDNKKLCLSSGEIIKL E MTMMFEV DLAVASPATVSRCGMVYLEPSILGL PF+ECW+R LP  + P+ E  + LF  +LEE++ F+R +++E++ +TN  LT +++KL+D F  PF+P                      + LK               +IP E +++I E +E WF+FSLIWS GA+ D+  R  F  +LR KM  + + L FPEEGLV+DYR +  G         ++E+E  + +++ WV WM +   + + PD  Y +IIVPT+D V++  + + LL +KKPV+C+GPTGTGKTL+ISDKL K +  +YIS F+ FSA+T+ANQTQD IDSKLDKRRKGVFGPP+G+  IFFIDDLNMPALE +G+QPPIEL+RQW D  GWYDRK IG F++LVDINF+ +MGPPGGGRN +T RLMRHFN L F E+ E S K +F TIL  W+   + E            +    E LV+A I VY  I SQ+LPTPAKSHYTFNLRDLSKVFQGMLM +P  +    Q+LRLW+HE+CRVF+DRLVN++DR WF  LL  +    +   +  V   +P+LYGDFMS   + K Y       KM++VIEE +ED+NQINTAK+ LVLFMDA+ H+CRI+R +RQ LGNALLLG+GGSGR SLT+LA+HMAEY+CFQIELSKNYG++EWRDD+K+++L AGL+N PI FLFSDTQIK+ESFLED+NN+LNSGD+PNLY+ D+ ++I   M+P +Q+ GLQ TK NL +AY+ RVR N+H V+ MSPIGE+FRARLRQFP+LVNCCTIDWF++WP EAL+SVA  FLN+IPELE S+E I+GL+ +C  IHQSVS    +Y  EL+R+NYVTP SYLELL IFS +  +KK ELK A++R K+GLDKLL T E V K+QE+LE M P LE+A +++  T E+I+ D+ +A+ET+  V  EE  A +KAK+ + I DDAQ+DLDEALPAL  +L SL+ LNKND+TEVRAM RPP GV+LVIE VCIMK +KPKK+ G+KPG K+DDYW+ GKGLLQDPG FL+SLF +DKDNI D VI+ I+PYI +E F PA I KVS+ACTSICQWVRAM+KYHFVAK V PKR+AL  +  +L  T++IL EA+ +L+ VED I  +Q K   C  +++ELE K + CE RL RA KLI GLS+EK+RWQ++V NL++++NNI G+VL++AG+VAYLG FTG+YR  +   W   L+++ VPHT +P   L+ T G+PVKIR+WQI GLP DTLS+EN VI +FS+RW  FIDPQ QAN+WIKN++K+NGLDV KLSD+DFLRS+ENAIRFGKPCL+ENVGEELDPALEP+LLKQT+KQQG  V+KLGD +IPYH+DFR YITTKLPNPHYTPE+STK+T++NFTLSPSGLEDQLLG VVAEERPDLE+AKNQLI+SNAKMRQELK+IED+ILYRLS +EG+PVDD++LI+ LEASK+K+ EI+AKV IAEQTE+DID TR  YIPVA+RTQILFFCV+DLA +DPMYQYSLEWFLNIF +GI N+ +AD L +RI NIN Y T+SLYSNVCRSLFEKHKL+F+FLL  RI+ +EGKI+ +EWR+LL+GGS+      NPAP+W+SDR W +IL L++LP FS F  +F+ K+L++F+ IFDSLEPHRE LPG W    D+FQ LLVLRCLR DKVTNAMQDFVA  L  RFIEPQTA+L++V+KDS+ TTPLIFVLSPGTDPA+DLYKFA++MKFSKKLSAISLGQGQGPRAE ++++++ERGKWVFFQNCHLAPSWMP+LERL+E I+ DKVHRDFRLWLTS+PS KFPV ILQNGSKMT+EPPRG++ANLLKSY+S  +DFLNS  K  E++ LLLSLCLFHG  +ER+KFGPLGFNIPYEFTDGDLRICI+QL MFL EY D+P+KVL+YTAG INYGGRVTDDWDRRC+MN+L  FYNP V++ ++ YS SGIY QI P  D  GY++YI+SLP+ND PEIFGLHDNANITFA NET  LL  +++LQPK S+AG + REEIVE+V++ IL  +PE  N++ +  +YPV+YE+SMNTVL+QEVIRYNRLL +I  +L+DLLKA++GLVVMS  LE M+ SLY+N VP+ W++KAYPSLKPL+SWV+DL QR+ F+Q WI +GIP VFWISGFFFPQAFLTGTLQNFARK +ISIDTISF FKVM +A  E+T+ P  GCYI GLFLEGARWD    QL ES+PKEL+TEM VIWL+P  NR     + Y CP+YKTLTRAGTLSTTGHSTN+V ++E+PT + Q+HWIKRGVA
Sbjct:   88 KYPLMKQRGFYSDILSPGTLDQLGEVCRGPRMSQNLLRQADLDKFTPRVGSFEVPEDFQERMEQQCIGSTTRLLAQTDFPLQAYEPKMQVPFQVLPGQHPRKIEIERRKQQYLSLDIEQLLFSQG-IDSNKLMPRHLDHQHPQTIEQGHDPIFPIYLPLKVFDNEDFDCRTPREWINMGLEPGSLDRKPVPGKALLPTDDFLGHEDPKSQKLKYKWCEVGVLDYDEEKKLYLVHKTDEKGLVRDEMGRPILNAGVTTEGRPPLQVCQYWVPRIQLLFCAEDPCMFAQRVVQANALRKNTEALLLYNLYVDCMPSDGQHVISEQSLSK-IKQWALSTPRMRKGPSVLEHLSSLAREVSLDYERSMNKINFDHVVSSKPETFSYVTLPKKEEEQVPERGLVSVPKYHFWEQKEDFTFVSLLTRPEVITALSKVRAECNKVTAMSLFHSSLSKYSHLEEFEQIQSQTFSQVQMFLKDSWISSLKVAMRSSLRDMSKGWYNLYETNWEVYLMSKLRKLMELVKYMLQDTLRFLVQDSLASFSQFISDTCCSVLNCTDDMVWGDDLINSPYRPRKNPLFIMDLVLDSSGVHYSTPLEQFEASLLNLFDKGILATHAVPQLEKLVMEDIFISGDPLLESVGLHEPLVEELRATIASAVSKAMIPLQAYAKEYRKYLELNNNDIAS----FLKTYQTQGLLAQEVREVVLTHLREKEILDSSLPSSIIIGPFYINTDNVKQSLSKKRKALATSVLDILAKNLHKEVDSICEEFRSISRKIYEKPNSIEELAELREWMKGIPERLVGLEERIVKVMDDYQVMDEFLYNLSSDDFNDKWIASNWPSKILGQIELVQQQHVEDEEKFRKIQIMDQNNFQEKLEGLQLVVAGFSIHVEISRAHEIANEVRRVKKQLKDCQQLAMLYNNRERIFSLPITNYDKLSRMVKEFQPYLDLWTTASDWLRWSESWMNDPLSAIDAEQLEKNVVEAFKTMHKCVKQFKDMPACQEVALDIRARIEEFKPYIPLIQGLRNPGMRIRHWETLSNQININVRPKANLTFARCLEMNLQDHIESISKVAEVAGKEYAIEQALDKMEKEWSTILFNVLPYKATDTYILKSPDEASQLLDDHIVMTQNMSFSPYKKPFEQRINSWENKLKLTQEVLEEWLNCQRSWLYLEPIFSSEDINQQLPVESKRYQTMERIWKKIMKNAYENREVINVCSDLRMLDSLRDCNKILDLVQKGLSEYLETKRSAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIARLLFQEDLEITHMYSAEGEEVQLCFSIYPSSNVEDWLREVERSMKASVHDIIEKAIRAYPTMPRTQWVLNWPGQVTIAGCQTYWTMEVAEALEAGNLRSQLFPQLCQQLSDLVALVRGKLSRMQRAVLSALIVIEVHAKDVVSKLIQENVVSVNDFQWISQLRYYWTNNDLYIRAVNAEFIYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVERFMFEGVEIPLVPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMITEISLYSFGFNEASVLAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPSMNEELICLRAIRDVNVPKFLQEDLKLFSGIVSDLFPTIKEEDTDYGILDEAIREACRNSNLKDVEGFLTKCIQLYETTVVRHGLMLVGPTGSGKSTCYRVLAAAMTSLKGQPSISGGMYEAVNYYVLNPKSITMGQLYGEFDLLTHEWTDGIFSSFIRAGAITSDTNKKWYMFDGPVDAIWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLMPFIECWLRKLPPLLKPYEEHFKALFVSFLEESISFVRSSVKEVIASTNCNLTMSLLKLLDCFFKPFLP---------------------REGLK---------------KIPSEKLSRIVELIEPWFIFSLIWSVGATGDSSGRTSFSHWLRLKMENEQLTLLFPEEGLVFDYRLEDAGI----SGTNDSEDEEEEYKQVAWVKWMDSSAPFTMVPDTNYCNIIVPTMDTVQMSHLLDMLLTNKKPVLCIGPTGTGKTLTISDKLLKNLALDYISHFLTFSARTSANQTQDFIDSKLDKRRKGVFGPPLGRNFIFFIDDLNMPALETYGAQPPIELLRQWMDHGGWYDRKIIGAFKNLVDINFVCAMGPPGGGRNTVTPRLMRHFNYLSFAEMDEVSKKRIFSTILGNWLDGLLGEKSYRERVPGAPHIAHFTEPLVEATIMVYATITSQLLPTPAKSHYTFNLRDLSKVFQGMLMADPAKVEDQVQLLRLWYHENCRVFRDRLVNEEDRSWFDQLL-KRCMEQWEVTFNKVCPFQPILYGDFMSPGSDVKSYELITSESKMMQVIEEYIEDYNQINTAKLKLVLFMDAMSHICRISRTLRQALGNALLLGVGGSGRSSLTRLASHMAEYECFQIELSKNYGMSEWRDDVKKVLLKAGLQNLPITFLFSDTQIKNESFLEDINNVLNSGDIPNLYTADEQDQIVSTMRPYIQEQGLQPTKANLMAAYTGRVRSNIHMVLCMSPIGEVFRARLRQFPSLVNCCTIDWFNEWPAEALKSVATVFLNEIPELESSQEEIQGLIQVCVYIHQSVSKKCIEYLAELTRHNYVTPKSYLELLHIFSILIGQKKLELKTAKNRMKSGLDKLLRTSEDVAKMQEDLESMHPLLEEAAKDTMLTMEQIKVDTAIAEETRNSVQTEEIKANEKAKKAQAIADDAQKDLDEALPALDAALASLRNLNKNDVTEVRAMQRPPPGVKLVIEAVCIMKGIKPKKVPGEKPGTKVDDYWEPGKGLLQDPGHFLESLFKFDKDNIGDVVIKAIQPYIDNEEFQPATIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQALLEAQDDLGVTQRILDEAKQRLREVEDGIATMQAKYRECITKKEELELKCEQCEQRLGRAGKLINGLSDEKVRWQETVENLQYMLNNISGDVLVAAGFVAYLGPFTGQYRTVLYDSWVKQLRSHNVPHTSEPT--LIGTLGNPVKIRSWQIAGLPNDTLSVENGVINQFSQRWTHFIDPQSQANKWIKNMEKDNGLDVFKLSDRDFLRSMENAIRFGKPCLLENVGEELDPALEPVLLKQTYKQQGNTVLKLGDTVIPYHEDFRMYITTKLPNPHYTPEISTKLTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLIISNAKMRQELKDIEDQILYRLSSSEGNPVDDMELIKVLEASKMKAAEIQAKVRIAEQTEKDIDLTRMEYIPVAIRTQILFFCVSDLANVDPMYQYSLEWFLNIFLSGIANSERADNLKKRISNINRYLTYSLYSNVCRSLFEKHKLMFAFLLCVRIMMNEGKINQSEWRYLLSGGSISIMT-ENPAPDWLSDRAWRDILALSNLPTFSSFSSDFV-KHLSEFRVIFDSLEPHREPLPGIWDQYLDQFQKLLVLRCLRGDKVTNAMQDFVATNLEPRFIEPQTANLSVVFKDSNSTTPLIFVLSPGTDPAADLYKFAEEMKFSKKLSAISLGQGQGPRAEAMMRSSIERGKWVFFQNCHLAPSWMPALERLIEHINPDKVHRDFRLWLTSLPSNKFPVSILQNGSKMTIEPPRGVRANLLKSYSSLGEDFLNSCHKVMEFKSLLLSLCLFHGNALERRKFGPLGFNIPYEFTDGDLRICISQLKMFLDEYDDIPYKVLKYTAGEINYGGRVTDDWDRRCIMNILEDFYNPDVLSPEHSYSASGIYHQIPPTYDLHGYLSYIKSLPLNDMPEIFGLHDNANITFAQNETFALLGTIIQLQPKSSSAGSQGREEIVEDVTQNILLKVPEPINLQWVMAKYPVLYEESMNTVLVQEVIRYNRLLQVITQTLQDLLKALKGLVVMSSQLELMAASLYNNTVPELWSAKAYPSLKPLSSWVMDLLQRLDFLQAWIQDGIPAVFWISGFFFPQAFLTGTLQNFARKFVISIDTISFDFKVMFEAPSELTQRPQVGCYIHGLFLEGARWDPEAFQLAESQPKELYTEMAVIWLLPTPNRKAQDQDFYLCPIYKTLTRAGTLSTTGHSTNYVIAVEIPTHQPQRHWIKRGVA 4258          
BLAST of Dynein heavy chain axonemal vs. Ensembl Human
Match: DNAH7 (dynein axonemal heavy chain 7 [Source:HGNC Symbol;Acc:HGNC:18661])

HSP 1 Score: 3103.92 bits (8046), Expect = 0.000e+0
Identity = 1692/3774 (44.83%), Postives = 2372/3774 (62.85%), Query Frame = 2
Query: 1610 TKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPL-LESVGMEEPQVKKLRENLRET-LKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWI--LTIPDMLDEQQEVIDK--CLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEK---IVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKGL--YVKLL-EQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAI-YPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKM---------------------STQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYI-IKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPE-YISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWI---MRAVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKN----LLVGKLNSDFNQKYE----------DVVKIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTN--------LFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKI-QGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEP-YIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPE---WISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKF-SKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSY--TSFSD-DFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQ-VMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            + +KL+ F       M   ++ LTL S+ +F ++I                P D    S+   ++P F++ L+LDN    +   L  +  + +N++D  I+A+  VP++E  +         P  L+ + + E  V   +E ++E  +K+++ P E   L Y+K+  L    IT      + N+ A++H+  +I  E+ K+    E ++    + I +G F ++ E + + L K+   +   +L  + R+ ++   + C+ F+ I  K    P    EL E++ +I  + + DM++ +Q ++D   CL    LIE  Y N S  D     ++  W  ++     +  + + E  E++++        F E+L++         S+ D+        + + ++ +L  A      FN  E  F    + Y +  K+     P+  L+    ++   + +    P   V+ + VE  +  +++ ++K  K F++ P    +  +++  +E+FK  IPLIQ + NPG+R RHWE +S  +G  + P    T S  L+M L+ +I+    I+E A KEY++E+A+ KM  EW+A++F + SY+ TGT+IL   DEI  LLDDHI+ TQ+M  SP+ KP+E+++ +WE  L   Q+++DEWL+ Q  WLYLEPIFSS DI  Q+P EG+R+  +D+ WR IM++   +  V+T+    R+L  LK+ N+LLE + KGL+EYLE KR  FPRF+FLS+DELLEILS+TKDPT VQPHL+KCFE IAK++F + L+IT M S EGE    I    +    G VE+W++E+E +M  S+  + G     Y +  R  WV  WPGQ V+   Q +WT+EV  A+    +K L  Y+K    Q+D +  +VRG ++   R+TL AL+V++VHARDV+++++ +NI + +DFEW+SQLRYYW E +L+ + +NA   YGYEYLGN+ RLVITPLTDRCY TL GALHL  GGAP GPAGTGKTETTKDL KA A QCVVFNCSD LD++A+GKFFKGL S GAWACFDEFNRID+EVLSVVAQQI TIQ+      D  MFEG EL L P+CAVFITMNPGYAGR+ELPDNLKALFR VAMMVPDYA+IAEI L+S GF  AR LS KIV T++L SEQLSSQ HYD+GMRAVKSV++AAGNLK +    +EE++ LR+I DVN+PKFL  DL LF GI SDLFP +K    DY DLL +I+       L+    F +K +Q++E  +VRHG M+VG    GKT  Y VL  AL+ + ++   + +  Q     VLNPKS+TMGQLYG+FD ++HEW+DG+L+   R   ++  PD++W IFDGPVDAVWIENMNTVLDDNKKLCL SGEII++  +M ++FE  DL VASPATVSRCGM+Y+EP +LG  P +  W+  LP ++    +E +  LFD  +  +V+F+R + +E+ PT++  L  +++ L+D F+      D + E K  K++ +R+                                     +E  FLFSLIWS GASC  D R KF+  LR  M                     S++ + +PFPE+G +YDY+F   G                     KW  W+  + E   I  D+ +++IIVPT+D +R  ++ E L   +KP + VGPTGTGK++ I++ L   +  E Y    I FSA+TTA QTQ+++ SKLDKRRKGVFGPP+GK ++ F+DD+NMPA EV+G+QPPIEL+RQW D   WYD K     + LVDI  + +MGPPGGGRNP+T R MRHFN++  NE  + SM T+F  IL + +    +   E   L   +V   + +Y      +LPTPAKSHY FNLRD S+V QG+ +  PE+  + + + RLW HE  RV+ DRL+++ DR W  N    +L   +  DF++ ++          +   +  L++ DF     E+  Y E  + D +  ++E +LE++N I+   MNLVLF  A+ H+ RI+RI++QP  +ALL+G+GGSGRQS+T+LAAHMA+Y  FQ+E+SK Y   EW +DLK I+          VFLF+DTQIK+ESFLED++N+LN+G++PNL++ D+ + I   M+     L  Q  KT         LF+ +    R  LH V+ MSPIG+ FR RLR+FPALVNCCTIDWF  WP++AL++VA +FL    E+E+SEE+  G + MCK  H S  + S+ +  EL RYNYVTPTSYLEL+  F  +  +K+ E+ + + R + GL+KL      V  +Q ELE + PQL+ A +E       IE++S    +T+ +V  +E +A ++A   + I+D+   DL  ALP L+ +L +L  L   DIT V++M  PP GV+LV+E +CI+K +K  KI      G KI+D+W   K LL D  +FL SL  YDKDNI  + +  I   YI +  F P  I   S A   +C+WV AM  Y  VAK VAPK+  L  +  EL+     L++ +A LK V+D++  LQ+ LE   +++ +LEN+ DLC  +L RA++LIGGL  EK RW  + + L  L  N+ G++LIS+G VAYLG FT  YR +   EW+   K   +P +D    +L+ T G+ V IR W I GLP D+ SI+N +I+  +RRWPL IDPQ QAN+WIKN++K N L VIKLS+ D++R+LEN I+FG P L+ENVGEELDP LEP+LLKQTFKQ G+  I+LGD+ I Y  DFRFYITTKL NPHY PE S KVT++NF ++P G++DQLLG+VVA+ERPDLE+ K  LI+  A+ +++LKEIEDKIL  LS +EG+ ++D   I+ L +SK  +NEI  K  +AE+TE+ ID TR  Y P+A+ + ILFF +ADLA I+PMYQYSL WF+N+F   I N+ K++ L +R+  + ++FT+SLY NVCRSLFEK KLLFSF L   +L HE  I+ AEWRFLL GG      L NP      W+  + W+EI  L  LPAF     EF+ +  + +K+++DSLEPH E  P EW D  + FQ +L++RCLR DKV   +Q+F+ + LG  FIEP   DL   + DS+   PLIFVLSPG DP + L KFADD  +   KLS++SLGQGQGP A ++++ A++ G WV  QNCHLA SWMP+LE++ E++  +  H DFR+WLTS PSP FPV +LQNG KMT E P+G++AN+++SY     SD +F  S  K  E++ LL  LC FH ++ ER+KFGPLG+NIPYEF + DLRI + QL MFL +Y ++P++ L+Y  G  NYGGRVTDDWDRR + ++L+ F+NP+ V   DY +  SGIY  + P  DH  Y+ Y ++LP+   PEIFG++ NA+IT   +ET  L D++L  Q + + AG KS +E+V EV+ +IL  +P  F+IE   +RYP  Y QSMNTVL+QE+ R+N+LL  I+ S  ++ KAI+GL VMS  LE + +S+ + K+P+ W  K+YPSLKPL S+V D   R+ F+Q W + G PPVFW+SGFFF QAFLTG  QN+ARK  I ID + F ++VM     E    P DG +I GLFL+GA W+    +L ES PK L+  +PV+WL PC    IP    Y  P+YKT  R G LSTTGHSTNFV ++ +P+D+ ++HWI RGVA
Sbjct:  353 SSAKLESFFNCAAALMTLQLQDLTLVSMQDFTDLIAQ--------------PPD----SVRAFEHPGFIMRLILDNDTIKFEPELSDYIDIFLNVYDVMIKAVSFVPRVETKLYSKWESKSKPTTLKPIILNE-IVDAHKEKIKEVIMKESVAPTEHLRL-YDKYDFL----ITRKAERDVDNFLAENHSYEKIIDEICKYQKLIEEIQYTSIKTIRLGMFEMHCEELIRALVKRADIICGKLLAKMFRDHQEVNTRLCDEFERIAEKALSTPPNTAELMEMKAYIQKVEVTDMIELEQRLVDSKNCLA--FLIE--YVNFSPADMRLNNSVFQWYGRMGEIFEEHRKIIKEKIEQYQEGLKLRCERFVEELESYAKQSEEFYSFGDLQDVQRYLKKAQILNGKLDLAADKIEQFNAEEEAFGWLPSVYPQRKKIQDGLNPYLRLYETAVEFSSNYRAWTEGPYHKVNPDQVEADIGNYWRGLYKLEKTFHDSPYALAMTKKVRSKVEDFKQHIPLIQVICNPGLRPRHWEAMSAIVGYPLQPSDDSTVSSFLDMNLEPYIDRFEGISEAASKEYSLEKAMEKMITEWDAVEFVIHSYRETGTFILASVDEIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFTAVDKTWRDIMRSVMQDKHVLTVVTIDRMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELIEIISTAKARGQVEKWLVELERVMINSIHKVTGDATFAYTKYERINWVRDWPGQTVLCVSQIFWTKEVQTAIPM-GIKALEQYLKTCNRQIDDIVTLVRGKLSMQNRVTLGALVVLDVHARDVLSSLVKKNISDDSDFEWLSQLRYYWQENHLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGADILMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNDLLAAIKDNCASMNLQMTAFFSEKILQVYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQIT---VLNPKSVTMGQLYGQFDSVSHEWSDGVLAVSFRAFASSVTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMLSWVNLLPASVSVIQKEFIMGLFDRMVPVSVEFIRKHTKELSPTSDTNLVRSLMNLIDCFM-----DDFADEVKL-KERNDRETYS---------------------------------LLEGIFLFSLIWSVGASCTDDDRLKFNKILRELMESPISDRTRNTFKLQSGTEQTSSKALTVPFPEKGTIYDYQFVTEGI-------------------GKWEPWIKKLKEAPPIPKDVMFNEIIVPTLDTIRYSALMELLTTHQKPSIFVGPTGTGKSVYITNFLLNQLNKEIYKPLLINFSAQTTAAQTQNIVMSKLDKRRKGVFGPPLGKRMVVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSMIK-LVDIQIMCAMGPPGGGRNPVTPRYMRHFNIITINEFSDKSMYTIFSRILTWHLEICYKFPDEFLDLTTQIVNGTMTLYKEAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETTETTEVIKRLWVHEVLRVYYDRLLDNTDRSWLINYIQEILRNYMYEDFHELFQRLDFDNDGMVEADDLRSLMFCDFHDPKREDTNYREIADVDNLRMIVEIHLEEYNNISKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSVFQVEISKGYDTTEWHEDLKVILRKCAEGEMQGVFLFTDTQIKEESFLEDVSNLLNAGEIPNLFALDEKQEICDKMR----QLDRQRDKTKQTDGSPIALFNMFIDHCRSQLHVVLAMSPIGDAFRNRLRKFPALVNCCTIDWFQSWPEDALQAVASRFLE---EIEMSEEIRDGCIDMCKSFHTSTIDLSKSFFVELQRYNYVTPTSYLELISTFKLLLEKKRSEVMKMKKRYEVGLEKLDSASSQVATMQMELEALHPQLKVASKEVDEMMIMIEKESVEVAKTEKIVKADETIANEQAMASKAIKDECDADLAGALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGD-MRFLQSLHEYDKDNIPPAYMNIIRKNYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGELKIAMDGLRKKQAALKEVQDKLARLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSHTALELGQLYINLTGDILISSGVVAYLGAFTSTYRQNQTKEWTTLCKGRDIPCSDD--CSLMGTLGEAVTIRTWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQSQANKWIKNMEKANSLYVIKLSEPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVAQERPDLEEEKQALILQGAENKRQLKEIEDKILEVLSSSEGNILEDETAIKILSSSKALANEISQKQEVAEETEKKIDTTRMGYRPIAIHSSILFFSLADLANIEPMYQYSLTWFINLFILSIENSEKSEILAKRLQILKDHFTYSLYVNVCRSLFEKDKLLFSFCLTINLLLHERAINKAEWRFLLTGGI----GLDNPYANLCTWLPQKSWDEICRLDDLPAFKTIRREFM-RLKDGWKKVYDSLEPHHEVFPEEWEDKANEFQRMLIIRCLRPDKVIPMLQEFIINRLGRAFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMAALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKEGTWVVLQNCHLATSWMPTLEKVCEELSPESTHPDFRMWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLNQYEELPYEALRYMTGECNYGGRVTDDWDRRTLRSILNKFFNPELVENSDYKFDSSGIYF-VPPSGDHKSYIEYTKTLPLTPAPEIFGMNANADITKDQSETQLLFDNILLTQSRSAGAGAKSSDEVVNEVASDILGKLPNNFDIEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLKTIRDSCVNIQKAIKGLAVMSTDLEEVVSSILNVKIPEMWMGKSYPSLKPLGSYVNDFLARLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNYARKYTIPIDLLGFDYEVMEDK--EYKHPPEDGVFIHGLFLDGASWNRKIKKLAESHPKILYDTVPVMWLKPCKRADIPKRPSYVAPLYKTSERRGVLSTTGHSTNFVIAMTLPSDQPKEHWIGRGVA 4017          
BLAST of Dynein heavy chain axonemal vs. Ensembl Human
Match: DNAH12 (dynein axonemal heavy chain 12 [Source:HGNC Symbol;Acc:HGNC:2943])

HSP 1 Score: 3022.26 bits (7834), Expect = 0.000e+0
Identity = 1664/3778 (44.04%), Postives = 2344/3778 (62.04%), Query Frame = 2
Query: 1718 DACYACVKLDQGYEWPNDLLTSSLP-------PKKN---PIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQ------VKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLN-EKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWI-----LTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKL----DNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFN-----ELPSVQEVA-----------------------GQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEK---IVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALE--TRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSL--PDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFL-----------------PFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEY-IIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPP-EYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELHP----LEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVK-------------IEPLLYGDFMSVAIE--NKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQ--DLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQG-DKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEP-YIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFS-KKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSY----TSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVM-TEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQ--PKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            DA Y+CV      +   DLL  ++        PK     PIF ++L  D+    +           ++L ++  +ALQNV    Q I   +S    P+  ++  E P+      V  L+  +   L+ A    E+Y  +YN  L     D T   N  +  ++ + HT  E    +EK L+   EI+  L+PQ+I      ++ E+++ GL  K KA AN +L+ +A + RK  +  C  F+ I     + P T EE+ +L  ++     + I +++   QE   K    Y  ++ F +   +   NA  T++ WP KI   I      L+E+ +  ++    ++ A  EKL    +  +  +     + ++ +  +   +VR++ K++ E++      N  E LF   +T Y +L KL  + EP++  +  V  W +     M+   + ++ E +E  V EF + + K++K F      EL   ++ A                         +   I+ FK +IP +  L NPGMRARHW+ +S+ +G  + P S  T  K L++ L  ++E    I+  A KE+++E+A+N M G WE + F +  Y++TG  IL   DEI  +LDD I+ TQ+M  SP+ KPFE  I  WE  L   Q+ IDEWL+ Q QWLYLEPIF SEDI +Q+P EG+++ T+DR WR IMK    +P V+       LL  L+ CN+LLE++ KGL+ YLE KR  FPRF+FLS+DE+LEILS+TKDP  VQPHL+KCFE IAKL+F  +L+I AM+S EGE+   I    ++   G VE+W++++E++M  S+  +I    + Y +  R +WV +WPGQVV+   Q +WT E  + +   T  LK  Y +L  QL+ +  +VRG ++K  R TL AL+ I+VHARDVV +MI   + +  DF W++QLRYYW  EN ++R +N    Y YEYLGN+ RLVITPLTDRCY TL GA +L  GGAP GPAGTGKTETTKDL KA A+QCVVFNCSD LD++AMGKFFKGLAS+GAWACFDEFNRI++EVLSVVAQQI  IQ+A QQ+L  F+FEG EL L P+C V ITMNPGYAGR+ELPDNLK LFR VAMMVP+YALIAEISL+S+GF +AR LS KIV T++L SEQLSSQ HYD+GMRAVK+V+ AAGNLK +    +E+++ LR+I+DVN PKFL  D+ LFNGI SDLFP IK    DY + L     A     L+ V  F++K IQ +E  +VRHG MLVG   + KTK   VL   L+ + +     G   + ++  V NPKSITMGQL+G+FD ++HEWTDGI++   R+   +  PD++W +FDGP+D +WIE+MNTVLDDNKKLCL SGEII++  +M+++FE  DL+ ASPATVSRCGM+YLEPS LG  P V  W+ SL  P     ++  ++ LF   +  +++  +   +E++PT+N  +  ++ +L +  +   V +D      TSK                                       I   + + F+FSLIWS G SCDTD R+ FDT++R      LI L                 PF E+GLVYDY ++                    + K +WVHW   +    +    +K  DIIVPT+D +R   + +  +   KP++ VGPTGTGK++ + DKL  ++   +Y   +I  SA+T+ANQ Q++I ++LDKRRKGVFGPPMGK  I FIDD+NMPALE +G+QPPIEL+RQ+ D   WYD K   +  +LVDI  I +MGPPGGGRNP+T R +RHFN+   N   +++M  +F +I+ F++     E  P    +   +V   +++Y      +LPTP KSHYTFNLRD S+V +G L++E +++ +   ++RL+ HE  RVF DRL+ND DR W   L    +   F + +  +               +  L++GD+M+  +E  ++ Y+E         V+++ L+++NQ +  +MNLV+F   + H+ RI R+++Q  GNALL+G+GGSGRQSLT+LA  MA+   FQ E+SK+YG+ EWR+D+K ++   G++ +  VFL +DTQIK+E+FLED++++LN+G+VPN+++ D+ + +   ++P+ Q  +   + +   LF+ +  R + NLH V+  SPIG+ FR RLRQFP+L+NCCTIDWF  WP++ALE VA+KFL  +   EV ++ I   + +CK  H S+ + SE++  EL R+NYVT TSYLEL+G F ++  +K+Q + +A+ R  NGLDKL + E  V ++Q EL  ++P+LE+A  E+    + IE +S   +  +  V  +E +A+ KA+E + ++++ + DL EA+PAL+ +L +L  L   DIT V++M  PP GV+LV+  VC+MKD+KP+KI      G KI DYW   K LL D   FL  L  YDKDNI  +V+QKI   Y+ +  F P  + K S A   +C+W+ AM  Y  VAK VAPK+  L  + K L +T ++L + RA+L  VE  +  LQ         +  LE++ +LC  +L RA +LIGGL  EK RW  +  +L+    N+ G+VL+SAG +AYLG FT  +R +   +WS   K   +P +++    L  T GDPVKIR W I GLP DT SI+N VIV   RRWPL IDPQGQAN+WIKN +KEN L VIKLSD D++R+LEN I+FG P L+ENVGEELDP+LEP+LL+QTFKQ G   I+LG+ II Y  DF+FYITTKL NPHY PE++TKV+++NF ++P GLEDQLLG+VVA+ERP+LE+ +N LI+ +A  +++LK+IE KIL  LS +EG+ ++D   I+ L+++K+ SNEI  K  IAE+TE  I E+R  Y P+A  + +LFF +ADLA IDPMYQYSL WF+N++ N I ++ K+  L +R+  +N++FT++LY N+CRSLFEK KLLFSFLL   +L    +I+  E  FLL GG        NP P W+ D+ W EI   +  PAF    + F  +++ +++ I+DS EPH  K P       +  Q +++LRCLR DK+T A+ ++V   LG++F+EP   DLT  Y DS+ T PLIFVLSPG DP + L KFA+D   S  K  AISLGQGQGP A ++IK A+E G WV  QNCHLA SWMP LE++ E    +  +  FRLWLTS PS KFPV ILQNG KMT EPP G++ NLL+SY     S  + F     K   W  LL  +C FH ++ ERKKFGPLG+NIPY F + DLRI I QL +F+ EY  +PF+ + Y  G  NYGGRVTDDWDRR ++ +L+ FYN  ++    Y +S SG Y    P   +  Y+ +I+ LP    PEIFGLH+N +I+  + +T  L + LL  Q   K + A G S ++I+ E++K+IL  +P  F+IE   ++YPV YE+SMNTVL+QE+ R+N L+  I+++LRDL KAI+G+VVM  ALE++S SL   KVP+ WA ++YPSLKPL S++ D   R+ F+Q W ++G P VFW+SGFFF QAFLTG +QN+ARK    ID + + F+V+     + +  P DG YI GL+L+GARWD     L E  PK LF  MP+IW+ P     I  S+ Y CP+YKT  R GTLSTTGHSTNFV ++ + TD+  +HWIKRGVA
Sbjct:  286 DAFYSCVSTLMSNQL-KDLLRRTVEGFVKLFDPKDQQRLPIFKIELTFDDDKMEFYPTFQDLEDNVLSLVERIAEALQNV----QTIPSWLSGTSTPV--NLDTELPEHVLHWAVDTLKAAVHRNLEGARKHYETYVEKYNWLL-----DGTAVEN--IETFQTEDHTFDEYTEFIEKFLSLASEIM--LLPQWIHYTMVRLDCEDLKTGLTNKAKAFANILLNDIASKYRKENECICSEFEAIKEHALKVPETTEEMMDLISYVEKARTVGIEELILRIQE--SKRQMSY-FLDVFLFPQEDLALNA--TVLMWPRKIN-PIFDENDELIENAKHKKE---NELMAKREKLILEIEKESRRMEEFTEFAELERMQQYVTDVRQLQKRIQESEEAVQFINKEEELFKWELTKYPELDKLKVNIEPYQKFFNFVLKWQRSEKRWMDGGFLDLNGESMEADVEEFSREIFKTLKFFQTKLKKELQEKRKAARKRSLEEEKIEEEPKDNATITMCSTVMEQIKAFKEYIPTVSILCNPGMRARHWKQISEIVGYDLTPDSGTTLRKVLKLNLTPYLEQFEVISAGASKEFSLEKAMNTMIGTWEDIAFHISLYRDTGVCILSSVDEIQAILDDQIIKTQTMRGSPFIKPFEHEIKAWEDRLIRIQETIDEWLKVQAQWLYLEPIFCSEDIMQQMPEEGRQFQTVDRHWRDIMKFCAKDPKVLAATSLTGLLEKLQNCNELLEKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFLPNLDIKAMYSSEGERVELIALISTSAARGAVEKWLIQVEDLMLRSVHDVIAAARLAYPESARRDWVREWPGQVVLCISQMFWTSETQEVISGGTEGLKKYYKELQNQLNEIVELVRGKLSKQTRTTLGALVTIDVHARDVVMDMIKMGVSHDTDFLWLAQLRYYWENENARVRIINCNVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQQKLVVFVFEGTELKLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNARPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKYPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGIKLPEADYHEFLECAHEACNVHNLQPVKFFLEKIIQTYEMMIVRHGFMLVGEPFAAKTKVLHVLADTLTLMNEHGY--GEEEKVIYRTV-NPKSITMGQLFGQFDPVSHEWTDGIVANTFREFALSETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSPQMSLIFETMDLSQASPATVSRCGMIYLEPSQLGWEPLVSSWLNSLKGPLCEPEYQALLRGLFAWLIPPSLNQRKKKCKELIPTSNSNVVVSLTRLFEVLLCNVVEND-----PTSKH--------------------------------------IRVWIMACFIFSLIWSIGGSCDTDGRRVFDTFIR------LIILGKDDENPVPDSVGKWECPFDEKGLVYDYMYE-------------------LKNKGRWVHWNELIKNTNLGDKQIKIQDIIVPTMDTIRYTFLMDLSITYAKPLLFVGPTGTGKSVYVKDKLMNHLEKDQYFPFYINLSARTSANQVQNIIMARLDKRRKGVFGPPMGKKCIIFIDDMNMPALEKYGAQPPIELLRQFFDCGHWYDLKDTSKI-TLVDIELIAAMGPPGGGRNPVTPRCIRHFNICSINSFSDETMVRIFSSIVAFYL--RTHEFPPEYFVIGNQIVNGTMEIYKQSVENLLPTPTKSHYTFNLRDFSRVIRGCLLIERDAVANKHTMIRLFVHEVLRVFYDRLINDDDRRWLFQLTKTVIKDHFKESFHSIFSHLRKQNAPVTEEDLRNLMFGDYMNPDLEGDDRVYIEIPNIHHFSDVVDQCLDEYNQTHKTRMNLVIFRYVLEHLSRICRVLKQSGGNALLVGLGGSGRQSLTRLATSMAKMHIFQPEISKSYGMNEWREDMKGLLRNVGMKGQKTVFLITDTQIKEEAFLEDIDSVLNTGEVPNIFAADEKQEVMEGVRPVAQAGNKHDELSPLALFAFFVNRCKDNLHVVVAFSPIGDAFRNRLRQFPSLINCCTIDWFQSWPEDALERVAVKFLETLELTEVEQQEI---VPICKHFHTSIMDLSERFLHELGRHNYVTATSYLELIGSFRQLLTQKRQAVMEAKQRYMNGLDKLAFAESQVGEMQMELVELQPKLEEAKIENANMMQVIEIESVQVEAKRQFVKLDEEIASGKAEEAQALKNECESDLAEAIPALEAALSALDTLKPADITIVKSMKNPPSGVKLVMAAVCVMKDIKPEKISDPSGTGGKILDYWGPSKKLLGD-MNFLRDLKEYDKDNIPVTVMQKIRSEYLMNPEFDPPKVAKASSAAEGLCKWIMAMEVYDRVAKVVAPKKARLSEAQKSLAETMELLNQKRAELAEVEHHLENLQMTFLEKTEEKAALEDQVELCAKKLERASQLIGGLGGEKSRWAQAADDLQITYENLTGDVLVSAGVIAYLGAFTSGFRQTCTKDWSMLCKKKKIPCSEEFL--LSKTLGDPVKIRAWNIAGLPTDTFSIDNGVIVNNCRRWPLMIDPQGQANKWIKNSEKENQLSVIKLSDSDYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLRQTFKQGGIDCIRLGEVIIEYSFDFKFYITTKLRNPHYMPELATKVSLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKDIEKKILETLSSSEGNILEDESAIKVLDSAKMMSNEITKKQQIAEKTELKIAESREGYRPIAKHSSVLFFSIADLANIDPMYQYSLTWFVNLYINSIHDSNKSKILEKRLRYLNDHFTYNLYCNICRSLFEKDKLLFSFLLCANLLLARKEIEYQELMFLLTGGVSLKSAEKNPDPTWLQDKSWEEICRASEFPAFRGLRQHFC-EHIYEWREIYDSKEPHNAKFPAPMDKNLNELQKIIILRCLRPDKITPAITNYVTDKLGKKFVEPPPFDLTKSYLDSNCTIPLIFVLSPGADPMASLLKFANDKSMSGNKFQAISLGQGQGPIAAKMIKAAIEEGTWVCLQNCHLAVSWMPMLEKICEDFTSETCNSSFRLWLTSYPSSKFPVTILQNGVKMTNEPPTGLRLNLLQSYLTDPVSDPEFFKGCRGKELAWEKLLFGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFINEYDTIPFEAISYLTGECNYGGRVTDDWDRRLLLTMLADFYNLYIVENPHYKFSPSGNYFA-PPKGTYEDYIEFIKKLPFTQHPEIFGLHENVDISKDLQQTKTLFESLLLTQGGSKQTGASG-STDQILLEITKDILNKLPSDFDIEMALRKYPVRYEESMNTVLVQEMERFNNLIITIRNTLRDLEKAIKGVVVMDSALEALSGSLLVGKVPEIWAKRSYPSLKPLGSYITDFLARLNFLQDWYNSGKPCVFWLSGFFFTQAFLTGAMQNYARKYTTPIDLLGYEFEVIPSDTSDTS--PEDGVYIHGLYLDGARWDRESGLLAEQYPKLLFDLMPIIWIKPTQKSRIIKSDAYVCPLYKTSERKGTLSTTGHSTNFVIAMLLKTDQPTRHWIKRGVA 3953          
BLAST of Dynein heavy chain axonemal vs. Ensembl Human
Match: DNAH3 (dynein axonemal heavy chain 3 [Source:HGNC Symbol;Acc:HGNC:2949])

HSP 1 Score: 2921.34 bits (7572), Expect = 0.000e+0
Identity = 1608/3629 (44.31%), Postives = 2249/3629 (61.97%), Query Frame = 2
Query: 1973 NPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIH---KQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKSTYPT---GNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYP-HRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLR-----------RKMSTQLIFLP-FPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVP--EYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPE-YISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELH-PLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVV------------KIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLG--LQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKP-KKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKI-EPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKF-SKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQ-IDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTS--FSDD-FLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEI---PSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            N LL +V  EE  V        +  +K  +    Y   Y K+++L +    + +  FL+          +I   ++K  NE   +   +P    +  F ++   +   L ++ + + + ++       R +    C  +  I  K+ E P   +EL  L E++                 +T ++L  +        +F   +  +  P++I          LL   ++     +   + F  +L+     + S     ++    E+ + V +++   K L  A A   L N  E L  +  + Y  L  ++K+  P+  LW    ++    +  MN PL  +++E + + +   ++T +K +K  +++P+ + +A  +K+ I++FK +IP++    NPGM+ RHW+ +S+ +G  I P  T   S  LE      +E +  I   A KEY++E+ L++M  +W  + F  + Y++T T IL   D+I  LLDDH++ TQ+M  SP+ KP E    KWE  L   QD +D WL+CQ  WLYLEPIFSSEDI  Q+P EG+++  +D  W+ +M  A  +  ++      R+   L+E N LLE +QKGL++YLE KR  FPRF+FLS+DELLEILS+TKDP  VQPHL+KCFE IAKL+F  +LEI  M S E E + F +  YP    G VE+W+ ++E MM  S+R +IG G+  Y ++PR  WVL+WPGQVVI     +WTQEVS AL    L     K  +Q+  +  +VRG ++   R+TL AL VI+VHARDVV  +  + + ++NDF+WISQLRYYW+ ++++++ +  E  YGYEYLGN+ RLVITPLTDRCY TL GAL L  GGAP GPAGTGKTETTKDL KA A QCVVFNCSD LD+ AMGKFFKGLA AGAWACFDEFNRI++EVLSVVAQQI +IQ+A  ++L  F+FEG EL L P+CAVFITMNPGYAGR ELPDNLKALFR VAMMVPDYALI EISL+S GF D+R+L++KIV T++L SEQLSSQ HYD+GMRAVKSV++AAGNLK +    +E ++ LRA+ DVN+ KFL  D+ LF GI+SDLFP +     DY   L  +    +K  L+ V  F+ K IQ++E  +VRHG M+VG    GKT  Y+VL +AL  L    + +      V   ++NPK+ITMGQLYG FD ++HEW DG+L+   R+  ++   D++W IFDGPVDA+WIENMNTVLDDNKKLCL SGEII++  +M+++FE ADL  ASPATVSRCGM+Y+EP  LG  P  + ++ +LP ++   H+E V  +F   ++  ++F R + + +V T+   L F+M++L  S +                             ++A            + Q       +I   ++  FLFSL+W+   + + DSRKKFD + R           R  S +L     FPE G +YD+ F    +                     W  W   +   E  +    K S++I+PT++  R     +  L  + P++ VGPTGTGK+ +I++    ++P   Y+   I FSA+T+ANQTQD+I SKLD+RRKG+FGPP+GK  + F+DDLNMPA EV+G+QPPIEL+RQW D   W+D+K       +VD+  + +MGPPGGGRN IT R  RH N++  N  ++D +  +F +I+ +   +    +     + LV+A   +Y       LPTP+KSHY FNLRD S+V QG+L+     L  V++ +RLW HE  RVF DRL++ +DR+ F N++    ++ F Q  E V+             I  L +GD+     + K Y E  +  ++  V+E  LE+FN I+ A M+LV+F  A+ H+ RI R+++Q  G+ LL+G+GGSGRQS  KL+  M  Y+ +QIE++KNY   +WR+DLK+I+L  G+  K  VFLF+D QIKDESF+ED+N +LN+GDVPN++  D+   I   M+   +  G  ++ T  ++++ + +RV   +   + MSPIG+ FR RLR FP+L+NCCTIDWF  WP +ALE VA KFL D+   E+ + +   ++ MCK   +SV   S  Y  +L R+NYVTPTSYLEL+  F  +   K+QE+   R+R   GL KL +    V  +Q EL  ++PQL    EE+     +IE ++  A   +++V  +E  A   A   + I+++ + DL EA+PAL+ +L +L  LN  DI+ V++M  PP  V+LV+E++CIMK +KP +K      G  I+DYW   K +L D  KFL+SL  YDKDNI    +++I E +I    F PA I+ VS AC  +C+WVRAM  Y  VAK VAPKRE L  +  +L    + L + RA+LK V DR+  L +  E    ++K+LE   ++C  +L RA+KLI GL  EK RW ++   L     N+ G+VL+S+G VAYLG FT +YR    ++W A  K   +P       +L  T GDP+KIR WQI GLP D+ SI+N +IV  SRRW L IDP GQAN+WIKN++K N L VIK SD +++R LENA++ G P L+EN+GEELD ++EPILLK TFKQQG   ++LG+ II Y  DF+ YITT+L NPHY PEV+ KV ++NF ++P GL+DQLLG+V A+E+P+LE+ KNQLIV +AK ++ LKEIEDKIL  LS+++G+ ++D   I+ L +SK+ S EI  K  +A  TE  IDETR  Y PVAV +  +FFC++DLA I+PMYQYSL WF+N++ + +T++ K++ L  RI  I ++FT S+Y+NVCRSLFEK KLLFS LL   I++ + +I    W FLL GG       PNPAP+W+S++ W EI+  ++LP      E  + + L ++K I+DS  PH E+LPG W       + +++LRCLR DK+  A+++F+A  +G+ +IE  T DL   Y DSS   PLIFVLSP  DP + L KFADD+     +   ISLGQGQGP A ++I NA++ G WV  QNCHLA SWMP+LE++ E+ I  +  +  FRLWLTS PS KFPV ILQNG KMT EPP+G++ANLL+SY +   SD  F  S AK   W+ +L  LC FH V+ ER+ FGPLG+NIPYEF + DLRI + Q+ MFL +Y +VPF  L Y  G  NYGGRVTDD DRR ++++LS FY  ++  EDY     G    I P   +  Y+ Y+R+LPI   PE+FGLH+NA+IT    ETN L + +L   P+ S   GKS +E+VEE++++IL  +P  F++E++ K YPV+YE+SMNTVL QE+IR+NRL  +++ SL +L +AI+G V+MS  LE + NS+   KVP  WA+K+YPSLKPL  +V DL  R+ F Q WID G P VFWISGF+F Q+FLTG  QN+ARK  I ID I F F+V     P+ T +   P DG YI+GLFLEGARWD   MQ+ ES PK L+  +P+IWL P  +      +IY CPVYKT  R GTLSTTGHSTN+V SIE+PTD  QKHWI RGVA
Sbjct:  572 NLLLGTVNAEEKLVSDFLIQTFKVFQKNQVGPCKYLNVYKKYVDLLDNTAEQNIAAFLKENHDIDDFVTKIN-AIKKRRNEIASMNITVP----LAMFCLDATALNHDLCERAQNLKDHLIQFQVDVNRDTNTSICNQYSHIADKVSEVPANTKELVSLIEFLKK------------SSAVTVFKLRRQLRDASERLEFLMDYADL--PYQIEDIFDNSRNLLLHKRDQAEMDLIKRCSEFELRLEGYHRELESF-RKREVMTTEEMKHNVEKLNELSKNLNRAFAEFELINKEEELLEKEKSTYPLLQAMLKNKVPYEQLWSTAYEFSIKSEEWMNGPLFLLNAEQIAEEIGNMWRTTYKLIKTLSDVPAPRRLAENVKIKIDKFKQYIPILSISCNPGMKDRHWQQISEIVGYEIKPTETTCLSNMLEFGFGKFVEKLEPIGAAASKEYSLEKNLDRMKLDWVNVTFSFVKYRDTDTNILCAIDDIQMLLDDHVIKTQTMCGSPFIKPIEAECRKWEEKLIRIQDNLDAWLKCQATWLYLEPIFSSEDIIAQMPEEGRKFGIVDSYWKSLMSQAVKDNRILVAADQPRMAEKLQEANFLLEDIQKGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLEFTDNLEIVGMISSEKETVPFIQKIYPANAKGMVEKWLQQVEQMMLASMREVIGLGIEAYVKVPRNHWVLQWPGQVVICVSSIFWTQEVSQALAENTLLDFLKKSNDQIAQIVQLVRGKLSSGARLTLGALTVIDVHARDVVAKLSEDRVSDLNDFQWISQLRYYWVAKDVQVQIITTEALYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRKLKTFIFEGTELSLNPTCAVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPEENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYEVFLKVLNDNIKKMKLQPVPWFIGKIIQIYEMMLVRHGYMIVGDPMGGKTSAYKVLAAALGDLH---AANQMEEFAVEYKIINPKAITMGQLYGCFDQVSHEWMDGVLANAFREQASSLSDDRKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMNSKMSLIFEPADLEQASPATVSRCGMIYMEPHQLGWKPLKDSYMDTLPSSLTKEHKELVNDMFMWLVQPCLEFGRLHCKFVVQTSPIHLAFSMMRLYSSLL---------------------------DEIRAVEEEEMELGEGLSSQ-------QIFLWLQGLFLFSLVWTVAGTINADSRKKFDVFFRNLIMGMDDNHPRPKSVKLTKNNIFPERGSIYDFYFIKQAS-------------------GHWETWTQYITKEEEKVPAGAKVSELIIPTMETARQSFFLKTYLDHEIPMLFVGPTGTGKS-AITNNFLLHLPKNTYLPNCINFSARTSANQTQDIIMSKLDRRRKGLFGPPIGKKAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGYWFDKKDTTRL-DIVDMLLVTAMGPPGGGRNDITGRFTRHLNIISINAFEDDILTKIFSSIVDWHFGKGFDVMFLRYGKMLVQATKTIYRDAVENFLPTPSKSHYVFNLRDFSRVIQGVLLCPHTHLQDVEKCIRLWIHEVYRVFYDRLIDKEDRQVFFNMVKETTSNCFKQTIEKVLIHLSPTGKIVDDNIRSLFFGDYFKPESDQKIYDEITDLKQLTVVMEHYLEEFNNISKAPMSLVMFRFAIEHISRICRVLKQDKGHLLLVGIGGSGRQSAAKLSTFMNAYELYQIEITKNYAGNDWREDLKKIILQVGVATKSTVFLFADNQIKDESFVEDINMLLNTGDVPNIFPADEKADIVEKMQTAARTQGEKVEVTPLSMYNFFIERVINKISFSLAMSPIGDAFRNRLRMFPSLINCCTIDWFQSWPTDALELVANKFLEDV---ELDDNIRVEVVSMCKYFQESVKKLSLDYYNKLRRHNYVTPTSYLELILTFKTLLNSKRQEVAMMRNRYLTGLQKLDFAASQVAVMQRELTALQPQLILTSEETAKMMVKIEAETREADGKKLLVQADEKEANVAAAIAQGIKNECEGDLAEAMPALEAALAALDTLNPADISLVKSMQNPPGPVKLVMESICIMKGMKPERKPDPSGSGKMIEDYWGVSKKILGDL-KFLESLKTYDKDNIPPLTMKRIRERFINHPEFQPAVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLREAEGKLAAQMQKLNQKRAELKLVVDRLQALNDDFEEMNTKKKDLEENIEICSQKLVRAEKLISGLGGEKDRWTEAARQLGIRYTNLTGDVLLSSGTVAYLGAFTVDYRVQCQNQWLAECKDKVIPGFSD--FSLSHTLGDPIKIRAWQIAGLPVDSFSIDNGIIVSNSRRWALMIDPHGQANKWIKNMEKANKLAVIKFSDSNYMRMLENALQLGTPVLIENIGEELDASIEPILLKATFKQQGVEYMRLGENIIEYSRDFKLYITTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNQLIVESAKNKKHLKEIEDKILEVLSMSKGNILEDETAIKVLSSSKVLSEEISEKQKVASMTETQIDETRMGYKPVAVHSATIFFCISDLANIEPMYQYSLTWFINLYMHSLTHSTKSEELNLRIKYIIDHFTLSIYNNVCRSLFEKDKLLFSLLLTIGIMKQKKEITEEVWYFLLTGGIALDNPYPNPAPQWLSEKAWAEIVRASALPKLHGLMEH-LEQNLGEWKLIYDSAWPHEEQLPGSW-KFSQGLEKMVILRCLRPDKMVPAVREFIAEHMGKLYIEAPTFDLQGSYNDSSCCAPLIFVLSPSADPMAGLLKFADDLGMGGTRTQTISLGQGQGPIAAKMINNAIKDGTWVVLQNCHLAASWMPTLEKICEEVIVPESTNARFRLWLTSYPSEKFPVSILQNGIKMTNEPPKGLRANLLRSYLNDPISDPVFFQSCAKAVMWQKMLFGLCFFHAVVQERRNFGPLGWNIPYEFNESDLRISMWQIQMFLNDYKEVPFDALTYLTGECNYGGRVTDDKDRRLLLSLLSMFYCKEI-EEDYYSLAPGDTYYIPPHGSYQSYIDYLRNLPITAHPEVFGLHENADITKDNQETNQLFEGVLLTLPRQSGGSGKSPQEVVEELAQDILSKLPRDFDLEEVMKLYPVVYEESMNTVLRQELIRFNRLTKVVRRSLINLGRAIKGQVLMSSELEEVFNSMLVGKVPAMWAAKSYPSLKPLGGYVADLLARLTFFQEWIDKGPPVVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFEFEVT----PQETVMENNPEDGAYIKGLFLEGARWDRKTMQIGESLPKILYDPLPIIWLKPGESAMFLHQDIYVCPVYKTSARRGTLSTTGHSTNYVLSIELPTDMPQKHWINRGVA 4109          
BLAST of Dynein heavy chain axonemal vs. Ensembl Human
Match: DNAH6 (dynein axonemal heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:2951])

HSP 1 Score: 2672.89 bits (6927), Expect = 0.000e+0
Identity = 1517/3837 (39.54%), Postives = 2233/3837 (58.20%), Query Frame = 2
Query: 1619 KLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKN--------------PIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQL------EQFI-------MKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKF--------------LNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNL---LEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRI----HKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKST-LTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNT-GTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQF-----------------EKDL--EITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLK-WPGQVVIAGCQTYWTQEVSDALET------RDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYW-IE-ENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPH-RERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLP---FPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPE-YISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYE-DVVKIEPLLYGDFMSVAIE--NKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGL-QATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGS-VKAQDLPNPAPEWISDRVWNEILTL-ASLPAFSKFPEEFI-----------HKYLNDFKRIFDSLEPHREKLPGE---------WCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQI-DKDKVHRD-FRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDH-TGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAG-GKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQ----SMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMV------------------KAWPEITEIPS--DGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            +L  F+ L  Y ++++M  LT++++ + +N + D        D   +W  +     +P KK               P+FL +L+L      +   L+ F    +   +     + +VP L      + F        ++  +    P L +V  ++     +   ++ET++ A      YA  + KF              L LQ  DI  + +E L  Y  QH  A+ ++                      +G   I+T  +R+ L          +  +L R+ +K  D      +    KL   P T  E      ++  I + ++  ++  +     Y+L+E++      +DF    TM       + SI+ V   +   + D E   K     + +  E+L+N    V        I       +++R I       L + Q  A  + + ++ F   V+ +E L ++  + +  + LW + S+W KL    +      +D EV+   V+++ K +    ++   LP    V  Q+K  +E+ K  +P+I  LRNP ++ARHW  +   +  ++V     LT  +  ++ + D  + I  I+  A  E A+E  L K+   W+  +F +L ++++   +IL  +D+I  LLDD  +   ++  S Y  P + R+ +W+  L      ++EWL CQR WLYLE IF++ DI RQLP E K +  +D+ W++IM+     P+ +       LL   +  N LL+Q+QK L  YLE+KR  FPRFYFLS+DELLEIL+QT++P AVQPHLRKCF++I+KL+F                 EK    +I AM S EGE++   K     GNVEEW+ ++E  M  SLR +    + +Y+   RT+WV+   P QV++   Q  W +++++ LET      + LK       E+L+ L A+V+G + K+ R  L+ALI I+VHARD+V  ++   ++ +  F+W  QLRYYW I+ +N   R   +++ YGYEYLG   RLVITPLTDRCYL L GAL L  GGAPAGPAGTGKTETTKDL KA AIQCVVFNCSD LD+  MG+FF GLA +GAW CFDEFNRIDIEVLSV+AQQ+ TI+ A+  +L RFMFEG E+ L  +CA FITMNPGYAGRTELPDNLKALFRP AMMVP+YALIAE+ L+S GF  ++ L++K+   +KL SEQLS QDHYDFGMRAVKSV+  AG+LKR+N  ++E+++ +RA+QD N+PKFL DD  LF+GI+SDLFP ++    DYG L  +I     ++ L+     V K IQ +ET +VRHG+MLVGPTG GKT  Y +L   L +L+ ++  + S +Q V TYVLNPKSITMG+LYGE + +T EW DG+++  +R  V     D +W I DGPVDA+WIENMNTVLDDNK LCL++ E IKL  ++ M+FEV DL VASPATVSRCGMV+++P  L   P+V+ W++ +   +    +E +  LF  Y++E + F+     + +P  +      +  L++S I      +L++E                                           K+   +   F+F  +WS G +   +    FDT++R    TQ    P    P  G ++    D   T  L+                    W   +P +    D+ + +++VPT D VR   + E+LL  K  V+  G TG GK++     L K      Y+  ++ FSA+T++ +TQ++I+SKL+++RK + G P  K I+ F+DDLNMP L+ +GSQPPIEL+RQ+ DF G+YDR  +  ++ + D+  I +  PPGGGRNP+T R +RHF++L      E S+K +F  IL  ++      +     ++V+A +++Y  +   +LPTPAKSHY FNLRDLSK  QG+L  +P ++    Q+ RL+ HE  RVF DRL+N++D+ +F  +L    N  F    + +    +P+++GDF+    +  ++ Y +  + +K   V+++ L+D+N  N  ++ LV F DA+ HV RIAR+IRQ  GNALL+G+GG+G+QSLT+LAAH+  Y C QIELS+ Y    + +DL+++   AG+E+K +VFLF+DTQI  E FLED+NNILNSG+VPNL+  D+LE++    +P  +++G+ +  +  +F  +  +VR  LH V+ MSP+GE FR+R R FP+LVNCCTIDWF QWP+EAL SV+  F + +     +EE+   L  MC  +H SVS+ +E+Y  EL R  Y TPTSYLEL+ ++  + + K++++  ARDR KNGL KLL T  +V K++ +L  ++P L    E+ +A  E++  D E A + +  V  +EA A  KA+E + I DDAQRDLDEALPAL  + ++L  L+K DI+E+R   +PP+ V  V+E + I+ + KP               W + K LL D   FL  L  YDK+NI   ++ K++ YI +  F P  +EKVS+AC S+C WVRAM  Y  V K V PKR+ L  +  EL+ T   L+E +A L+ VED+I  LQ++ +     ++ L     L +ARL RA KL   L +E++RW++S+   E  I+NI GNV I+A  VAY G FT +YR S+   W    ++  +P    P+ +L++  GDP +IR W  DGLP+D +S EN ++V   RRWPL IDPQ QANRWI+N + ++GL +IKL+D +FLR LEN+IR G P L+E + E LDPALEPILLKQ F   G ++I+LGD+ I Y  +FRFY+TTK+PNPHY PEV  KVTI+NFT++ SGLEDQLL  VV  E+P LE+ + +LIV     + +LK IE+KIL  L  +EG+ +D+ +LI TL+ SK+ S  I+ ++  AE TE+ I+  R +Y PVA +  +++F +A L++IDPMYQYSL++F  +F   I  + K + L +R+D +      + Y NV R LFE+HKL++SF+L   +++ +G +  AEW F L G + ++ +  P P   W+    W     L  S P F    +  +             Y+N  K    S   H +K   +         W      F  L++++C + +KV  A+ DFV   LG++FIE    DL  +Y+D S  TPL+F+LS G+DP     +FA +  +S+++ +ISLGQGQGP AE+++K+AM+ G WVF QNCHLA SWM ++E L++   D D   +D FRL+L+SMPS  FPV +LQN  K+T EPP+G++AN+ +++T  +  F        +WR ++  +C FH ++ ERKKFGPLG+NI YEF D D    +  L ++  E   +P+  L Y  G I YGGRVTD WD+RC+  +L  F++P+ + EDY YS+SGIY   +P+ D    +  YI +LP+ D PEIFG+H+NAN+ F   ET+ L++ +L++QP+ ST G GKS +EIV+E+   +   +PE   +E  S+   V   Q    S+ TVL QEV R+N LL +I +SL  L KAI G VVMSE +E + NS  +N+VP  W++ AYPSLKPL SWV DL  R  F+  W+  G P  +WISGFFFPQ FLTGTLQN ARK  + ID +SF + V+                   +  P   E+PS  DG  + G+F++ +RWD  +M + ++ P ++   +PV+   P  N    P+ +Y CP+YKT  RAGTLSTTGHSTNFV ++ +P+ + + +WI +G A
Sbjct:  436 RLTCFIRLNDYLIENTMHILTVNAVNSLLNHLTDKLKRTPSADVIQKWITEE-KPEVPDKKGTLMVEKQEEDESLIPMFLTELMLTVQSLLFEPSLEDFLDGILGAVNHCQNTVLSVPNLVPDSYFDAFTSPYINNKLEGKTCGTGPSLAAVFEDDKNFHTIISQIKETIQAAFESARIYAATFEKFQIFFKENESLDLQALKLQEPDIN-FFSEQLEKYHKQHKDAVALRPTRN------------------VGLLLIDTRLLREKLIPSPLRCLEVLNFMLPRQSKKKVDAIIFEAQDAEYKLEFVPTTTTEYVHSLLFLDEIQERIESLEDEGNIVTQMYKLMEQYQVPTPPEDFAVFATM-------KPSIVAVRNAIDKSVGDRESSIKQFCVHLGSDLEELNNEVNEVKLQAQDPQILDISADQDKIRLILNNLQSVLADLQKRAFQYKSYQKNFKVEVSKFEALEEVSAELKLKQLLWDSFSEWDKLQQEWLKSKFDCLDPEVLNGQVSKYAKFV---TQLEKGLPP-NSVVPQLKYKVEKMKEKLPVIIDLRNPTLKARHWAAIEQTVDATLVDAEIPLTLERLSQLHVFDFGQEIQDISGQASGEAALEAILKKVEDSWKTTEFVILPHRDSKDVFILGGTDDIQVLLDDSTINVATLASSRYLGPLKTRVDEWQKQLALFNQTLEEWLTCQRNWLYLESIFNAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSISKLEFALMPPAEGKIPGIDGEPEKVYTNDILAMLSPEGERVSLGKGLKARGNVEEWLGKVEEAMFTSLRRLCKAAIADYQGKLRTDWVVAGHPSQVILTVSQIMWCRDLTECLETEHSNHIQALKNFEKVNFERLNALAAIVQGSLPKLHRNILTALITIDVHARDIVTELVQSKVETVESFDWQRQLRYYWDIDLDNCVARMALSQYTYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPFAMMVPNYALIAEVILYSEGFESSKILARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPDLNEDVVLIRALQDSNLPKFLTDDALLFSGIISDLFPGVQIPEHDYGILQSTIVDVMNRQNLQPEMCMVRKVIQFYETMLVRHGVMLVGPTGGGKTTVYRILAETLGNLQ-KLGIENSFYQAVKTYVLNPKSITMGELYGEVNNLTLEWKDGLMALSVRAAVNDTSEDHKWIISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPQIHMLFEVQDLRVASPATVSRCGMVFVDPEELKWMPYVKTWMKGISKKLTEETQEYILNLFQRYVDEGLHFINKKCSQAIPQVDISKVTTLCCLLESLILGKDGVNLAMEQ-----------------------------------------TKLNTILCQTFVFCYLWSLGGNLTENYYDSFDTFIR----TQFDDNPDARLPNSGDLWSIHMDFD-TKRLDP-------------------WERIIPTFKYNRDVPFFEMLVPTTDTVRYGYLMEKLLAVKHSVLFTGITGVGKSVIAKGLLNKIQESAGYVPVYLNFSAQTSSARTQEIIESKLERKRKNILGAPGNKRIVIFVDDLNMPRLDRYGSQPPIELLRQYQDFGGFYDRNKLF-WKEIQDVTIISACAPPGGGRNPVTPRFIRHFSMLCLPMPSEHSLKQIFQAILNGFLSDFPPAVKQTASSIVEASVEIYNKMSVDLLPTPAKSHYVFNLRDLSKCVQGILQCDPGTIREEIQIFRLFCHECQRVFHDRLINNEDKHYFHVILTEMANKHFGIAIDLEYFLNKPIIFGDFIKFGADKADRIYDDMPDIEKTANVLQDYLDDYNLTNPKEVKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCLQIELSRGYNYDSFHEDLRKLYKMAGVEDKNMVFLFTDTQIVVEEFLEDINNILNSGEVPNLFEKDELEQVLAATRPRAKEVGISEGNRDEVFQYFISKVRQKLHIVLCMSPVGEAFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSKTFFSQVDA--GNEELKEKLPLMCVNVHLSVSSMAERYYNELRRRYYTTPTSYLELINLYLSMLSEKRKQIISARDRVKNGLTKLLETNILVDKMKLDLSALEPVLLAKSEDVEALMEKLAVDQESADQVRNTVQEDEATAKVKAEETQAIADDAQRDLDEALPALDAANKALDSLDKADISEIRVFTKPPDLVMTVMEAISILLNAKPD--------------WPSAKQLLGD-SNFLKRLLEYDKENIKPQILAKLQKYINNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVVKVVEPKRQKLRAAQAELDITMATLREKQALLRQVEDQIQALQDEYDKGVNEKESLAKTMALTKARLVRAGKLTAALEDEQVRWEESIQKFEEEISNITGNVFIAAACVAYYGAFTAQYRQSLIECWIQDCQSLEIPI--DPSFSLINILGDPYEIRQWNTDGLPRDLISTENGILVTQGRRWPLMIDPQDQANRWIRNKESKSGLKIIKLTDSNFLRILENSIRLGLPVLLEELKETLDPALEPILLKQIFISGGRLLIRLGDSDIDYDKNFRFYMTTKMPNPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPRLEEQRIKLIVRINTDKNQLKTIEEKILRMLFTSEGNILDNEELIDTLQDSKITSGAIKTRLEEAESTEQMINVAREKYRPVATQGSVMYFVIASLSEIDPMYQYSLKYFKQLFNTTIETSVKTENLQQRLDVLLEQTLLTAYVNVSRGLFEQHKLIYSFMLCVEMMRQQGTLSDAEWNFFLRGSAGLEKERPPKPEAPWLPTATWFACCDLEESFPVFHGLTQNILSHPISIRLGSFETYINPQKWEGYSKMKHEDKHMRQEKEAAHQDPWSAGLSSFHKLILIKCCKEEKVVFALTDFVIENLGKQFIETPPVDLPTLYQDMSCNTPLVFILSTGSDPMGAFQRFARESGYSERVQSISLGQGQGPIAEKMVKDAMKSGNWVFLQNCHLAVSWMLAMEELIKTFTDPDSAIKDTFRLFLSSMPSNTFPVTVLQNSVKVTNEPPKGLRANIRRAFTEMTPSFFEENILGKKWRQIIFGICFFHAIIQERKKFGPLGWNICYEFNDSDRECALLNLKLYCKE-GKIPWDALIYITGEITYGGRVTDSWDQRCLRTILKRFFSPETLEEDYKYSESGIY--FAPMADSLQEFKDYIENLPLIDDPEIFGMHENANLVFQYKETSTLINTILEVQPRSSTGGEGKSNDEIVQELVASVQTRVPEKLEMEGASESLFVKDLQGRLNSLTTVLGQEVDRFNNLLKLIHTSLETLNKAIAGFVVMSEEMEKVYNSFLNNQVPALWSNTAYPSLKPLGSWVKDLILRTSFVDLWLKRGQPKSYWISGFFFPQGFLTGTLQNHARKYNLPIDELSFKYSVIPTYRDQAAVIEAAKTVQFGQELPMDMELPSPEDGVLVHGMFMDASRWDDKEMVIEDALPGQMNPVLPVVHFEPQQNYKPSPT-LYHCPLYKTGARAGTLSTTGHSTNFVVTVLLPSKRSKDYWIAKGSA 4151          
BLAST of Dynein heavy chain axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 1278.85 bits (3308), Expect = 0.000e+0
Identity = 951/3350 (28.39%), Postives = 1649/3350 (49.22%), Query Frame = 2
Query: 2879 EKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMH------KSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFS-SEDINRQLPVEGKRYATMDRMWRKIMKTAFDNP---SVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQF-EKDLEITAMFSGEGEKIVFEK-STYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQI--------PRTEWVLKWPGQVVIAGCQTYWTQEVSDAL-ETRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLK------IRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFM-FEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQN---------TTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGL--KDVTG-----FVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQ---GVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECW---IRSLP---------------------DAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEV-VNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPD-MKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRR--KGVFGPP--MGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGG-GRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGML-MLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQ--KYEDVVKIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGL-QATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKF----------------LNDIPELEVSEEVIRGLMY--MCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKL----EACARRQKELEN-KSDL--CEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVP-HTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWI------KNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADT--LTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRF-LLAGGS---VKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRI-FDSLEPHREKLPGEWCD-------ICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEP-QTAD-LTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQG-PRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQL---------GMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIY--SQSGIYRQISP-LTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEI-------VEEVSKEILQGMPE--------IFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRI--LFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRG 12448
            +KL+   ++    +++W A+       D       ++V    + +S+ E    +       ++ K +  +  +    G++ + + E          L++  ++ RHW  +  E+ ++    S LT  +  +  +  H   I KI  VA  E A+E+ L +M   W+  + E+++Y+N  T ++K  D++   L +H     +M  SPY K FEE    W+  L     + D W+  QR+W+YLE +FS S +I+  LP E  R+AT+      +MK    +P    V+ +    RLL  L +   +L ++QK L EYLE +R SFPRFYF+ D++LLEI+  +KD T +Q HL+K F  I  +   E+D  ITA  S EGEK+   K  +     + +W+  +E  M+ +L   +   L ++ ++           EW+ K+P QV+    + +W  E+   L + +  + +   +++ L+ L   V  +   I R  + ALI   VH RD    +++  I+  NDF W+  +R+Y+  + +       ++  N++F YG+EYLG   RLV TPLTDRCYLT+T ALH + GG+P GPAGTGKTE+ K LG       +VFNC +  DF AMG+   GL   GAW CFDEFNR++  +LS V+QQI TIQ+A +   D  +   G  L +  +  +FITMNPGY+GR+ LPDNLK LFR +AM  PD  LIA++ LFS GF  A TL+ KIV  F L  EQLS Q HYDFG+RA+K V+ +AGN+KR             + E+ + ++++ +  VPK + +D+ L   ++SD+FP I        +L   + T   +  L   DV G     ++DK +QL++ T + HGLMLVG +GSGKT  ++VL  AL   ++    +G        +V++ K+++   LYG  D  T EWTDG+ +++IR+    V      ++W IFDG VD  W+EN+N+VLDDNK L L +GE + +   + ++FEVADL  A+ ATVSRCGMV+    ++      E +   IR +P                     DA       +Q+   + L+        +   IVP   G L + + +L    I P  P  L     +    + R++  +++ L                 I D V +++I   V    L +L+W+F       SR+    ++R+  +   I LP  ++  + DY     G                      W  W++ VP   I+   +  +D++VPTID VR   +    L   KP++  GP G+GKT+++   L      E ++  + FS+ TT        D   + RR   GV   P  + ++++ F D++N+PA + +G+Q  I  +RQ  +  G+Y R +   + SL  I F+ +  PP   GR+P+T R +RH  ++  +   + S++ ++GT  +  +++    +  L + L  A +DVY+A Q +      + HY ++ R+L++  +G+   + P    S +Q++RLW HE+ R+FQDRLV +++REW   L+       F    + ++ +K  PLLY  ++S     + YV  V  +++   +   L+ F +     + LVLF   + HV RI RI RQ  G+ LL+G  G+G+ +L++  A +     FQ+++   Y  A++ +D++ ++  AG  N+ + F+  ++ + D  FLE LN +L +G+VP L+  D+   +   +K   Q  GL   +   L+  ++++V  NLH V TM+P G   R R    PAL N C ++WF  W + AL  V  +                 L    EL  S+   R  +   +C  +H++V  ++E   ++  R    TP  +L+ +  F  ++  K+ +L++ +     GL+K+  TEE V++LQ+ L++   +L++  E +    +E+  D + A+E +    + +   A++ K+    +   + DL +  PA+ E+  +++ + K+ + EV++M  PP  V+L +E +CI+             G  +   W A + ++     F+  +  +D + ++  +++++E YI +  +    + + S AC  + +W RA   Y  +   V P R  L+R  +E     K  +E     K V+ RI  L+E +    E  A+   + EN K DL   + ++ R+ +L+  L +E+ RW          ++++VG+ L+S+ ++AY G +    R+ + H+W   +   G+    D      + T  D ++   WQ++ LP D L  ENA+++    R+PL IDP GQA  +I      KN+QK + LD      + F ++LE+A+RFG   L+++V E  DP L P+L ++  +  G V+I +GD  I     F+ ++ T+     ++P++ ++VT VNFT++ S L  Q L  V+  ERPD++  +N L+    +    L+ +E  +L  L+ ++G  +DD  +I+TLE  K ++ E+  K    ++   ++D   ++Y  ++     ++  +  L +I  +Y YSL++ + IF + +     + T    +R+  I      +++  V R +    K+L + LL    ++        E  F LL G S    K  +  +  P  +         ++A       F   F H   N      + + +     +P  W D       +C     L+V+  LR D++  +    V+    + F++  +  D L++V  + SP+ P++   + G D +  +   A  ++ +++L++I++G  +G  +A+  +  A + G+WV  +N HLAPSW+  LE+ +  +   K H  FRL+LT+   PK P  IL+    +  EP  G+KANLL+S +S     L      TE   L L +C  H ++ ER ++ PLG++  YEF+D DLR+  + L         G    E   +P+  L+       YGG++ + +D+  +  VL   +  +   +D++      G     +P ++     + ++  L     P   GL +NA          ++L ++LK+  +        +EE+       + E++K+ LQ +P+        + NI+D   R+   +E+ +N          ++LL  I+  L ++    +     +    +++ SL   +VP  W     P    +  W+ DL++R+  L      DN     FW+ G F P+A++T T Q  A+    S++ ++    +      ++  I   G  IRG
Sbjct:  352 DKLTVATEELAAMKDVWKALQPVYTGIDEAKEKTWLSVQPRKIRQSLDELMNQLKQLPVKCRTYKSYEHVKQMLHTYGKMNMLVAE----------LKSEALKERHWHQMMKEMRVNW-NLSDLTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNK-TRLIKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLAD---MLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEEDRSITAFHSREGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENVEQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWEN---VEGV------AHVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSIIRRVPLDSDSAISFSSSSAPVNLIGEDAKPTRSIEIQRTAALALQ-----THFSPDGIVP---GSLKYAVSEL--EHIMPPTPQRLLSSFFSMMSYSIRKIVSHDEGL-----------------IDDSVEIDQIQSFVLRSMLTNLVWAFSGDGKWKSREMMSDFIRQATT---ISLPPNQQACLIDYEVQLSGD---------------------WQPWLSKVPTMEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQEMEVVN--VNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFY-RTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGTFNRA-MLKMTPAVRGLADQLTNAMVDVYLASQ-EHFTQDDQPHYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERYFGNACRLDEALK-RPLLYSCWLS-----RNYVP-VTREELQDYVSARLKGFYE-EELDVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCL-VHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICIL------------LGENVGTDWKAIRQVMM-KDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQE---AAKKTQEG----KVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQ---WQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLD------ESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLLMRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGGLDFLTVENKKSIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLA--VETNRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQLEKRLHSM---KPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAP--TERSRLYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKEIVKMRRTVENIKDPLFRF---FEREVNL--------GSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNLHIHIGRTDSTDVFRI--SGIDIRG 3562          
BLAST of Dynein heavy chain axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 1278.08 bits (3306), Expect = 0.000e+0
Identity = 942/3269 (28.82%), Postives = 1619/3269 (49.53%), Query Frame = 2
Query: 3095 QIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFS-SEDINRQLPVEGKRYATMDRMWRKIMKTAFDNP---SVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQF-EKDLEITAMFSGEGEKIVFEK-STYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQI--------PRTEWVLKWPGQVVIAGCQTYWTQEVSDAL-ETRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLK------IRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFM-FEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQN---------TTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGL--KDVTG-----FVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQ---GVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECW---IRSLP---------------------DAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEV-VNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPD-MKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRR--KGVFGPP--MGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGG-GRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGML-MLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQ--KYEDVVKIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGL-QATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKF----------------LNDIPELEVSEEVIRGLMY--MCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKL----EACARRQKELEN-KSDL--CEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVP-HTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWI------KNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADT--LTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRF-LLAGGS---VKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRI-FDSLEPHREKLPGEWCD-------ICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEP-QTAD-LTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQG-PRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQL---------GMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIY--SQSGIYRQISP-LTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEI-------VEEVSKEILQGMP-EIF----NIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRI--LFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRG 12448
             +K  +  +     L+  L++  ++ RHW  +  E+ ++    S LT  +  +  +  H   I KI  VA  E A+E+ L +M   W+  + E+++Y+N  T ++K  D++   L +H     +M  SPY K FEE    W+  L     + D W+  QR+W+YLE +FS S +I+  LP E  R+AT+      +MK    +P    V+ +    RLL  L +   +L ++QK L EYLE +R SFPRFYF+ D++LLEI+  +KD T +Q HL+K F  I  +   E+D  ITA  S EGEK+   K  +     + +W+  +E  M+ +L   +   L ++ ++           EW+ K+P QV+    + +W  E+   L + +  + +   +++ L+ L   V  +   I R  + ALI   VH RD    +++  I+  NDF W+  +R+Y+  + +       ++  N++F YG+EYLG   RLV TPLTDRCYLT+T ALH + GG+P GPAGTGKTE+ K LG       +VFNC +  DF AMG+   GL   GAW CFDEFNR++  +LS V+QQI TIQ+A +   D  +   G  L +  +  +FITMNPGY+GR+ LPDNLK LFR +AM  PD  LIA++ LFS GF  A TL+ KIV  F L  EQLS Q HYDFG+RA+K V+ +AGN+KR             + E+ + ++++ +  VPK + +D+ L   ++SD+FP I        +L   + T   +  L   DV G     ++DK +QL++ T + HGLMLVG +GSGKT  ++VL  AL   ++    +G        +V++ K+++   LYG  D  T EWTDG+ +++IR+    V      ++W IFDG VD  W+EN+N+VLDDNK L L +GE + +   + ++FEVADL  A+ ATVSRCGMV+    ++      E +   IR +P                     DA       +Q+   + L+        +   IVP   G L + + +L    I P  P  L     +    + R++  +++ L                 I D V +++I   V    L +L+W+F       SR+    ++R+  +   I LP  ++  + DY     G                      W  W++ VP   I+   +  +D++VPTID VR   +    L   KP++  GP G+GKT+++   L      E ++  + FS+ TT        D   + RR   GV   P  + ++++ F D++N+PA + +G+Q  I  +RQ  +  G+Y R +   + SL  I F+ +  PP   GR+P+T R +RH  ++  +   + S++ ++GT  +  +++    +  L + L  A +DVY+A Q +      + HY ++ R+L++  +G+   + P    S +Q++RLW HE+ R+FQDRLV +++REW   L+       F    + ++ +K  PLLY  ++S     + YV  V  +++   +   L+ F +     + LVLF   + HV RI RI RQ  G+ LL+G  G+G+ +L++  A +     FQ+++   Y  A++ +D++ ++  AG  N+ + F+  ++ + D  FLE LN +L +G+VP L+  D+   +   +K   Q  GL   +   L+  ++++V  NLH V TM+P G   R R    PAL N C ++WF  W + AL  V  +                 L    EL  S+   R  +   +C  +H++V  ++E   ++  R    TP  +L+ +  F  ++  K+ +L++ +     GL+K+  TEE V++LQ+ L++   +L++  E +    +E+  D + A+E +    + +   A++ K+    +   + DL +  PA+ E+  +++ + K+ + EV++M  PP  V+L +E +CI+             G  +   W A + ++     F+  +  +D + ++  +++++E YI +  +    + + S AC  + +W RA   Y  +   V P R  L+R  +E     K  +E     K V+ RI  L+E +    E  A+   + EN K DL   + ++ R+ +L+  L +E+ RW          ++++VG+ L+S+ ++AY G +    R+ + H+W   +   G+    D      + T  D ++   WQ++ LP D L  ENA+++    R+PL IDP GQA  +I      KN+QK + LD      + F ++LE+A+RFG   L+++V E  DP L P+L ++  +  G V+I +GD  I     F+ ++ T+     ++P++ ++VT VNFT++ S L  Q L  V+  ERPD++  +N L+    +    L+ +E  +L  L+ ++G  +DD  +I+TLE  K ++ E+  K    ++   ++D   ++Y  ++     ++  +  L +I  +Y YSL++ + IF + +     + T    +R+  I      +++  V R +    K+L + LL    ++        E  F LL G S    K  +  +  P  +         ++A       F   F H   N      + + +     +P  W D       +C     L+V+  LR D++  +    V+    + F++  +  D L++V  + SP+ P++   + G D +  +   A  ++ +++L++I++G  +G  +A+  +  A + G+WV  +N HLAPSW+  LE+ +  +   K H  FRL+LT+   PK P  IL+    +  EP  G+KANLL+S +S     L      TE   L L +C  H ++ ER ++ PLG++  YEF+D DLR+  + L         G    E   +P+  L+       YGG++ + +D+  +  VL   +  +   +D++      G     +P ++     + ++  L     P   GL +NA          ++L ++LK+  +        +EE+       + E++K+ LQ +P EI      +E+I       +E+ +N          ++LL  I+  L ++    +     +    +++ SL   +VP  W     P    +  W+ DL++R+  L      DN     FW+ G F P+A++T T Q  A+    S++ ++    +      ++  I   G  IRG
Sbjct: 1352 HVKQMLHTYGKMNMLVAELKSEALKERHWHQMMKEMRVNW-NLSDLTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNK-TRLIKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLAD---MLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEEDRSITAFHSREGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENVEQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWEN---VEGV------AHVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSIIRRVPLDSDSAISFSSSSAPVNLIGEDAKPTRSIEIQRTAALALQ-----THFSPDGIVP---GSLKYAVSEL--EHIMPPTPQRLLSSFFSMMSYSIRKIVSHDEGL-----------------IDDSVEIDQIQSFVLRSMLTNLVWAFSGDGKWKSREMMSDFIRQATT---ISLPPNQQACLIDYEVQLSGD---------------------WQPWLSKVPTMEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQEMEVVN--VNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFY-RTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGTFNRA-MLKMTPAVRGLADQLTNAMVDVYLASQ-EHFTQDDQPHYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERYFGNACRLDEALK-RPLLYSCWLS-----RNYVP-VTREELQDYVSARLKGFYE-EELDVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCL-VHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICIL------------LGENVGTDWKAIRQVMM-KDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQE---AAKKTQEG----KVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQ---WQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLD------ESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLLMRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGGLDFLTVENKKSIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLA--VETNRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQLEKRLHSM---KPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAP--TERSRLYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKEIVKMRRTVENIKDPLFRFFEREVNL--------GSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNLHIHIGRTDSTDVFRI--SGIDIRG 4494          
BLAST of Dynein heavy chain axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 1278.08 bits (3306), Expect = 0.000e+0
Identity = 942/3269 (28.82%), Postives = 1619/3269 (49.53%), Query Frame = 2
Query: 3095 QIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFS-SEDINRQLPVEGKRYATMDRMWRKIMKTAFDNP---SVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQF-EKDLEITAMFSGEGEKIVFEK-STYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQI--------PRTEWVLKWPGQVVIAGCQTYWTQEVSDAL-ETRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLK------IRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFM-FEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQN---------TTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGL--KDVTG-----FVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQ---GVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECW---IRSLP---------------------DAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEV-VNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPD-MKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRR--KGVFGPP--MGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGG-GRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGML-MLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQ--KYEDVVKIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGL-QATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKF----------------LNDIPELEVSEEVIRGLMY--MCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKL----EACARRQKELEN-KSDL--CEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVP-HTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWI------KNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADT--LTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRF-LLAGGS---VKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRI-FDSLEPHREKLPGEWCD-------ICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEP-QTAD-LTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQG-PRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQL---------GMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIY--SQSGIYRQISP-LTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEI-------VEEVSKEILQGMP-EIF----NIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRI--LFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRG 12448
             +K  +  +     L+  L++  ++ RHW  +  E+ ++    S LT  +  +  +  H   I KI  VA  E A+E+ L +M   W+  + E+++Y+N  T ++K  D++   L +H     +M  SPY K FEE    W+  L     + D W+  QR+W+YLE +FS S +I+  LP E  R+AT+      +MK    +P    V+ +    RLL  L +   +L ++QK L EYLE +R SFPRFYF+ D++LLEI+  +KD T +Q HL+K F  I  +   E+D  ITA  S EGEK+   K  +     + +W+  +E  M+ +L   +   L ++ ++           EW+ K+P QV+    + +W  E+   L + +  + +   +++ L+ L   V  +   I R  + ALI   VH RD    +++  I+  NDF W+  +R+Y+  + +       ++  N++F YG+EYLG   RLV TPLTDRCYLT+T ALH + GG+P GPAGTGKTE+ K LG       +VFNC +  DF AMG+   GL   GAW CFDEFNR++  +LS V+QQI TIQ+A +   D  +   G  L +  +  +FITMNPGY+GR+ LPDNLK LFR +AM  PD  LIA++ LFS GF  A TL+ KIV  F L  EQLS Q HYDFG+RA+K V+ +AGN+KR             + E+ + ++++ +  VPK + +D+ L   ++SD+FP I        +L   + T   +  L   DV G     ++DK +QL++ T + HGLMLVG +GSGKT  ++VL  AL   ++    +G        +V++ K+++   LYG  D  T EWTDG+ +++IR+    V      ++W IFDG VD  W+EN+N+VLDDNK L L +GE + +   + ++FEVADL  A+ ATVSRCGMV+    ++      E +   IR +P                     DA       +Q+   + L+        +   IVP   G L + + +L    I P  P  L     +    + R++  +++ L                 I D V +++I   V    L +L+W+F       SR+    ++R+  +   I LP  ++  + DY     G                      W  W++ VP   I+   +  +D++VPTID VR   +    L   KP++  GP G+GKT+++   L      E ++  + FS+ TT        D   + RR   GV   P  + ++++ F D++N+PA + +G+Q  I  +RQ  +  G+Y R +   + SL  I F+ +  PP   GR+P+T R +RH  ++  +   + S++ ++GT  +  +++    +  L + L  A +DVY+A Q +      + HY ++ R+L++  +G+   + P    S +Q++RLW HE+ R+FQDRLV +++REW   L+       F    + ++ +K  PLLY  ++S     + YV  V  +++   +   L+ F +     + LVLF   + HV RI RI RQ  G+ LL+G  G+G+ +L++  A +     FQ+++   Y  A++ +D++ ++  AG  N+ + F+  ++ + D  FLE LN +L +G+VP L+  D+   +   +K   Q  GL   +   L+  ++++V  NLH V TM+P G   R R    PAL N C ++WF  W + AL  V  +                 L    EL  S+   R  +   +C  +H++V  ++E   ++  R    TP  +L+ +  F  ++  K+ +L++ +     GL+K+  TEE V++LQ+ L++   +L++  E +    +E+  D + A+E +    + +   A++ K+    +   + DL +  PA+ E+  +++ + K+ + EV++M  PP  V+L +E +CI+             G  +   W A + ++     F+  +  +D + ++  +++++E YI +  +    + + S AC  + +W RA   Y  +   V P R  L+R  +E     K  +E     K V+ RI  L+E +    E  A+   + EN K DL   + ++ R+ +L+  L +E+ RW          ++++VG+ L+S+ ++AY G +    R+ + H+W   +   G+    D      + T  D ++   WQ++ LP D L  ENA+++    R+PL IDP GQA  +I      KN+QK + LD      + F ++LE+A+RFG   L+++V E  DP L P+L ++  +  G V+I +GD  I     F+ ++ T+     ++P++ ++VT VNFT++ S L  Q L  V+  ERPD++  +N L+    +    L+ +E  +L  L+ ++G  +DD  +I+TLE  K ++ E+  K    ++   ++D   ++Y  ++     ++  +  L +I  +Y YSL++ + IF + +     + T    +R+  I      +++  V R +    K+L + LL    ++        E  F LL G S    K  +  +  P  +         ++A       F   F H   N      + + +     +P  W D       +C     L+V+  LR D++  +    V+    + F++  +  D L++V  + SP+ P++   + G D +  +   A  ++ +++L++I++G  +G  +A+  +  A + G+WV  +N HLAPSW+  LE+ +  +   K H  FRL+LT+   PK P  IL+    +  EP  G+KANLL+S +S     L      TE   L L +C  H ++ ER ++ PLG++  YEF+D DLR+  + L         G    E   +P+  L+       YGG++ + +D+  +  VL   +  +   +D++      G     +P ++     + ++  L     P   GL +NA          ++L ++LK+  +        +EE+       + E++K+ LQ +P EI      +E+I       +E+ +N          ++LL  I+  L ++    +     +    +++ SL   +VP  W     P    +  W+ DL++R+  L      DN     FW+ G F P+A++T T Q  A+    S++ ++    +      ++  I   G  IRG
Sbjct: 1352 HVKQMLHTYGKMNMLVAELKSEALKERHWHQMMKEMRVNW-NLSDLTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNK-TRLIKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLAD---MLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEEDRSITAFHSREGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENVEQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWEN---VEGV------AHVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSIIRRVPLDSDSAISFSSSSAPVNLIGEDAKPTRSIEIQRTAALALQ-----THFSPDGIVP---GSLKYAVSEL--EHIMPPTPQRLLSSFFSMMSYSIRKIVSHDEGL-----------------IDDSVEIDQIQSFVLRSMLTNLVWAFSGDGKWKSREMMSDFIRQATT---ISLPPNQQACLIDYEVQLSGD---------------------WQPWLSKVPTMEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQEMEVVN--VNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFY-RTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGTFNRA-MLKMTPAVRGLADQLTNAMVDVYLASQ-EHFTQDDQPHYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERYFGNACRLDEALK-RPLLYSCWLS-----RNYVP-VTREELQDYVSARLKGFYE-EELDVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCL-VHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICIL------------LGENVGTDWKAIRQVMM-KDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQE---AAKKTQEG----KVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQ---WQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLD------ESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLLMRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGGLDFLTVENKKSIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLA--VETNRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQLEKRLHSM---KPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAP--TERSRLYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKEIVKMRRTVENIKDPLFRFFEREVNL--------GSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNLHIHIGRTDSTDVFRI--SGIDIRG 4494          
BLAST of Dynein heavy chain axonemal vs. Ensembl Celegans
Match: che-3 (Cytoplasmic dynein 2 heavy chain 1 [Source:UniProtKB/Swiss-Prot;Acc:Q19542])

HSP 1 Score: 555.829 bits (1431), Expect = 4.402e-158
Identity = 337/950 (35.47%), Postives = 531/950 (55.89%), Query Frame = 2
Query: 3110 IEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKST----LTFSKCLEM--RLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDE----INQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLE-ITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALE-TRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNP---GYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWI 5914
            +E FK     ++  R   + A HW  +   LG+   P+ T    L F+  L +   + ++ + + ++   A  E AI  A+ +++      +F +  YK++    LK+  E    IN L D   ++ QS+  SPY   F ++   WET L      + +  + QR+W+YLEPIF        LP E  R++ +D  +R I+     +  +++LC    L  +L++    L + QK L+++LE KR +FPRFYF+ DD+LLEIL Q+ +P  +Q H++K F+ I ++QF    E I +M S EGE +   K+      VE W+ E+ + MR +L+ +  + + + +  P    + K+P QV+    +  ++  + + L  + DL     +LLE+L     +   D  K+  + L +LI+  +H  DVV+ ++T   ++IN + W  QLR+Y +   + +R V++EF Y YEY GN ++LV TPLTD+CYLTLT A+++  GG P GPAGTGKTE+ K L      Q +VFNC + +D  +MG+ F G+   GAW CFDEFNR+D  VLS V+ QI TIQ A + R     F G  + + P+ A+F+T+NP   GY GR ++PDNLK LFR V M  PD  LI+   L+S GF DA  L++KIV+ F+LS + LS Q HYD+G+RA+K V+   G L+R  T  +E  + ++A+    + K    D + FN ++ D+F N+ +E   + +L+  +  AA++ G+K     ++K  QL+E    R G+++VG  GSGK+  +++LQ +L   K        P +       NPK++   +L G  D+ T EW+DGI++   R+ VT +     W + DG +D  W+E +N+VLDDN+ L + SGE I+    +  +FE   L  ASPATVSR GM+Y+    +     V  W+
Sbjct: 1148 VEHFKEVSSALKFCRGDVLSADHWHEMFRFLGL---PRGTTIEKLKFADLLSVSKNIIENTDQLKQLNSRAQGEVAIRDAIQELTLWAAQTEFTLADYKHSNGQNLKIIKEWKESINSLKDSQALL-QSLKSSPYYSQFTDKTAVWETRLADLDVFLAQMNEIQRKWIYLEPIFG----RGALPSEASRFSRVDSEYRAILNDVSKDARLVSLCSRQSLKKSLEQIVDQLNRCQKALNQFLEQKRTAFPRFYFIGDDDLLEILGQSTNPQVIQTHMKKLFQGINRVQFSSTGETIISMVSSEGETVPLSKAVRIVPQVESWLQELSDEMRRTLKDLTAQAVADAQ--PS---LAKYPSQVLCLAEEVKFSASIENNLNGSSDLNSFKSQLLEKLKAYTNMKVDD--KVSDLKLKSLILDLIHHIDVVDQLLTNQAKSINSWTWQRQLRFYLVNGGIVLRQVSSEFEYTYEYQGNYAKLVHTPLTDKCYLTLTQAMYMGLGGNPYGPAGTGKTESVKALAALMGRQVLVFNCDEGIDVTSMGRIFTGIVECGAWGCFDEFNRLDSTVLSAVSMQIQTIQGAIKSRAGSCTFGGKNVQVNPNSAIFVTLNPAGKGYGGRQKMPDNLKQLFRAVVMGKPDNELISSTILYSEGFVDATALARKIVSVFQLSRQMLSKQQHYDWGLRALKVVLGGCGALRRTQTNKNETDLVVQALLLNTLSKLTFSDSERFNSLIDDIFSNVTKEMTKFEELVEPLGVAAQEMGIKLGDKQMEKVFQLYEQMRQRIGVVVVGAAGSGKSTIWKILQRSLILTK-------KPLKVTQ---FNPKAVNRSKLLGNMDMDTREWSDGIITMAARE-VTKDTSVHHWIVCDGDIDPEWVEALNSVLDDNRLLTMPSGERIQFGSNVNFLFETDSLQFASPATVSRMGMIYISEEDVTPKDIVASWL 2071          

HSP 2 Score: 491.886 bits (1265), Expect = 1.299e-138
Identity = 502/2084 (24.09%), Postives = 952/2084 (45.68%), Query Frame = 2
Query: 6515 NVPEYIIKPDMKYSDI--IVPTIDNVRLISISEQLLIS--KKPVMCVGPTGTGKTLSISDKLTKYM---PPEYISEFIVFSAKTTANQTQDLIDSKLDKRRK---GVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPG-GGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDA---------VRHVCR-IARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAY-SKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIA--SESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGD-PVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLF--SFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWIS-DRVWNEILTLASLPA-FSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPF--KVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSG--IYRQISPL--TDHTGYMAYI-RSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSK--EILQGMPEIFNIEDISKR---YPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASK-AYPS-----LKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCY-IRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLI-PCANRSIPPSEIYDCPVYKTLTRA 12619
            +V + + K +++  D+   V T D  R   I    L S  ++  +  G TG GK      +L K+     PE     +  SA+++++    LI     +       V+ P     +I F+  +N+PA + +G+   + L++Q   ++G++D     E+ S+ +I F+ SM P G G    I+ RL      +  N      + +++ T L   I+  V E +   E +    +D+Y  +QS   PT +   + F+ RDL+     +L  E +      ++  +   E+ R+F DRL  + D+  F+ +L   +    +Q  E V+  E +       V  E+         +  L +   N+ DFNQ+    +N   F  A         +   C  I R++  P G+  L G  G GR+   +L AHM     F   ++ N+   ++ ++LK  +  A   N+ +V +  D Q++   FL+ +N++L SG+VP L++  +L+ +      +V +   QA+ T     + + R+R  +H V+ +      F+  + + PA++  C + +  ++ + +L         +IP++++  + I     +    +  + N  E           + P  Y + +  F ++   K+  L    +R K G+ KL    + V K+Q++       L +   E+    + I      A++ ++ + + +A   K+    E  +      L E  P + E+  ++  +    ++E+R++  PPE VR +++ V +   +             +D  W+A +  L   G   D + N+D + I++ + +K+   +   S SF  A  ++ S A   +  WV+A  +Y  + + +AP      +  K L++ +K ++     L++V++ +  L+ K E   +   +++   D  +  +  A  L+  LS E  RW+  +       + +    LI++ ++ YLG  + + R S+     +  K + +P T KP +     F     +  NW+  GLP D LS+EN  I+  S   PL ID  GQ + ++    +++  +  K +  D +  +E AIRFGK  +++++ E  D AL PIL K    Q    VI  G   I ++ DF+ Y  T+       P    ++ IVNFT + S L  QLL + +  E+P+LE+  + L+      + EL+ +E  +L +L+ ++G+ +++  L+ +L  SK  +  I   ++ +EQ  +++   +  Y+P+++ T  LFF  ++L   +PMY YS+   +++F  G T  +  D  + R++ +      +++ ++ R +F + +L+F  +F+ AT     + K    EW         ++ DL     +WIS DR+ +       LP+ F+ F  +    + N+F +            P         FQ +L ++ ++ +++ N + DFV   L    I P   +L  ++++S  T P++F+L+ G DP+ +L +FA  M       +IS+GQGQ   A E I+ +  +G+W+   N HL    +PS   + + +     H +FRLWLT+    +FP  +LQ   K+T EPP G++ NLL++YT       N I   +     +  L   H +L ER+ F P G+   YEF   D+R+  + +        D  F   +L++    + YGGR+ +D+D      VL  + N  +  ++ I  ++G  + + I  L  T+   Y+ +I +S+P  D P +FGL +N   ++ I E +  +  +  L      A G ++  + ++  K  +I+    ++   +D+ KR     +     ++ VL  E I    L+  +  S+  + K+++   + S A++    SL   + PD W S  A PS     L  +        Q     ++      P  F  S  F+P  FL    Q  +R+  I +D +     ++  AW   +++P+  C  ++GL L+GA +D    + T S     +++ P+++L     + S    E    PVY +  R+
Sbjct: 2179 DVSQNVTKEEVEREDLRPFVQTADTQRYSDIIGSWLQSGNRESFLITGTTGCGK-----QQLLKHCFQNDPESQLASLYCSAQSSSSHLLQLIQQNCVQASNPTGRVWRPKDRPNMILFLKGINLPAPDKYGTNELLALLQQLLTYQGFFDHNL--EWVSIENIQFVGSMNPIGDGAAVSISNRLFSLLRCVSLNTTDSSQLTSIYRTYLTP-ILEEVGERNS--EIIANRMVDIYNKVQSNFRPTDSVV-FLFSPRDLTNWVVSLLRHELDQ----GKLEAVICFEARRIFADRLPTENDKLKFEEILRNVI--PISQANETVIFKEKVYVTTGTVVPGES---------NTGLPLTPINMSDFNQLLAKSINRFAFEIANFNCPLTSQLAFFCACIDRVLTGPGGHLFLPGRPGFGRRDSVRLVAHMHNIQVFSPPVTANFSAKQFDNELKNAITQAVTNNEHVVLILEDHQLRKNIFLQAINSLLASGNVPGLFTQQELDGLVA----LVSEAANQASFTGALQQFLAHRIRSLVHVVLILEVEANDFKINITENPAILKHCNVIFADRFDRNSLV--------EIPKIQMESQGITTTDAILTGFNDVLVNLPEHLS--------IQPIKYRQFVENFFQLLGYKRLTLSVRLERLKGGVSKLNEARDEVAKMQKKAGKKSKLLAEKQAEADEALKAITESMSGAEDQKLSMEQLKAATEKENVRIEEQKAKIDEQLKEVQPLIDEARRAVGSIKSESLSEIRSLRAPPEAVRDILQAVLLFMGI-------------LDTSWEAMRKFLSKSG-VKDDIMNFDANRITNEIHKKVTALVKQKSNSFEEANAKRASAAAAPLAAWVKANLEYSKILEKIAPLEGEKNKLVKNLKKAEKQMENLSKGLQSVDEVVGELKRKFEVLMKEATQIKVDLDREQDTIRIAGTLVESLSGEFERWKIQIETFGEEQSKMELCSLITSAFITYLGGCSEKDRKSLLK---SMCKMFNMPPTFKPLS-----FASLETEQLNWKTKGLPADQLSLENGSILFTSCHAPLIIDRSGQVSLFLSKFLEKS--ETFKAAQPDLMTQIELAIRFGKTIIIDDIVE-FDSALIPILRKDLSSQGPRQVISFGGKSIDFNPDFKIYFCTRDEKVDIRPNSYVQLNIVNFTTTISALSAQLLDVAIHLEKPELEERSSSLLRDAELKKLELEGLEQLLLQQLASSQGNLLENTALLDSLNKSKESAEIITKSIVESEQLHKELTTQKDIYVPLSLFTSSLFFSFSNLQFHNPMYNYSVNTIMHLF--GKTIKSCEDKSSTRVETLARQMQLTVFYHISRGIFRQDRLMFAVAFINATMPKMFQPK----EWELFTGVLVDESTDLSALRVQWISPDRLQSLARIRTHLPSLFNNFQIQDDATW-NEFSKTLQC----ENAFPKNVELKMTHFQKVLFIQAVKPERLYNCLMDFVLKTLNIPSINPPAFELKHIFQESESTEPILFILADGADPSQELSEFASSMNVP--YHSISMGQGQEIAAYEAIRESASKGEWLCLNNLHLMLQAVPS---IFKHLSLTTPHENFRLWLTTEGDARFPSMMLQQSLKITFEPPPGVRNNLLRTYTQIDRSTKNVITCQS-----IFVLAWLHALLQERRTFIPQGWTKFYEFGASDVRVAKSFVEQLTANKADWEFVRGILKF----VIYGGRIENDFD----FKVLDSYLNV-LFCDEKINGRAGSQLVKGIDLLATTNVQEYIGHISKSVPSVDEPYLFGLPENIKYSWQIVEADRTISSIRTL------ALGDTKNALSDQSDKISQIVSLWKKLCQSDDLPKRELPTAIRSADPISEVLCLETINALSLIKQLHRSIGHVAKSMKTPSLASPAVQKTIQSLVFQQTPDEWDSMWAGPSDPADYLNVVVKKTRGTLQLFESSKSSSLLSSPIDF--SDLFYPNIFLNALRQTTSRQIKIPLDQL-----ILSSAWTP-SQLPAKQCVQVQGLLLQGATFDSFLRETTVSSAA--YSQAPIVFLAWTSESSSTITGEQIQVPVYSSSERS 4145          
BLAST of Dynein heavy chain axonemal vs. Ensembl Celegans
Match: dhc-3 (Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G5EDV4])

HSP 1 Score: 176.407 bits (446), Expect = 3.452e-43
Identity = 147/582 (25.26%), Postives = 297/582 (51.03%), Query Frame = 2
Query: 7628 RHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVF---LFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGL----MYMCKEIHQSVSNYSEKYRQELSRYNYV-TPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKI-EPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVV 9346
            R+V  + ++I+   G+ L++G   S       + + + ++  F  +  K   + EWR+ +  ++    ++ K  V    +  D +I  E+ L DL  I     +P  Y    L R+      ++ + G + T         K +   + T ++   I  + ++    F  L+NC  +          L  + L +  D  + E  +EV+  L    ++  ++I Q +     K   +LS +  + T    L+++   +K+  +K++E+++   + + G++K+   EE V  +Q EL  ++PQL +   E+      IE+++   +  + VV   E  A + A + + ++ +++ +L  A+PAL+ ++E+L+ + ++D++ ++ M  PP  VRL +E VCI+  VKP KI  ++ G  ++DYW +G+ LL D   FL  + ++ +D +S   ++ I E Y++ E F P  +++ S A   +C+WV A+  Y+ ++K V PKRE L ++   ++Q  K L+  R  L  V +++ GL ++     ++++ELE++   CE R+ RA++L+  LS EK +W++ + 
Sbjct: 1886 RNVNVLEKVIQTSYGHTLIVGNDTSKSLDAITVISELCKHLLFTNQGIKT--IEEWRELMSNVLRDCLIDGKDTVLGVHITPDDEIF-ETILLDLTCICCFKLIPPRY----LTRL------MLSEFGEKHT------LEGKGIWEMIETKLSALKISIVLKSS--DFSWLINCHRM---------LLSMLILIWWRDPSKREQEQEVLDELHNSELFSKQQIDQIM-----KVLDDLSDFKMINTRAEKLKMVSTITKLAKKKREEVRKTMTKYEKGMEKMKRAEEQVAGMQGELLRLQPQLVRTSIETSMLMSTIEKETIDVENAREVVAANENKANEAATKAQSLKAESEAELASAIPALESAVEALETMTQSDVSSLKTMRFPPYAVRLCMEAVCILLGVKPAKI-TNEIGEVVNDYWVSGQKLLSDI-HFLAKIRSFARDTVSKKTVKLIREKYLSKEEFDPENVKQCSLAAEGLCRWVLAIDMYNQISKIVEPKRERLRKAEVLVKQHLKQLEVKRKALLKVTEKLQGLSDQFSQMCQKKQELESQISSCEVRMERAERLVQALSGEKDKWKNKIT 2430          

HSP 2 Score: 158.688 bits (400), Expect = 9.041e-38
Identity = 135/531 (25.42%), Postives = 239/531 (45.01%), Query Frame = 2
Query: 3080 QEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKI-MKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKST---YPTGNVEEWMLEIENM----MRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMT-LSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAI 4645
            +E   +I++ + EF+  +P++  +    M+ RHW+M+  +   S+  +     S+ LEM   +  +   ++   A KE  +E ++ KM  +W    F      + G  +L  + E+N  +  H+  +Q++  SP+     + I  W  TL      +  + QC  +W  +E +FS+EDI  Q+P E + +  +   W  I  +   + P +  +    +L   L E   L  +++ G   YL  KR  FPR + LSD+ +L ++  +++P   + ++   F ++        +EI ++ S + E I   K         +VE+WM E+++     +R  +R++I K  +NYK  P  E +L  P QV     +  +T ++ ++++   L  L  +L      +R      + K  R   L  L  I   +  +VN ++ E +  I+D+ W SQLRYYW  EN+ IR       Y YE  G    ++   L D          H  F G   G       +    LGK FAI
Sbjct:  675 KEALLKIEIVLAEFEKLLPVLGAISCQAMKDRHWKMILQDSETSVKVEGNPLVSELLEMNFIEKADKFEQVGAQAEKERVLETSIEKMKSQWVTATF----VTHQGGELL--TTELNVQMQAHLARSQTILSSPHAFSILDHIRHWLDTLLNLNTFVHLYKQCDTRWRKIEGVFSTEDIAYQMPHEFRTFKKISLRWLHINNQITEERPILEQMDLVQQLNLELSELEVLFGRMENGFHAYLRKKRAVFPRLFALSDELVLSLICDSREPANCKSYIPLLFPSLTTFDQNTKMEIISV-STKLETISLVKPVNVNLSKRHVEKWMHELDSQIKYTLRTRIRLLIEK--MNYKLSP-VETILNEPIQVAAVYLKIAFTWQMENSMKQNSLTILASEL---KICIRDCQHAVLHKHDRWEFLPVLYHIYKSSTHLVNKLMNEQVIFIDDYRWTSQLRYYWHLENVFIRVGTVSTRYDYEVQG-VDCMIDNQLVDEAVKYFICMNHFGFNGFVNGMDVNLARQIAGALGKPFAI 1191          
BLAST of Dynein heavy chain axonemal vs. Ensembl Fly
Match: Dhc36C (gene:FBgn0013810 transcript:FBtr0304742)

HSP 1 Score: 2789.6 bits (7230), Expect = 0.000e+0
Identity = 1585/3831 (41.37%), Postives = 2271/3831 (59.28%), Query Frame = 2
Query: 1502 FLKDTWIDNLQKFIRTSLRDSKKGWFNIYETDFYVYTKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVL-DNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAI-LDLLAR---ELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKC-------LTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFE---KSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKGLYVKLLE----QLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFV-DKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYP-HRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFI-------YPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQL----------------------IFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKP-DMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIV-FSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVA---ELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREW-FKNL---LVGKLNSDFNQKYEDVVK---------IEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPI--VQDLGLQ--ATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFL--NDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIAS-ESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREK-LPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKF-SKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTS--FSD-DFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQV--MTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQ------PKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEI--PSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQ--KHWIKRGVA 12718
             L+++W   +   +   L+ SK+G       D   +T   +K+F   V   M   +  + + SL  + + I D  ++                       NP F + ++L D     ++    +     + + D  + ++Q +P++E  +  D+  +    L    + E  V++ +  +   L++  I  E    +++ F++L N    E V  F+ + +A      ++  E ++   E  I +++    +I   FY   E  R       +++   + LDLLAR   + +    +  + +  I +K    P    EL +L+ +++   + L  + E   K        L D+ L       + N+  + +W +   P         + + ++E +E  +K     +  F  +L N    V +  ++ DI +          + ++L +A       N  E  +   ++ Y    K     +P++ L+ A  D++   D  M+  + + D + ++  V+ FY+ + K  K   + P   ++   +K  IE F+  +P+I  L NPGM+ARHWE++S+ +G  I     LT  K +E +L +++     I+E A KE  +E+A+ KM  EWE ++F +  Y+++GT+ L   D+I  LLDD I+ TQ+M  SPY KPFE  I KWE  L   Q+++DEWL+ Q  W+YLEPIFSS DI +Q+P EG+R++ +D++W+++MK    +P V+ +    ++   LK+   LLE +QKGL+ YLE KR  FPRF+FLS+DELLEILS+TKDPT VQ HL+KCFE IA L F ++L++TAM S E E++       ++   G VE+W+LE+E  M++S+   + +   +Y ++ R  WVL WPGQ V +   TYWT E+++  E+ + K    K L+    Q++ +  +VRGD+    R+TL AL+V++VHARDV+  ++   ++++ DF+W+ QLRYYW + NL  R +N   PYGYEYLGNT RLV+TPLTDRCY TL  AL+L  GGAP GPAGTGKTETTKDL KA A QCVVFNCSD LD++A+GKFFKGLAS GAW+CFDEFNRID+EVLSVVAQQI TIQ+         +FEG  L L P+CAVFITMNPGYAGR+ELPDNLKALFR VAMMVPDYALI+EI L+S+GF  A+ LS KIV T++L SEQLS+Q HYD+GMRAVKSV+ AAG LK +    +E+++ LR+I+DVN+PKFL  D+ LF GI SDLFP       DY       Q A  ++  K  T FV +K  QL+E  VVRHGLMLVG    GKT  Y VL  AL  ++     DGS  + ++T V+NPK+ITMGQLYG+FD ++HEW+DGIL+   R    ++ PD++W IFDGPVDA+WIENMNTVLDDNKKLCL SGEII+L     ++FE  DL VASPATVSRCGM+YLEPS LG  P V  W  +LP A +   ++ +  L   +    +  +R +L+EI PT++  L  +++   + FI       Y    SDL   A+T                                              E  FLFS IWS G S D DSR+KF+   R  M                             P P++G V+DYR+   G                   K KW  W  +V      P D+  + II+ T ++VR+ ++ + L    KP+M VGPTGTGK++ + D + K M   +    ++ FSA+T+ANQTQD+I SKLDKRRKGVFGPP+    + F+DD++MP  E +G+QPPIEL+R   D   WYDRK I   + L+D+  IV+MGPP  G N +T R  R FN++  ++   D + T+F  I+  W +       E  P  + +V A + +Y   +  +LPTPAKSHY FNLRD S+V QG+L+  PE+   V+ + RLW HE  RV+ DRLV D DR W F+N+   +    N+D ++ +  +V+            L+Y DF +   + K YVE  + +++ +V+E  L ++N ++   MNLVLF  A+ H+ RI RII+QP  +ALL+G+GGSGRQSLT+LA+H+ +Y+ FQ+E+++ YG  E+ +D+K I+   G      VFLF+D QIKDESFLED++N+LNSG+VPNL++ ++   +   M  I   +D  +Q   +   LF+ +    +  LH V+ MSPIG+  R R+R+FP++VNCCTIDWF  WP++AL +V+ +FL   D+  LE      R  + MC E H S    S K+   L RYNYVTPTSYLEL+  F  + ++K+  +   R+R   G+ +L    + V  +QE+L  ++P+L++A E       ++  DS++A+E + +V  +E+ A ++A   + I+D+    L EALP L+ +L +L  L   DI  V+ M  PP GVR+V+E VCI+KDVKP K+        ++DYW   K +L D  KFLDSL N+DKDNI   V++K+   I S E+F P  I+  S AC  +C+WV A+ KY  VAK VAPK+ AL  +        K L E  A L  VE  +  +Q+ L+   R+   L  + + C  +L RA +LI GL  E+ RW ++   L+    ++ G+VLIS+G V+YLG FT ++R     +W      +GV  T      L    G+PV+IR W I GLP D  SIE+A++++ +RRWPL IDPQGQAN+WIKN +K N L VI+L+  D+ R +ENAI+FG P L+EN+GEELDP LE +L K  FKQ GA+ IKLGD++I Y+  FRFY+TTKL NPHY PEV+ KVT++NF ++  GL+DQLLG+ VA ERPDLE  KN LIV  A  ++ LKE ED+IL  LS AE + ++D   +Q L ++K  +N+I  K +I E TE+ ID  R  Y+P+A  + ILFF + +LA IDPMYQYSL WF+N++ + I N  K D +  R+ ++ N+FT+SLY N+CRSLFE+ KLLFS +L   +++H+ +ID AEW FLL GG        NP   W+  + W+E+  L +L  F    E+F ++    +K  FDS  P   K +P  W +    FQ LL+LR  R DK+  A+ +FV+  LGERF++P   DL   + DS    PLIF+L+PG+DP + L KFA+D  F + +L ++SLGQGQGP A ++I   ++ G WV  QNCHLA S+MP LE++ E +  D  H DFRLWLTS P+  FPV +LQNG KMT EPP+G+++N+L+S  S   SD ++  S  +   ++ L+ SLC FH V+ ER+ FGP+G+NIPYEF + DLRI + QL MFL +Y  V +  L+Y  G  NYGGRVTDDWDRR +  +L  FY P V  +   Y   ++G+Y  +    +   Y+ + R LP    P IFG H NA+I     ET+ LL   L  Q           +   + EE+V  V+ +IL  +P++F+ +    +YP +Y QSMNTVL+QE++R+N LLN I++SL  L K I+GLVVMS A+E++  S+   K+P  WA K+YPSLKPL S+V D  +R+ F+Q W D+G P  FW+SGFFF QAFLTG  QN+ARK +ISID ++F ++V+    P+   +  P DG ++ G+FLEGARWD     L ESRP+ELF  MP+IWL P     +P    Y CP+YKT  R G LSTTGHSTNFV ++ +  + +    HWI RG A
Sbjct:  320 LLEESWYGEIHSSL---LKASKRGQL----PDIRRFTL--VKRFFNCVAALMTQQLEDICIRSLKEYADFICDYGHS-----------------------NPGFEISVMLADEDTIQFNPSFSKVQSELLRVIDSIMLSIQMLPRIESKLYTDLIVSKKIFLTPT-VPESIVQETKNRICAMLEEQRIGPELRLQDFDPFIDLINGSDAERVGNFMES-DATFEQYADMVYEYKE--KEDRIAKEVWA--VIRMGFY---EFHRDKFITHLESLCRQLQLDLLARMVTDQQARITRLGKEYDAIAKKALTVPKDTAELMQLKAYVVHAEENLVPEMEARLKVNMSEILWLMDHTLYSPL--EIKNNSNSFQWYL-KLPSIFEQHRAIIAEKVIEYQELLKK----RIELFRRELQNYYEQVQTYDTWGDIKQLSRYKKRAGVLDQRLVQAMETIDQINEEETSYGWDLSQYPMRKKAHDQLKPYKTLFDAGQDFMDKWDLWMHSQVGSFDPDEIDGDVSNFYRIIQKLDKQMGDHPITMQLIQDVKAQIEAFREHMPIINTLGNPGMKARHWELVSEIIGFPIKVSPELTLEKIIEYQLDEYVPKFEAISESATKENNLERAMAKMVNEWEGVEFSISPYRDSGTFKLAAVDDIQILLDDQIIKTQTMKSSPYIKPFEADIIKWEAKLMLLQEILDEWLRVQATWMYLEPIFSSPDIQQQMPEEGRRFSAVDKIWKELMKQVSQDPKVMVVVQIDKMNDKLKKAYSLLEVIQKGLNAYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQIHLKKCFEGIATLNFTEELDVTAMRSSEREEVTLVDVISTSKARGQVEKWLLELEIDMKKSVHHKVSEAFYSYLKMLRHVWVLTWPGQCVQSISLTYWTLEITECFESEEPKENLAKYLQKCVLQINKIVDLVRGDLNTQNRITLGALVVLDVHARDVLAEIVANQVEDLQDFQWLCQLRYYWEDNNLDTRMINCSLPYGYEYLGNTPRLVVTPLTDRCYRTLFAALNLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRGINSGSPTLVFEGTTLTLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALISEIELYSYGFLTAKPLSVKIVATYRLCSEQLSTQCHYDYGMRAVKSVLKAAGALKLRYRDENEDILVLRSIKDVNLPKFLNQDIPLFQGITSDLFPGTVLPEADYVLFNKCTQMACERQN-KQCTPFVLEKVQQLYEMIVVRHGLMLVGYPFGGKTTTYRVLAEALECME---KTDGSENKAIYT-VINPKAITMGQLYGQFDAVSHEWSDGILAVNYRIFAISDSPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSNTTNLVFEPMDLEVASPATVSRCGMIYLEPSSLGWEPLVASWKNTLPAAFHTVSKQLISMLISRFCPILLFILRKSLKEIAPTSDANLMVSLMNFFECFIDDFRDEKYVANVSDLDFRAQT----------------------------------------------EGIFLFSCIWSLGGSLDADSREKFNIIFRALMEKTFPQSLYDTYGVPEDLYVESLAKPFIFPIPKQGSVFDYRYIKEG-------------------KGKWKPWQDDVNSAPPIPRDIPVNQIIIQTNESVRIGAVLDLLNRHGKPIMLVGPTGTGKSVYVIDYMLKKMDLSFYKPLLISFSAQTSANQTQDIIMSKLDKRRKGVFGPPLNSRFVIFVDDVSMPLKENYGAQPPIELLRMMLDHMMWYDRKNIVPMK-LIDLQMIVAMGPPSTG-NTVTPRFQRFFNVISIDDFNNDILNTIFSKIV-LWHLDTRGFSKEFDPCIDEIVGATLTIYNDAKLNLLPTPAKSHYLFNLRDFSRVIQGVLLSVPEATEDVNSMRRLWVHEVLRVYGDRLVEDADRSWLFENICSTVKSCFNTDPSRLFGRLVEKDKSLQESDFRQLIYCDFTNPKADTKNYVEVQDLEELRRVVEAYLVEYNNMSKKPMNLVLFRFAIEHLSRICRIIKQPRSHALLIGVGGSGRQSLTRLASHICDYELFQVEITRLYGPYEYHEDIKAILRKIGASEMHGVFLFTDVQIKDESFLEDISNLLNSGEVPNLFTNEEKIEVQEKMAQIDKQRDKAVQTDGSPVALFNFFVTTCKDQLHIVLAMSPIGDALRNRIRKFPSIVNCCTIDWFQSWPEDALLAVSTRFLASEDLTALER-----RTAIDMCMEFHTSTQELSAKFFSRLHRYNYVTPTSYLELIQTFKALLSQKRNNITNNRNRYLTGISQLDIAAQQVAVMQEQLIALEPKLKEASEIVAEQVAKVTADSKLAEEQREIVKLDESAAKEQAAVAQEIKDECDAKLGEALPILESALAALNTLTTADIAVVKTMKSPPIGVRIVMEAVCILKDVKPDKVPNPSGLGTVEDYWGPSKRVLSD-MKFLDSLLNFDKDNIPVEVMKKLAQRILSNEAFDPDKIKSASTACEGLCRWVIALTKYDVVAKIVAPKKLALAEAEATYNAAMKTLNEKLAMLAKVEANLAAIQKILDEQLRQYGILLAEHEACTKKLQRAQELISGLGGERTRWSETAKMLQASFKSVTGDVLISSGVVSYLGPFTIDFRVDQIRKWVTKCLNFGVTCTAD--FQLAVVLGEPVEIRFWNICGLPTDAFSIESAIMMKNARRWPLMIDPQGQANKWIKNYEKNNKLCVIRLNQADYTRVMENAIQFGLPVLLENIGEELDPVLESVLQKTLFKQGGALCIKLGDSVIEYNHSFRFYMTTKLRNPHYLPEVAVKVTLLNFMITTQGLQDQLLGITVARERPDLEAEKNNLIVQGADNKRMLKETEDQILEVLSSAE-NILEDETAVQILSSAKALANDISEKQVITEATEKQIDIARLSYVPIAEHSTILFFTIVELANIDPMYQYSLVWFVNLYMSSIDNTEKVDDIAARLLDLRNHFTYSLYVNICRSLFERDKLLFSLILNINMMKHDNRIDNAEWMFLLTGGVGLENPYKNPT-TWLGVQNWDELCRLTNLTNFKGLREDF-NENSAQWKPFFDSKSPQDNKDIPKSWDNRVSVFQKLLLLRVFRPDKLVPAVLNFVSGELGERFVDPPQFDLMASFADSHCCVPLIFILTPGSDPTATLLKFAEDQGFGTNRLFSLSLGQGQGPIAMKMIDEGVKMGNWVVLQNCHLAASFMPLLEKICENLLPDATHPDFRLWLTSYPADHFPVVVLQNGIKMTNEPPKGLRSNILRSMISDPISDPEWYESCTQPRIFKQLIYSLCFFHAVIQERRYFGPIGWNIPYEFNETDLRISLMQLRMFLNQYETVNYDALRYLTGECNYGGRVTDDWDRRTLKTILDKFYCPAVIDLETPYYLDETGLY-YVPVFKEVDLYLNFTRDLPQISAPAIFGFHANADIMKDQKETDMLLSHTLLTQDTSASSDDSGGSKALTPEEVVTNVATDILDKLPKLFDRDAALLKYPTLYHQSMNTVLVQEMVRFNVLLNTIRTSLITLRKGIKGLVVMSPAVEAVYKSVLIAKIPAMWAGKSYPSLKPLGSYVTDFLRRLEFLQHWFDHGAPSTFWLSGFFFTQAFLTGAQQNYARKYVISIDLLAFDYEVLTVEEPQRQGLSGPEDGVFVYGIFLEGARWDRTGKYLAESRPRELFDTMPLIWLKPLKRVDLPERHNYLCPMYKTAERRGVLSTTGHSTNFVVAMLLLCNPNTPVSHWIIRGTA 4017          
BLAST of Dynein heavy chain axonemal vs. Ensembl Fly
Match: Dnah3 (gene:FBgn0035581 transcript:FBtr0289982)

HSP 1 Score: 2573.12 bits (6668), Expect = 0.000e+0
Identity = 1484/3614 (41.06%), Postives = 2122/3614 (58.72%), Query Frame = 2
Query: 2246 YIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQA-CEAFKTITRKLYERPNTIEELAELREWI-----LTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSI------IQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQ---ANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKSTYP---TGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWI-----EENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYL---EETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLP------------FPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWM---------ANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVM-CVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAE-LHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVV--KIEP-----------LLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLG--LQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDI----PELEVS--------------EEVIRGLMYMCKE--------------IHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKI-EPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQID-KDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTS--------FSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTED-YIYSQSGIYR-QISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQP------KMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPC--ANRSIP-------PSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            +I +  F ++  +V+  L    + + + I+D   + L  + ++A CE  + ++ K  ERP    E+  L+ +I     + I  + DE + V+ + +    L+   Y  LS+D+ +        P ++   +      + V ++ LE   R R+++   + A  ++    TM    +    D+    E+   V  +    T  +     A   N  E L    V+ +  L+++++  EP   LW    ++ K +   M +    ++++ V + V   +K M+K  +     P  +  A Q+++ IE+F+ ++P++  +   G+  RHW+ +S  LG  + PK   T    +++ +   +  + +IA  AGKEY +   L  M  +W  + FEVL Y+++ T+IL   D+I  LLDDHI+ TQ+M  SP+      +   WE  L   Q++ID W Q Q  W+YLEPIFSSEDI RQ+P+EG+ +  +D++WRKIMK    +  V+       +L    +  + LE V KGL+ YLE KR  F RF+FLS+DELLEILS+TKDP  VQPHLRKCFE I  L F+ ++EI  M S E E++   +   P    G VE W+ E+E +M +S++  + +   +Y  + R  WV+ WPGQVV       WT EV +A+ET++L     K   Q+  L  +VR D+    R+ + ALIV++VH RDVV  +    I NI DF+WISQLRYYW      E+ + +  V  +  YG EYLGN  RLV+TPLTDRCY TL GAL L  GGAP GPAGTGKTET KDL KA A +CVVFNCSD LD+ A+GKFFKGLA +GAWACFDEFNRI++EVLSVVAQQI TIQ+A  +++ +F FE   L L P+C++FITMNPGYAGRTELPDNLK LFR VAMMVPDYA+I EI+L+S GF  AR LS+KIV  +KL SEQLSSQ HYD+GMRAVKSV+ A+ +L+R    + E  I LRAI DVN+PKFL  D+ LF GI  DLFP ++      GD+L  +      + L+    +++K +Q++E  +VRHGLM+VG +  GKT  Y+VL   L ++          F  V   ++NPK+ITMGQLYG FD ++HEW DG+L+   R+ V     ++ W +FDGPVDAVWIEN+NTVLDDNKKLCL SGEI+++ + M MMFE ADL  ASPATVSRCGM+Y+EPS LG     + +I  L + +         L D+Y+   E+  +++     E +P     L  + I    +F   F+                  ++K+             K+FN+A               +  FLF   W++ ++     +K FD  LR+ +       P            FPE+ L  DYRFD                         W  W          +N PE     + + S++IVPT      IS  ++  ISK   M  VGPTGTGK+  I+  L        +   I FSA+T+A   QD I SKLD+RRKGVFGP +GK    F DD+ MP+ + +GSQ P+EL+R W D   W D     +   LVD+  + +MG  GG  N I  RL RH  ++  +  ++ ++  +F TI  +   +   E +  L   L +A + VY       LPTPAKSHY+F+LRD+++VFQG++M+ P+ +   +++ RLW HE+ RVF DRLV+ QDR+    + V    S+     E     +IEP           L YG++M    E K Y E   Y+K+ K+++  L ++N  ++  M+LV+F  A+ HV R++R+++ P GN L++GMGGSGR+S  +LAA++A+     +++SK+Y + +WRDDLK+I+++A       VFLFSD Q  DE ++ED+N ILN+GD+PNLY  +D   I  +M  + + LG  L    + +++ Y  R+R  LH  +  SPIG+ F+ R+R +P+L+NCCTIDW+  WP+EAL  V + F++ +    P  E +              EEV R  + + +E               HQSV + SEK   EL+R NYVTP++YLELL  F   Y RK  E+ + RDR   GL+KL +    V ++Q  L  ++P+L+   EE+      IER++  A++ + VV  +EA A + A   + I+DD + DL EA+PA++ +LE+L  L   DI  V++M  PP GV+L +E VC+++ +KP + + D  G  ++DYW     +L D  KFLDSL  +DKDNI   +I++I E YIA   F P  I+  S AC  IC+WVRAM  Y  VA+ V PK+ AL  +  EL Q  + L   RA+L+ + D++  L +     +R +K LE++ D CE +L RA+KL+GGL  EK RW ++  NL   I+NIVG+VL++ G  AYLG FT EYR ++  +W+A  K   +P ++    +L  T G P+ IR W + GLP D  S+EN +IV  S R+ L IDPQ QAN+WIKN++K N L VIK SD ++++ LE AI FG+P L+ENVGE+LD  L PIL K   K +G + IK GD +I Y+ +FR YITT L NP Y PEV   VT++NF ++  GL +QLL +VVA ERPDL++ K QLI+ +A+ R  L  IE KIL  LS +EG+ ++D + I  L +SK+ S +I+ K +IA  TE +ID  R +YIPV+  + ILFFC+++LA +DPMYQYSL WFLN+F N I  A K+D L+ER+ N+N+YFT S+Y+NVCRSLFEK KL+ S ++   IL  +G+++ A   F L GG       PNP   W+ D+ W  +   A L      P + +  Y +++   +D+  P + +LP     + D +  L+V++ LR DK+  A++ F+   L   F+EP   DL   + DSSP  PL+F+LS G+DP + L+ FA       KL  ISLGQGQGPRAE++I  A   G+WV  QNCH+A SWM  LER+       D  + D+RLW TS PS  FPV +LQN  KMT EPP+G++AN+ +S+TS        F++ FL S + N  W   + +L  FH V+ ER++FGPLG+NIPYEF + DL+I + QL MF+ +   +PF+   Y  G  NYGGRVTDD DRR ++++L+  YNP  + ED Y  SQSG YR  +SP   ++  + Y+ S P++  PE++GLH+NA+I   + ETN L+  +L  Q       K S++GG ++E+    + K++L+ +PE FNI+++SK YPV+Y  SMNTVL QE+IR+NRLL+ I+ SL ++ KA+ G + M   LE    S+   K+P +W  K+YPSLKPL S+V DL  R+ F Q WIDNG P V+WISGF+F Q+F+TG LQN++RK    ID I   F V  K   ++   P  G YIRG+F+EGARW+    ++ ES  K LF  +PVI+L P   A   +P       P  IYDCPVYKT  R G LSTTGHSTNFV  +++   +   HWI RG A
Sbjct:  865 FIPLNLFMLDNRHVKLSLRMYVREIYDFIIDFY-KALNWNENRAICEELEEMSMKAGERPEETPEVVALQNYINDCREMRIFAIKDEIKNVLKRVVF---LLTHTY--LSSDELHLNSRTFILPGELEEVLDLSAARLAVVRDNLELALRERRMEFEKLLAQEKR----TMDGFRIREIRDVLTLEELKERVDTVDLLFTTIENLSREAKAINTEETLLQIDVSAFPLLAEIIEKMEPIEKLWKTSYEFEKDYLIWMFERFECLNADGVREQVENMHKIMYKLSRQLAYNPVAKRAAEQMRMKIEKFRVYLPVLDSICRHGLEKRHWDQISKILGRKVNPKLFPTLKDMIDVDIMSILPQLEEIANAAGKEYDLNNGLRIMQADWRDVMFEVLQYRDSDTHILASLDDIQTLLDDHIMRTQAMKRSPFITALGSKADDWEARLLLIQNIIDAWTQVQITWMYLEPIFSSEDIMRQMPLEGRNFKAVDKLWRKIMKHTLKDRHVMAATEYPEMLEVFTKAIEDLETVTKGLNTYLEQKRLFFARFFFLSNDELLEILSETKDPMRVQPHLRKCFEGIGSLTFDDNMEIVEMVSDEEERVALVRKINPQLANGLVEMWLKEVEMVMLDSVKEQMREAWEDYAMVERISWVVSWPGQVVQGISCMAWTYEVEEAIETKELPAYLEKSNLQIADLVQLVRTDLQAGVRIAVEALIVLDVHDRDVVKYLTDCRITNIQDFDWISQLRYYWKVNEKNEDWVCVSMVVTDVEYGMEYLGNLPRLVVTPLTDRCYRTLMGALKLCLGGAPEGPAGTGKTETCKDLAKAVAKKCVVFNCSDGLDYKALGKFFKGLAQSGAWACFDEFNRIELEVLSVVAQQILTIQRAIGRKVVKFFFEDTMLKLDPTCSIFITMNPGYAGRTELPDNLKVLFRTVAMMVPDYAMIGEITLYSNGFDMARNLSQKIVQAYKLCSEQLSSQSHYDYGMRAVKSVLLASASLRRLYVDLPEPEIVLRAIVDVNLPKFLEQDISLFIGIYMDLFPGVELPMPQRGDILKWLHINLADRNLQATPWYLEKILQIYEMLLVRHGLMIVGGSMGGKTTAYQVLAQTLRNVSTDEEATLKEF-PVTFRIINPKAITMGQLYGRFDPVSHEWYDGVLAKTFREQVQGPKGERAWVMFDGPVDAVWIENLNTVLDDNKKLCLMSGEIMQMTKLMNMMFEPADLEQASPATVSRCGMIYMEPSQLGWRALHKSFINVLVNKV--------GLGDIYMTLFEDMTEWLVPAALEFLPQCKQMLELSPIYQYQTFSRFFL----------------HFLEKH-------------KQFNQA-------------WFQQMFLFCFAWAYCSALTGQGQKTFDALLRKVIYGSNENFPKPKYFSLNRGQMFPEKLLFLDYRFDEAEN---------------------WWTWQKSDDSASTTSNFPE-----NAQISELIVPT-KETGYISYWQEFCISKSYAMLVVGPTGTGKSAIITSNLLAMPKFANLVNVINFSARTSAQMVQDTIMSKLDRRRKGVFGPSLGKKCTVFCDDVAMPSKDTYGSQAPLELLRTWLDHGYWSDLVDTTKI-ELVDMTLMCAMGTLGGS-NFIFPRLYRHMFVVAVDSFEDSTIVRIFTTIGDWHFSKGYPEKVALLSRGLSEAMVSVYRDAIRSFLPTPAKSHYSFSLRDITRVFQGIVMVPPKRMPDPEKLGRLWAHETYRVFYDRLVDQQDRDRLLVMAVDACKSNLRFPLEQAFGERIEPGEKLTDNDLRNLFYGNYMEPDAEPKFYDEGDTYEKLEKLMKYYLREYNSFSSTPMDLVMFRFAIEHVSRVSRVLQMPRGNILMVGMGGSGRRSSARLAAYIADCRLMTVQVSKSYTITDWRDDLKKILMSASFNLNHTVFLFSDAQATDEGYVEDINGILNTGDLPNLYQLEDKATIMENMANVAKQLGKILDTLPSEVYAYYIDRIREQLHIALAFSPIGDSFKERIRVYPSLINCCTIDWYMPWPEEALSRVGVYFVSSMNLNRPHGEETQEPVQSKDAADPDEEEVRRETVGVEREQTQLEADLVDCVMYFHQSVVDASEKCYLELNRRNYVTPSAYLELLKAFRTFYTRKLDEITRLRDRYTTGLEKLDFAAGQVGEMQTNLYDLQPKLKVLSEETDRIMVNIERETAEAEKKKEVVGADEAAANEAAAAAQAIKDDCETDLAEAIPAMEAALEALNTLKPADIFIVKSMKNPPYGVKLTMEAVCVIRGIKPDR-KPDPSGHMVEDYWGPSMRMLSD-MKFLDSLKTFDKDNIPPPIIKRIREKYIADRDFVPEKIKAASMACEGICRWVRAMDVYDKVARIVMPKKAALAEAEGELSQQMEKLNAKRAELQVILDKLQKLNDFFAEKSREKKRLEDEIDNCEKKLNRAEKLLGGLGGEKTRWSEAAKNLHESISNIVGDVLLAGGCTAYLGYFTTEYRVNILDDWNALCKRKHIPSSE--TFSLATTLGHPMTIRAWSLAGLPADNFSVENGIIVTNSSRYSLLIDPQVQANKWIKNMEKNNNLKVIKQSDANYMQVLELAITFGQPVLIENVGEKLDSNLTPILEKNVIKHKGGLFIKSGDQMIEYNPNFRLYITTCLRNPRYPPEVMVMVTVLNFMITEQGLREQLLAIVVAHERPDLQEKKEQLIIESARNRDALYTIESKILEVLSTSEGNVLEDENAINILSSSKILSEDIQEKQVIAVATEIEIDAARQQYIPVSKHSAILFFCISELANVDPMYQYSLSWFLNLFVNTILKAPKSDQLSERLKNLNDYFTKSIYTNVCRSLFEKDKLVISLVMCLGILVSQGRVEKAALLFFLTGGIGYKTIPPNPLGAWLPDKSWASVCKAADLEGLKNLP-QMMETYSDEWHNFYDASNPDQLQLPAPHNTVNDMY-FLIVIKSLRPDKLVPAVRAFITRNLDRSFVEPPPFDLAASFADSSPKIPLVFLLSAGSDPMASLFMFAKQRNMYDKLKTISLGQGQGPRAEKMIMEAARHGQWVVLQNCHVAISWMGDLERICNDTTLTDGANHDYRLWCTSYPSAVFPVSVLQNSVKMTNEPPKGLRANMHRSFTSDPLMRDKFFTNAFLFSDSANKCWLRGVFALVFFHAVVQERREFGPLGWNIPYEFNESDLKISLLQLKMFINQSQSIPFRGHVYLTGECNYGGRVTDDKDRRLILSLLNMIYNPNTIEEDNYALSQSGTYRVPLSPTRLNS--IEYVSSFPLSPHPEVYGLHENADINRNVKETNALISGVLLTQTDLMASVKASSSGG-AKEDPAIAICKQVLKQLPEEFNIDEVSKTYPVIYTNSMNTVLRQELIRFNRLLSYIRKSLVNVGKAVVGQIAMIPELERTHASMVIGKLPADWLKKSYPSLKPLGSYVSDLLARLAFFQEWIDNGEPMVYWISGFYFTQSFITGVLQNYSRKNRFQIDMILIEFAV-TKFEVQVPGTPDIGAYIRGIFIEGARWNRKTKEVDESFSKVLFDTLPVIYLRPVLKALEDLPRSTAGGEPETIYDCPVYKTSERRGVLSTTGHSTNFVMYLQLRCSRKPMHWINRGTA 4378          
BLAST of Dynein heavy chain axonemal vs. Ensembl Fly
Match: Dhc62B (gene:FBgn0013811 transcript:FBtr0303106)

HSP 1 Score: 2449.47 bits (6347), Expect = 0.000e+0
Identity = 1395/3578 (38.99%), Postives = 2070/3578 (57.85%), Query Frame = 2
Query: 2270 INTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIP-DMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIR----MSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANE---VRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMND-PLIAVDSEVVEKSVTEFYKTMHKS-----VKIFNEL--------------------PSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVF---EKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKG-------LYVKLLEQLDGLRAVVRG-DMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMST---------QLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMK--YSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPE-YISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAV--AELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVK----------------IEPLLYGDFM---SVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQ--DLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDI--PELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKI-EPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTS--FSD-DFLNSIAK-NTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPL-TDHTGYMAYI-RSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKL---QPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGF---KVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            I+ E    GL    + + + I  ++ RE  K+    C+ F+ I  +  E P + EEL E  E+++ +  D + E  + I  CL     I E    +S   F+     + W   I      +  Q EQ     EE  +++    +   N  +D L   +  +   +D+++  +  +    ++    QL          N  E+LF   +T Y KL  +     PF  L     +W + + SV ND P   ++ + VE++  ++ K   K+     VKI  +L                    P    +   +  +I++F   + ++  + NP +R RHW+ +S+  G  + P +  T  K L   L   ++    I+  A KE  +  AL  M  EWE   F    YK TG  IL   D+I  LLDDHI+ T  M  S + KP EE +  W   +    + +D+W + Q  +LYL PIFSS+DI  Q+P EG+ +  +++ + + M      P V+   P + LL +L++ N+LLE +  G+S YLE KR  FPRF+FL++DE+LEILS+TKDP  V PHL KCFE I  L+F+    + AM S + E I F     +    G+VE+W++ +E+ M +++R        +Y ++ R EWVL+WP   V+A  Q YW   V   L  R   G        + +L ++L+ +  +VR   ++ + R+T+ +LIVI+VHA+DV  ++I   + +  DF+W++Q+RYYW ++   +R +NA  P+  EYLGN+ RLVITPLTDRCY TL GA  L   GAP GPAGTGKTETTKDL KA A+QC VFNCSD LD+ AMGKFFKGLAS GAWACFDEFNRI++EVLSVVAQQI  I +A +    +FMFEG EL L P+C V ITMNPGYAGR+ELPDNLK LFR VAMMVPDYA+I EISL+S+GF DAR L+ KIVTT++L SEQLSSQ+HYD+GMRAVK+V+SA GN+K+Q     E+++ LR++ DVN+PKFL  D+ LF GI+SD+FP IK   IDY  +    +    ++ L+    F+ K IQ +E  +VRHG MLVG   +GK+K  +VL   LS+LK +     + FQ V   ++NPKSITM QLYG FD +++EWTDG+++ + R       PD++W IFDGPVDAVWIENMNTVLDDNKKLCL+SGE+I +  EM+M+FEV DLA ASPATVSRCGM+Y+EPS LG   F + W++   D  +              EE V ++   ++ ++P      TF + +    FI P                 E        +L        M+     ++ P++    +    ++  LF+LIW  G   DT SR+KFD +L++   T         ++   P P EGL+ DY F +                   +++  W +W    P+   + D++   + +IVPT+D  R I + +  +  KK ++ VGPTGTGKT+ + + L   +  E + + FI F+   +ANQ QDL+ SKL K ++G++GPP G   + F+DD+NMP  EV+G+QPP+EL+RQ+ D+   YD K   +   + ++  + + G PGG R  +  R + HFN+   N   +DSM  +F  +      RA    ++  +   +V A   +Y ++QS++  TP+KSHY FNLRD+S+V  G  ++  ES++     +R+W+HE+ RVF DRLV+D DR+W  + L   L ++F  K E V +                   +L+G +    SV  E ++Y E    +  L +   +L+D+N     KM++ LF  A++H+ RI RII     +AL++G+GGSGRQSLTKLA +M +   FQ E++KNYG  +W DD+K I+  AG  NK   FL ++ QIK E FL+D++ +LN G+VPN++  D+ + +   ++   Q  +  +  +   +FS +  R +  LH +++ SPIG+  R R+R +P+LVNCCTIDW+  WP+EAL+ +A   L D+  P    SE++   +M  C+  H + +  +  + Q   R+ Y T  S++EL+  F  +  RK+ E   A+ R   GLD L      +  +Q +L  ++P+L    E S+    EI +++  A      V R+E VA+ +A+  ++++ D +RDL +A+P L+++L +L  L   DIT V++M  PP  ++LV+  VC++K + P++I     G  + DYW   K LL +   FL  L  +DKDNI   ++++I + +I ++ F P  + K S A   +CQW+ AM  Y  VAK VAPK+  L  + KE   T + L + RA   A+E+++  L  +L+      ++ E  ++ C  +L RA+ LIGGL  EK RW  +  +L+ L +++ G+VLIS G +AYL     +YR+    +W   +    +P +     ++ D  G  V I+NWQ+DGLP D  S ENA+I   S R+ LFIDPQ QAN W+KN++++N L+ +K +  ++++ +  A+ +G P ++ENV EEL+  L+PIL++QTF Q G   I LG++++P + +FR Y+T  L NPH+ PE   KVT++NF L+ + L DQLL +VVA+ERPDL++ +  L    A  +  L++ E+ IL  LS A G  +++   IQ L  SK  S +I  K   A++T   I+  R  Y PVAV + IL++ + DL  IDPMYQ+SL W++N++   I  A K+  L  RI  + + FT +LY+NVCRS+FEK KLL+SF+L  RIL   G++++  +  L+          PNP P WI++ VW  +L L  L       + F   +L+ ++ I+D   P ++ LP  W D    F+ ++VL+ LR D V  A++ F+A  +G++++ P   D++  Y DS+  TPL+F+LSPG DP   L  FA+ M   +   +ISLGQGQGP A  LIKNA E G WV  QNCHLA SWMP LE L E +D      +FR+WLT+ P+P+FPV ILQNG KMT EPP G+K NL++SY S   +D +F    AK +  +  LL  +C FH V+ ER+K+GPLG+NI Y F + DL+I + QL M L +Y  VP+  + Y     NYGGRVTD+WDRR ++ +L+ F N Q +T++  Y  +   R I P  T+H   + Y+  +LP    PE++GLH N+ IT  +  T  LLD ++ L   +   S   G S E+++ +  K+I + MP   +IE  +++YPV Y +SMNTV++QE+ R+ +L   I+++ RDL   I+G++VM+  LE++  ++  N++P  W SK+YP LKPL S+V DL++R+ ++  W  +G PP FW+SGFFF QAFLTG +QNFARK  I IDT++F +   KV  K  P     P DG Y  GL+LEGARW+  +  L E  PK L   MPVI+  P     +     Y CP+YKT  R GTLSTTGHSTN+V  + + T     HW+KR VA
Sbjct:  470 IHNEPAIFGLRTLAENLIHEITTIIIREHIKAEVDICDEFEKIKYRALEIPKSTEELLESAEYMIHVKKDKIAELTDRIQYCLQVGTNIVELT-EMSKYHFDLTIKTINWIKDINDICDYNASQQEQFKFTFEEHLQEV----IKKLNSDIDEL---LPKLTVIDDMSRPDKFRDSYIILQNFIDQLKTFDDYVAWINKEEKLFKVALTEYPKLDIIKTFVYPFAELMKCCIEWQR-YLSVWNDGPFEYLEPQFVERTTDDYLKEFQKNQKYYRVKIKQDLIDNPVCKFKGQTEDPDPAKHPVPLRLCTSMIQSIKDFTTGVFIVNTMCNPALRKRHWKEMSEIAGFDVTPDAGTTLRKILNSGLDPILDQFEIISIGANKELQLWNALQAMIKEWETRVFPYGPYKETGVQILSSLDDIQALLDDHILKTLVMRGSAFMKPCEEEVRAWYEKIMRVNETLDQWGKVQANYLYLLPIFSSKDIVAQMPEEGRLFVIVEQTYTRNMGLVLRQPLVMETAPVSGLLESLQKANELLEDIATGVSNYLEKKRLYFPRFFFLANDEMLEILSETKDPLRVLPHLSKCFEGINSLEFDAAKNVLAMISSDKETIEFIEQVSTAAAGGSVEKWLIGVEDEMLKAVRYQNELSFAHYPKVKRHEWVLEWPQMTVLAISQVYWASRVHGCLR-RTFGGNMTIMMNFFQELSKELNDIVTLVRSPKISNLNRITIKSLIVIDVHAKDVSEDLIKNKVSSEFDFQWLAQMRYYWEDDKTWVRIINATVPFANEYLGNSDRLVITPLTDRCYRTLVGAYQLHLNGAPEGPAGTGKTETTKDLAKALAVQCKVFNCSDGLDYKAMGKFFKGLASCGAWACFDEFNRIELEVLSVVAQQILLIIQAVRSNATKFMFEGTELTLNPACYVCITMNPGYAGRSELPDNLKVLFRSVAMMVPDYAMIGEISLYSYGFVDARKLAVKIVTTYRLCSEQLSSQNHYDYGMRAVKTVLSACGNIKKQYPDEVEDILLLRSLIDVNLPKFLSFDVPLFEGIISDIFPGIKLPHIDYSLVESEFKRVCLEEVLEPAPSFLLKVIQTYEMIIVRHGFMLVGEPLAGKSKTLQVLAKVLSALKIKAPQKSNYFQHVQMGIMNPKSITMNQLYGSFDPISYEWTDGLVAKIFRDFAMTPTPDRKWVIFDGPVDAVWIENMNTVLDDNKKLCLTSGEVITMSNEMSMVFEVMDLAQASPATVSRCGMIYMEPSTLGWRAFAKSWLKK-ADPRWAD------------EEGVPYVMALMQWLLPPCQ---TF-VRRFCSQFIKP----------------GEFNCMLTTFDL------FDMQIAEAIEENPEDYQKYLQTYFQAAILFALIWGVGGVLDTASREKFDVFLKKLWDTDPPPPEPLGKMEITP-PTEGLLVDYVFLY-------------------KQRGAWRYW----PDLAKRMDVEETKTGVIVPTVDTARYIHLLKMHVEHKKRMLLVGPTGTGKTVYVQNYLMNKLDKEVFETGFITFTVMISANQCQDLLISKLQKWKRGIYGPPKGMQSVLFVDDMNMPVKEVYGAQPPLELLRQFFDYGHVYDLKDSSKVY-IHNVLIMAACGLPGGSRQDVYARFLNHFNVYSINTFSDDSMFRIFLNVALNGFRRAGHGQDVFVVTNQIVSATQSIYKSVQSEIRATPSKSHYIFNLRDISRVVTGCTLVRKESVSDKKIFVRVWYHEAMRVFYDRLVDDVDRKWMFDKLNECLKANFKDKVETVFERYCVQGPDEAVFTMEAASNILFGVYFDEDSVPDE-RRYEEVPSVEVFLNLALTSLDDYNSTRRNKMDITLFTFALQHLNRICRIISIQGASALIIGLGGSGRQSLTKLATNMVQTSFFQPEITKNYGANDWHDDIKAILKEAGGMNKHTTFLITENQIKMELFLQDIDCLLNQGEVPNIFPIDEKQEVLEMVRLAAQGGNRNIDVSALQVFSFFVDRCKQKLHMILSFSPIGDALRTRVRLYPSLVNCCTIDWYDSWPEEALQMIAKMSLVDVNVP----SEDIKLAIMDTCQYFHTTAARSTRAFCQMTGRHIYQTNASFIELIRSFQTLIERKQSETMLAKMRYIGGLDTLAQAAAAISIMQRDLNALQPKLVALAESSRKMMLEINKETLAASAAAEQVKRDEEVASVQAEAAQVLKQDCERDLAKAIPVLEDALAALNTLKPADITLVKSMKNPPPVIKLVMAAVCVIKGIPPERIPDPASGKMVQDYWGPSKRLLGE-MNFLPGLKEFDKDNIPTEIVKRIHKEFIPNKDFDPKVVAKASSAAKGLCQWIIAMMMYDEVAKVVAPKKAKLAGAEKEYADTMEFLAQKRALALALEEKVALLNIELDKANAEMQKTEEHAESCRNKLLRAEALIGGLGGEKSRWNKAAEDLQELYDHLPGDVLISCGIIAYLSAVNLQYRSECVKDWFKKVTDLKIPCSSH--YSITDVLGLEVTIQNWQLDGLPNDEFSSENAIISANSSRYSLFIDPQAQANNWLKNMERKNRLNCVKFNQSNYMKVIAEALEYGTPVIIENVQEELEVPLDPILMRQTFVQGGIKHISLGESVVPVNPNFRLYMTCNLRNPHFLPETFNKVTVINFALTQNALMDQLLSIVVAKERPDLQELRITLTTEAAANKGALRDAENMILKTLS-AGGDILENEAAIQILADSKGLSKDIVEKQEAAKETVAKIEAFRLNYKPVAVHSSILYYSITDLPNIDPMYQFSLNWYINLYMYSIETANKSKDLPRRIKFLVDGFTRNLYNNVCRSIFEKDKLLYSFILTARILLGTGQVEMRHFAHLVTNAKESTNIPPNPDPTWITETVWLNVLRLEELKELRGIVDHF-KSHLHAWQAIYDHSSPEKQPLPPPWQDKTTAFEKIIVLKALRPDSVFLAVRLFIAESIGDQYVTPPEFDISKSYADSTALTPLVFILSPGADPLGSLLAFAEKMGQEETFQSISLGQGQGPIATALIKNAQEMGYWVCLQNCHLAASWMPYLEYLWENMDTFNTTPNFRIWLTAYPTPQFPVTILQNGVKMTNEPPTGLKENLMRSYNSEPINDYEFYTGCAKQDRAFTRLLYGICFFHAVVQERRKYGPLGWNIAYGFNESDLQISVLQLSMLLNQYDHVPYDAISYLTSECNYGGRVTDNWDRRLIVTILADFCNAQAVTDNR-YRFASDDRYILPRKTEHREILRYLDENLPSLAPPEVYGLHANSGITRDLQTTKTLLDSMILLLGSEAAGSAGAGVSVEQVILDTIKQIEREMPADMDIEAAAEKYPVDYNESMNTVVVQEMERFLKLQKEIRTTCRDLAMGIKGIIVMTPDLENVMTAMKFNRIPTKWMSKSYPCLKPLGSYVQDLYKRLNWLHDWHHHGKPPTFWLSGFFFTQAFLTGAMQNFARKYKIPIDTLTFDYDVLKVETKTSP-----PDDGVYCNGLYLEGARWEWRENTLVEQFPKVLIYAMPVIFFRPVGLVDVVEGSRYRCPLYKTAERKGTLSTTGHSTNYVVPLLLNTHVKASHWVKRSVA 3957          
BLAST of Dynein heavy chain axonemal vs. Ensembl Fly
Match: Dhc16F (gene:FBgn0283476 transcript:FBtr0074509)

HSP 1 Score: 2326.21 bits (6027), Expect = 0.000e+0
Identity = 1359/3599 (37.76%), Postives = 2060/3599 (57.24%), Query Frame = 2
Query: 2183 IKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQAC-----EAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIK-LHDSVMND-------PLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHI---EIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNT-GTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDL----------EITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRD---------LKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKI--RAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLR---PLKMKKFNK------ADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLYGDFMSVAIENKK--YVEFVEYDKMLKVIEENLEDFNQINTAK-MNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQ--ATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDI-PELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLAS--LPAFSKFPEEFIHKY---LNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTA-DLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKD--KVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYT--DVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSRE-EIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQ----SMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVM-------------------VKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            ++   +++ N    L+ ++ +Y+ +G   +   N +  +      + + + ++LA  L K A++       EA     R  YE   T+E +A +R ++      LD   + ID       +I++F   + +D          + ++ R ++ ++ +   +   R       D+AA  E +  + +        +  +    V N++  + ++L + +  A  F   ++ F   +T Y++++    D    +NL+   SDW + L + +++D        ++ ++S+ + K+  +F K + ++    N +P +Q+ A       E FK  +P+I  LRNP +RARHW  + D L      +  +      ++   D +   E + +I+  A  E  +E  L  +   W+  +  ++ + +    +IL  ++E+  +LDD  V   ++  S +  P + ++ +W   +       + W+ CQ  W+YLE IF+S DI RQLP E K + T+D+ +++ ++ A      +       +   L E N+LL+ + +GL  YLE KR  FPRFYFLS+DELLEIL+QT+ P AVQPHLRKCF+ I +L+F              +I A  S EGEK+ F K     G VEEW+ ++E  M  S +  +  G   Y    R +W    P QVV+   Q  W  ++    E ++         +    +K L+ L  L A+ R +++ + R  L ALI I+VHA+D V  +I + +   +DF W+  LR+YW +E   +  R   A  PY YEYLG    LV+TPLTDRCYL L GA  +  GGAPAGPAGTGKTETTKDL KA A QCVVFNCSD LD+  MG+FF GLA  GAW CFDEFNRIDIEVLSV+AQQ+ TI+ A+  R+ RF+FEG E+ +  SC VFITMNPGYAGRTELPDNLKALFRP++MMVPDYALI+E+ L+S GF D + L++K+V  ++L S+QLS Q+HYDFGMRAVKSV+  AG LKR +    E++  + A++D N+PKFL DD  LF GI+SDLFP ++     +  L  S++   R+K L+ V   + KC+QL+ET  VR G+MLVGPTG GK+     L+ ALS L +    D + F+ V    +NPK++TM +LYG  DL T EW DG+L   +R   T      +W + DGPVDAVWIEN+NTVLDDNK LCL++ E IKL   + M+FEV DL  ASPATVSRCGMVY++P  LG       WI                L D + E  VD M+H L    P    +  + +      F+  F  + L IE K       R +   +Q L + +R    L   +F        +++   E+V KI       F ++++W+  ++     +  F+    + ++ Q   +  P   L ++YR D                      K+ W  W+  + +++  P+  Y D+ VPT+D  +   +S+ L     PVM  G TG GKT+     + +      I   + FSA+T++N+TQ++I+  L+KR+K   G P+GK +I FIDD+NMP L+ +G+ P IEL+RQ+ DFKG+YDR+ +  ++ ++D+    +  PPGGGRNP+T R +RHF L    +  E+++  +F  IL+ ++    + +  L E +V AC+DVYM + + MLPTP KSHY FNLRDLSK  QG+L          +Q+LRL++HE+ RVF DRL+N +D+  FK L+       FN+   +  +  P+L+GDFM       +  Y E  ++ K+  V+ + + D+N +   K M L+LF DA+ H  R+AR++R   GN LL+G+ G G+QSLT+LA+H+ EY+C+QIE+ +NY +  + +DL+ +   AG++N+P+ FL  D+QI +E FLED+NNILNSG+VPNL+  D+ E+I  D +    +       T+ +++  +  RVR NLH V++MSP+G+ FR R R FP+LVNC TIDWF+ WP EAL SVAL  L  I P++E    +    ++M    H++V + S K+ +E+ R+ Y TP+SYLELL ++  +   K  E+   R R  NGL+KLL T E++  + +ELE+M PQL++     K+  + + ++++ A   +  V  +E  A +KA   + I +DA +DL+ A+PAL+E+ E+LK L K DI E+++   PP  V+  +E VCI+  VKP               W + K ++ D   F+  LF YDK+++ +  ++K++ YI  + F PA  EKVS+   S+  WV +M K+  V K V PK +  E +  EL++   +L++ + +L AVE +I GL++ LE   R  + +++  DL   R+ RA +L   LS+E++RW+++V +L   +  + G+VL++A  VAYLG F+ EYR  M   W +  + + +P +  P  NL+   GDP ++R W +DGLPKD +SIEN +    + RW L IDPQ QANRWI+N+++ N L VIK++D   +R LENA+R G P L+E + E +DP+L PIL ++T++ +G   +KLGD +I Y D+F+ Y+TTKLPNPHY PEV   VT+VNF ++ SGLEDQLL  +VA E P +E  +N L+V     +Q+L  +EDK+L  L  +EG+ +DD +L++TL  +K  S  I A++I  E+TE+ I  +R RY  +A R  IL+F VA LA+IDPMYQYSL++F  +F N +       ++  RI  +      +++ N+ R LFE HK++FSFLLA  + + EG++   E+ FL  G     +    PA   +S   W+  + L       FS   +E    +   + + K +FD  + ++     +W      F  L+ +   R  +    +  ++   +G+ F E      L+ VY D+S  TPLIFVLS G+DP S   KF   M+F+ K  +ISLGQGQGP AE LI+ ++  G WVF QNCHLA S+M +LE +V  +     K H DFRL+L+SMP   FP+ +LQN  K+T EPP+GIKAN+  + T    DF     +N  WR ++  LC+FH VL+ER+KFGPLG+NI YEF++ D    +  L  F+      ++P++ + Y  G I +GGRVTD WD RC+  +L+ F + +++  DY Y +   Y +       T Y AY++  P+ + PEIFG++ NANI F   ET   ++ LL  QP+ +   G++ E EI ++    I + +      E I     V+  +    S+  VL+QE+ R+N  L II  SL +L KAI+GLVVMSE LE++  +L  N+VP +WA +++ S+KPL S++ D  +RI FIQ W +NG P  +WISGFFFPQ+FLTG LQ +AR++++ ID++   F V                     K +  + E       + G+F+E ARWD+ K  L ++   ELF+ MPV+   PC    I P+  Y+ P+YKT  R+G LSTTGHSTNF+ ++ + +  D + WI RG A
Sbjct:  590 LRAYCDRYCNNVRALDGIL-EYVFLGLLKLTQTNFKDTVT----PVCSRLQNVLATYLPKLAEEETTRLYEEAQDFHGRICYEPHETLEIVAHIR-FLDKCSTELDGIFDGIDYVHDLLLIIKDFGIPIDDDSKEDYMDTEDYLNRTRETLEEIREKRQDFINRLEDAMQDDIAALKEDIHEVAIEALQPWLLDANSNRLSVTNKLDSMLERLNKCRETADEFLGYQKEFQIDLTMYDEMASGFYDIRMRQNLYRTWSDWEESLAEWIVSDFNTLNVVDMVELNSKTI-KNCMQFQKYLPEN----NIVPVLQKSA-------EAFKEKLPVIGYLRNPNLRARHWAEIEDLLNRKFFQEKDILIQTYEDVHAFDDVAIGEALMQISSQATGEVQLENMLKGIETTWKETELSIVPHHDAKDVFILAGTEELQAVLDDSNVNINTIAASKFVGPIKSKVDEWINAMDQFAKTFESWMDCQGAWIYLEAIFASADIQRQLPHEAKMFFTVDKSFKETVRQAKKVALALPTMSSVDVHKVLVENNRLLDLISRGLEAYLEVKRVVFPRFYFLSNDELLEILAQTRIPQAVQPHLRKCFDAIYRLEFGSKEGGDGKMVATNDIVAFLSPEGEKLQFGKGLKARGAVEEWLSKVEEAMFVSCKRYMRFGYQCYPAKEREDWFQDHPNQVVLTVSQVQWAADIHRIYEGKERNPLNILEKMAKFEIKCLKDLGALAALTRKNISSLLRKILCALITIDVHAKDSVRMLIEKEVCKASDFNWLKMLRFYWADETETVYSRMAAANIPYYYEYLGAGGVLVLTPLTDRCYLCLMGAFQMDLGGAPAGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKMMGRFFSGLAQCGAWCCFDEFNRIDIEVLSVIAQQLITIRTAKAMRVKRFIFEGREIKINRSCCVFITMNPGYAGRTELPDNLKALFRPISMMVPDYALISEVILYSEGFEDPKILARKMVQMYQLCSQQLSQQNHYDFGMRAVKSVLVMAGALKRASPNQREDITLIAALRDSNIPKFLADDAVLFRGILSDLFPGVELPDSQHPHLEASLRLGLRQKNLQAVPTTIRKCLQLYETMCVRWGVMLVGPTGGGKSVVLHALEFALSHLFENEVQDPN-FRPVVIQTMNPKAVTMNELYGYVDLKTLEWQDGLLGLAVRTATTVEDEIHQWIMCDGPVDAVWIENLNTVLDDNKMLCLANSERIKLTAWIHMLFEVQDLLQASPATVSRCGMVYVDPGDLG-------WI---------------PLIDTWRE--VD-MKHKL----PAPLAEFCYQL------FVGYFDKA-LKIERK-------RAVYTIHQVLGSKVRLCCELNSAQFEAVKWSAMSEEQGKELVTKI-------FAWAVLWAIASNLKDAEKVSFEEQWSKAIA-QHPNMTLPNFTL-WNYRID--------------------LEKMDWGSWIDIMAKFVFDPETSYYDMQVPTVDTTKYGYVSDLLFKRGMPVMVTGDTGVGKTVLAISCMKRLSQGNVIPVILNFSAQTSSNRTQEMIEGPLEKRKKTQLGAPVGKTVIVFIDDVNMPKLDTYGASPAIELLRQFLDFKGFYDREKL-YWKEILDVVLGCACAPPGGGRNPLTPRFVRHFALFSLPKPNEETLTQIFNGILRGFLQTFSSAVRALSEPMVNACVDVYMRVATVMLPTPDKSHYIFNLRDLSKCIQGILQASNLHYNQENQILRLFYHETTRVFHDRLINIEDKNIFKALMKEVCMDHFNRPVINDNE-PPILFGDFMVFGKPKNERIYDEIRDHTKLESVLNDYIADYNSVAVGKQMKLILFQDAMEHTVRLARLLRSDRGNGLLVGVAGMGKQSLTRLASHVNEYNCWQIEMRRNYDLNAFHEDLRVLYRIAGIDNQPVTFLLIDSQIVEEEFLEDINNILNSGEVPNLFEGDEFEKIILDARDGCNENRKDDPCTRDDIYKFFINRVRNNLHVVMSMSPVGDAFRRRCRMFPSLVNCTTIDWFTSWPTEALYSVALGLLTKIAPKMEDRISLASTTVFM----HKTVEDASVKFYKEMKRHYYTTPSSYLELLKLYQNLLKIKNMEIIAKRKRIANGLNKLLETNEVIAVMGKELEVMVPQLDEKSAMMKSLVDNLTKETKQADAVKQSVLEDEMNAKEKAAVAQAISEDAGKDLEIAMPALREAEEALKGLTKADINELKSFTTPPALVQFCMEAVCILLGVKPT--------------WASAKAIMADIN-FIKRLFEYDKEHMKEDTLKKVKKYIDHKDFVPAKFEKVSKVAKSMSMWVISMDKFSKVYKVVEPKIKRKEAAEAELKEVMTVLRQKQKELAAVEAKIQGLRDSLEEKQREFQVIQDNVDLTYGRINRAGRLTSALSDEQVRWRETVKSLTGDLACVPGDVLVAAACVAYLGAFSHEYRRDMSALWVSKCREHKIPSS--PEFNLLKVLGDPYEMRQWNVDGLPKDNISIENGIYATRALRWALMIDPQEQANRWIRNMERANNLQVIKMTDSTMMRVLENAVRQGYPVLLEEINETIDPSLRPILQRETYRFEGRTYLKLGDMVIDYDDNFKLYMTTKLPNPHYLPEVCINVTLVNFLVTESGLEDQLLADIVAIELPAMEIQRNDLVVKINSDKQQLLALEDKVLKLLFNSEGNILDDEELVETLNDAKETSLIIAARLIDTEETEKVITASRERYRILASRGAILYFVVAGLAEIDPMYQYSLKYFTQVFCNVLRLDHPPQSVEVRISTLMTDELRAIFDNISRGLFENHKIIFSFLLALSVERQEGRVTEEEFLFLSRGPVGNIRTKIQPAKIKMSQIEWDSCIFLEDNFSSFFSGLTDELDKPFFIQMQENKEVFDFAQTNQPP-TDKWNKRLRVFHKLMFISAFRKPRFLLNVVCYLQSTVGKYFTEASGGTQLSSVYLDTSAVTPLIFVLSTGSDPMSGFLKFTTQMQFTDKYYSISLGQGQGPLAENLIEKSLRLGHWVFLQNCHLATSFMQTLETIVRNLTLGITKAHVDFRLYLSSMPIQTFPISVLQNSVKITNEPPKGIKANVFGALTDLKQDFFEQHIQNGNWRAIVFGLCMFHAVLLERRKFGPLGWNITYEFSESDRECGLKTLDFFIDREVLDEIPWEAILYINGDITWGGRVTDYWDLRCLRTILTIFSSKRIIQPDYKYCRGDSYYRDPRKKTLTEYSAYVQGFPVLEDPEIFGMNQNANIVFQTKETAFFINTLLLGQPRSAADEGQAMENEIAQQTIARIQKALATKIKREPIHDTLSVLDAKGQVPSLTIVLVQEIDRFNIALGIIHDSLVNLSKAIKGLVVMSEELENVFKALLSNQVPASWAKRSFLSIKPLPSYISDFQRRIDFIQQWAENGAPRSYWISGFFFPQSFLTGVLQTYARRRVLPIDSLKIDFDVFERELVQQDFFEMHTNNMSDQKLYGNLPECTDAIINVHGIFIEAARWDLSKGGLCDANFGELFSRMPVVRFKPCL--EISPTVRYEAPLYKTQQRSGVLSTTGHSTNFILAVLLRSHNDPEFWIMRGTA 4071          
BLAST of Dynein heavy chain axonemal vs. Ensembl Fly
Match: kl-2 (gene:FBgn0001313 transcript:FBtr0346722)

HSP 1 Score: 2138.23 bits (5539), Expect = 0.000e+0
Identity = 1253/3256 (38.48%), Postives = 1849/3256 (56.79%), Query Frame = 2
Query: 3110 IEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKS-TLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVI---TLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEK------DLEITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIEN----MMRESLRIIIG--KGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDAL-------ETRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEEN--LKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANV-PEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIE-PLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQI-NTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIP---------------ELEVSEEVI--RGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSV--KAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVM-TEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKM-STAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPV-FWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEI--PSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQK-HWIKRGVA 12718
            ++ F+  +PLI  L+NP MR RHW  + D + ++    S   T    + +  Q   E I  I+  A  E  IE ++  ++  W+   FE+  Y + G Y +K  ++  QLL++H+V   +M  + + +PF   +  WE TL    + +++ L  QRQWLYLE IF  +DI +QLP E KR+AT+   +R I    F   + +    L P   LL      ++ LE +Q+ L  YLE KRQ FPRFYF+S+D+LLEIL  +K P  VQ HL+K F+N+ KL+ ++        + + M S +GE + F    Y  G  E W+ ++E     +M+E L++  G  K LV      R +W+  WPGQ+V+   Q  WT E + +L       + + L+ L  K ++ L  L  + R D+TK  R+ ++ LI +E+H RDV+  M   N ++   FEW SQLR+YW  E+    IR  N E  YGYEY GN+ RLVITPLTDRCY+TLT ALHL  GG+P GPAGTGKTET KDLGKA  I  +V NCS+ LD+ ++GK F GLA +G W CFDEFNRI+IEVLSVVAQQI +I  A   +    MFEG  + LK +  +FITMNPGYAGRTELPDNLK++FRP++MMVPD  +IAE  LFS GF++ R L++K+ T ++L+ +QLS Q HYDFG+R++ +++  AG  +RQ     EE I   A++D+NV +   +DL LFNGI+SD+FP +    IDY +  I+I    R+ GL+ +T  V K I+LFET   RH +M++G TG+ K+  +  LQ+    +  Q     S ++ V  Y +NPK++ + +LYGE++L T EW DG+LS+++R       P ++W +FDGPVDAVWIENMN+V+DDNK L L + E I +  +++++FEV DLAVASPATVSRCGMVY + +  G  PFV  W++ L    +    R+   FD  + + +DF R   +E V T       ++ KL++ F                                         K N  + I  E++    E    WF+F L+WS  +S D DSR++ D+++R   S       FP +  V+DY  D                      +  ++ W + +   +    +  +  IIVPT D VR   +  +LL  + PVM VG  GTGKT +    +      ++    +  SA+TTA   Q+ I+++ +KR K  F P  GK +I F+DD NMPA +++GSQPP+ELIRQW D+K W++RK   +   + +   + +MGPPGGGR  I+ R    F LL      ++++  +FGT+L   +     E+  +   +    I++Y+++ S+MLPTP KSHY FNLRD+SKVFQG+L  E E     +  LRLW HE  RVF DRLV+D D+ WF N +   L   F   +  +   + P  +GDF       + + E ++ D +   ++  LE++N      +MNLV F +A+ H+ RI R+I QP G+ L +G+GGSGRQ LTKLAA + E   FQIE++K Y   ++R+DLK +    G++ +  +F+FS  QI + SFLE  NN+L++G++ NL+  D+ + +  +++   +  G+  T   L+S +   VR  LH  +  SPIGE FR+ +RQ+PAL++  T +WF  WPQEAL  VA  FL   P                L +S E I  R + Y+   IH SV+  SE    E+ RYNYVT  +YL+L+  F K+  +K+ E+  A +R +NGL K+  T+E V  + EEL+    Q++    E +     IE     A E +  V  E  +  +    C  +   A+ DL+  +P +  ++++L  LNK DI+EV++  RPP  +  V+E V I+   +P               W+  K +L +   FL+ L N+D+D+ISD  +++I  Y  +    P  +  VS AC S+ QW+ A+  Y  V + VAPK+E L+ + K LE+ +  L  A+ KL+ ++  I  L  +LE       EL  K +    +L RA  L+  LS E+ RW ++V  L+     + G+ L+S  +++YLG F  +YR  +  +WS  +K   +P T +          D V IR W I GLP D LS EN VIV    RWPL IDPQ QAN WIKN+++ N L  +     D+LR LE A++ G P L++NVGE LD A+ PIL +    Q G  ++K  D  I Y++ FRFYITTK+ NPHY PE+S+K TIVNF L   GLE QLLG++V +E+P LE+ K++L+++ A+ ++ L +++++IL  L+ + GS +DD +L  TL+ S+  S  ++  + IAE TE +ID  R  Y P + R  ILFF + D++KIDPMY +SL  ++ +F   I  + +   + ERI NIN Y ++++Y N CR LFE+HKLLFS  +  +IL + GK+   E+ F+L GG V  K    PNPAP WIS++ W+ I  L  +  F    + F   Y   +   + +  P +E L GEW D    FQ + VLR LR D+++  +  F+   LG R+++P   DL   + +S   TPLIFVLSPG DPA  L   ++ +K ++++ ++SLGQGQ P A +LI + ++ G WVF  NCHL+ SWMP+L++++  +   K+H+ FRLWL+S P P FP+ ILQ   KMT EPPRGIK+N+ + Y + ++  + + ++ ++++ LL +LC FH VL+ERKKF  LG+N+ Y F D D  +    L ++L EY D P+  L+Y    +NYGG +TDDWDRR ++  ++ F+  Q + T  +  S    Y  I    D   Y+  I+  P  D P+ FG H NA+I   I ET  L + LL +Q +  ST+  ++ E  V +++KEIL   P+  N E  +K   +     +  VL+QE+ RYN+LL  + + LRDL + IQGLVVMS  LE +  ++ + +VP  W  KAY SLKPLA+W  DL  R+    +W     PP+ FW++ + FP  F+T  LQ  AR     ID +S+ F V V+       I     G YIR LFLEG  W      L +  P EL   +PVI   P  N       +Y CP Y    R+G+         FV ++++ +  ++  +WIKRG A
Sbjct: 1311 VDSFRRTLPLITALKNPCMRERHWNRVRDVIHVNFDENSKNFTLELIINLDFQAFSEDIQDISNPATMELQIENSIKNIATIWKKQSFEMAFYHD-GIYRIKNVEDCFQLLEEHMVQISAMKATRFVEPFITIVDYWEKTLSYISETLEKGLTVQRQWLYLENIFQGDDIRKQLPEEAKRFATITEEFRTISSKMFQAKTAVKATNLRPPPFLLNRFSRMDERLELIQRALEIYLEAKRQLFPRFYFISNDDLLEILGNSKRPDLVQTHLKKLFDNLYKLELKRVGKTLSRWQASGMHSDDGEYVEFMMVIYIDGPSERWLKQVEEYMLVVMKEMLKLTRGSLKKLVG----NREKWISLWPGQMVLTTAQIQWTTECTRSLIHCSMVDQKKPLRKLKKKQIKVLSKLSEMSRKDLTKTMRLKVNTLITLEIHGRDVIERMYKSNCKDTGHFEWFSQLRFYWHRESELCVIRQTNTEHWYGYEYTGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIWVIVTNCSEGLDYKSIGKNFSGLAQSGCWGCFDEFNRINIEVLSVVAQQIMSIMAALSTKALELMFEGQMIKLKHTVGLFITMNPGYAGRTELPDNLKSMFRPISMMVPDNIIIAENLLFSDGFTNTRNLARKVYTLYELAKQQLSKQYHYDFGLRSMVALLRYAGRKRRQLPNTTEEEIVYLAMKDMNVARLTANDLPLFNGIMSDIFPGVSLPTIDYSEFNIAIYEEFREAGLQPITIAVKKVIELFETKNSRHSVMIIGDTGTAKSVTWRTLQNCFYRMNSQ---RFSGWEAVTVYPVNPKALNLAELYGEYNLSTGEWLDGVLSSIMRIICGDEEPTQKWLLFDGPVDAVWIENMNSVMDDNKLLTLVNSERITMPVQVSLLFEVGDLAVASPATVSRCGMVYNDYNDWGWKPFVNSWLQRLRIKEFADFLRIH--FDYMVPKILDFKRMRCKEPVRTNELNGVVSLCKLLEIF---------------------------------------GTKVNGINPINLELLE---EMTRLWFMFCLVWSICSSVDEDSRQRLDSFIRELESC------FPIKDTVFDYFVDPN--------------------ERTFLPWDSKLLSSWKCDFESPFYKIIVPTGDTVRYEYVVSKLLAEEYPVMLVGNVGTGKTSTAISVMEACDKNKFCILAVNMSAQTTAAGLQESIENRTEKRTKTQFVPIGGKRMICFMDDFNMPAKDIYGSQPPLELIRQWIDYKYWFNRKTQQKI-YVQNTLLMAAMGPPGGGRQTISSRTQSRFVLLNLTFPSQETIIRIFGTMLCQKLESYPNEVREMWLPITLCTINLYVSMISKMLPTPNKSHYLFNLRDISKVFQGLLRSEKELQNKKNFFLRLWVHECFRVFSDRLVDDSDQFWFVNTINDILGKHFEVTFHSLCPSKVPPFFGDFA----HPQGFYEDLQVDFLRTFMKNQLEEYNNFPGMTRMNLVFFREAIEHIVRILRVISQPRGHILNMGIGGSGRQVLTKLAAFILEMAVFQIEVTKKYKTGDFREDLKNLYKVTGIKQRLTIFIFSSDQIAEVSFLEITNNMLSTGEI-NLFKSDEFDELKPELERPAKKNGVLLTTEALYSYFILNVRDFLHVALCFSPIGENFRSYIRQYPALLSSTTPNWFRFWPQEALLEVASHFLIGFPLNVVVSGKEDEKHRESLVISTEAILQRDIAYVFSVIHSSVAKMSENMYAEVKRYNYVTSPNYLQLVSGFKKLLEKKRLEVSTASNRLRNGLSKISETQEKVSLMSEELKASSEQVKILARECEDFISMIEIQKSEATEQKEKVDAEAVLIRRDEIICLELAATARADLEVVMPMIDAAVKALDALNKKDISEVKSYGRPPMKIEKVMEAVLILLGKEPT--------------WENAKKVLSE-STFLNDLKNFDRDHISDKTLKRIAIYTKNPELEPDKVAVVSLACKSLMQWIMAIENYGKVYRIVAPKQEKLDSAMKSLEEKQAALAAAKKKLEELQVVIEELYRQLEEKTNLLNELRAKEERLRKQLERAIILVESLSGERERWIETVNQLDLSFEKLPGDCLLSVAFMSYLGAFDTKYREELLVKWSLLIKDLLIPATLELKVTYF--LVDAVSIREWNIQGLPADDLSTENGVIVTQGSRWPLIIDPQMQANNWIKNMEERNQLMTLDFGMADYLRQLERALKEGLPVLLQNVGEYLDQAINPILRQSFTIQSGERLLKFNDKYISYNNSFRFYITTKISNPHYPPEISSKTTIVNFALKQDGLEAQLLGIIVRKEKPALEEQKDELVMTIARNKRTLIDLDNEILRLLNESRGSLLDDDELFSTLQKSRQTSVLVKESLSIAEVTEVEIDAARQEYKPASERASILFFVLMDMSKIDPMYVFSLAAYILLFTQSIERSPRNQLVHERIQNINEYHSYAVYRNTCRGLFERHKLLFSIHMTAKILSNAGKLLEEEYDFILKGGIVLDKLGQAPNPAPWWISEQNWDNITELDKVSGFHGIIDSFEQHY-KAWNGWYATTFPEQEDLVGEWNDKLTDFQKICVLRSLRPDRISFCLTQFIITKLGPRYVDPPVLDLKATFDESISQTPLIFVLSPGVDPAQSLISLSESVKMAQRMYSLSLGQGQAPIATKLIMDGIKDGNWVFLANCHLSLSWMPTLDKMIATMQSMKLHKKFRLWLSSSPHPDFPISILQTSIKMTTEPPRGIKSNMKRLYNNINEANMENCSEPSKYKKLLFALCFFHTVLLERKKFLELGWNVIYSFNDSDFEVSEILLLLYLNEYEDTPWGALKYLIAGVNYGGHITDDWDRRLLITYINQFFCDQALQTRKFRLSTLPNYF-IPDDGDVQSYLDQIQMFPNFDKPDAFGQHSNADIASLIGETRMLFEALLSMQVQTNSTSSNENGETKVFDLAKEILMNTPDEINYEQTAKIIGI-NRTPLEVVLLQEIERYNKLLVDMSTQLRDLRRGIQGLVVMSSDLEDIYLAVSEGRVPLQWL-KAYNSLKPLAAWARDLIHRVGHFNSWAKTLRPPILFWLAAYTFPTGFVTAVLQTSARATKTPIDELSWDFYVFVEEDTAAARIIREGGGVYIRSLFLEGGGWLRKNQCLQDPLPMELICPLPVIHFKPVENLKKRCRGVYQCPAYYYPVRSGS---------FVIAVDLKSGNEKADYWIKRGTA 4452          
BLAST of Dynein heavy chain axonemal vs. Ensembl Zebrafish
Match: dnah1 (dynein, axonemal, heavy chain 1 [Source:ZFIN;Acc:ZDB-GENE-081015-3])

HSP 1 Score: 5061.51 bits (13128), Expect = 0.000e+0
Identity = 2513/4142 (60.67%), Postives = 3159/4142 (76.27%), Query Frame = 2
Query:  344 DFPEKSFEPKLQLMYFVAPGMIPRRVRLEREKRAYXXXXXXXXXXXXGNITSDYLIPKYHPPNGKKFDGSWAP---YLFLETFDNEEYEIRNPDEWLAMGLEDGV--RKPVPGRALLPVTDDKHDVDIRDPSIDWTWQSVGVLDYDTDTKLWFVQKTDKSGRVIDDIGRPVIDGGLLPTGHFLEMSNQYWIPRIQLMFLAENPIKFSNRVIEAYQSRELHEALLRYHLYLDCMPMDGLGELDQSSLKRMIRLSKDETPILKKQKGLEDAVQSLEKEVMVDYWRSMNTIILHKLVGENPQKFNYITLPKPELPKVPMKGTIPMPKYDWDTKFEEFAFYSLLTKPEVVQAMCKSQYECLEARNKQLFHVPLAKHMRLEEFEQTQSQATQQVSLFLKDTWIDNLQKFIRTSLRDSKKGWFNIYETDFYVYTKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKG-LYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELHPLEET----------LVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVM-VKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            DF   S+ PK+QL Y   PG +PR++ +ER +R Y +L +  LL+ +G I S+ LIP     N  + +    P   YL LE FDNEE++ R P+EWLA+G E G   RKP+P +ALLP  +    VD + P+++++WQSVGVL Y  + K + V K D +G V D +G P+++GG    G ++ + +QYW+PRI+L+F AE+P  F+ RV  A   R+  EA   YH  +DCMP   +  L  +SL+R+ + +   + +  + K L++  + LEKE+ ++Y R++N +  +K+V + P+    ITLP+ +   +P +G + +P Y ++     F F SLLTK EV+  + + + EC       LF+V   K +RLEEFE  QSQ   Q+ LFL+++W+  L   I ++LRD +  W+N+  +   VY  SKL + M L++   QDS+R+L   SL +   +I DAC++ ++  Q   W  DL+ S   PKK P+F VDLVLD  G HYSTPL+ F    +NLFDK I +  NVPQ+++F++ ++ +    +L SVG+ EP+VK LRE++ + LK+A+IP+++Y  EY  +L L N D+  Y+++       ++ T  E+K EV +HL E E L + IP  IIIGPF +N E +RQ L KKRK +A A+LD LA  LR+    AC+  K I++KL+E+P++IEEL E REW+  +P+ L   +E++ K ++DY+LI+EFYY+LS+++F  KW+ + WPHKI   +  V    ++DEERF K+QVAD  +F E+L  L M VA    Y ++ +AHEVANEVRR+ KQL E Q  A L+NNRERLF +PVTN     KL +DF+PF +LW   SDW++ H+S +NDPL A++ E +E++VT+ YKTMH+ VK F +LP+ QEVA +I+  IE F+PFIPLI+ LRNPGMR RHWE+LS+ + I++  ++ LTFS CLE+ LQDH+E I+++A+ AGKEY+IEQALNKM  EW  + FEV+ YK TGTYILK  DE +QLLDDHIVMTQSM FSPYKKPFEERI+KWE+ L+ TQ+V++EWL CQR WLY+EPIFSS+DINRQLPVEGKRY TM+R WR IMK A DN  VI +CP+ARLL +LK+CN LLE VQKGLS+YLETKR +FPRFYFLSDDELLEILSQTKDPT+VQPHLRKCFENIA+L F+ DL IT M+S EGE++       PTGNVE W+ E+EN M+ S+R  I + L  Y   PRTEWVL WPGQVVIAGCQT+WTQEVS++L   DL   LY +L +QL  L  +VRG ++K+ R  LSALIVIEVHA+DV   ++ E + ++NDFEWISQLRYYW   +L IRAVNAEF YGYEYLGN+ RLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKA AIQ VVFNCSDQLDF+AMGKF KGLAS+GAWACFDEFNRID+EVLSVVAQQI TIQKAQQQR+  F+FEGME+ L  SCAVFITMNPGYAGRTELPDNLKALFRPVAMM+PDYA+IAEISL+SFGFSDA+ LSKKI +TFKLSSEQLSSQDHYDFGMRAVK+VISAAGNLKR+N  M+EELICLRAI+DVNVPKFL DDLKLFNGIVSDLFP I+EEPIDYG L  SI+     K LKDV G++ KCIQL+ETTVVRHGLMLVGP+GSGKT+CYEVL +A+++LK Q S  G  ++ V TYVLNPKSITMGQLYGEFD +THEWTDGILS LIR G ++   +K+WY+FDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKL + MTMMFEV DLAVASPATVSRCGMVYLEPSILGL PF ECW+R++PD   P+ +++  LF  +L++++ F+R +++E++ + +  LT +++KL+D F  PF+P +         KK   Q                            E ++++ E +E WF+F+LIWS GA+ D +S ++F  +LR KM    I L FPEEG VYDY  D  G    + E+ E +E  ++     WV WM    E +I P+ +YSDIIVPT+D VR+  + + LL +K PV+C+GPTGTGKTL+ISDKL K MP EYI+ F++FSA+T+ANQTQD IDSKLD+RRKGVFGPP+GKY IFFIDDLNMP LE +G+QPPIEL+RQW D  GWYDRK IG F++LVDINF  +MGPPGGGRNPITQR  RHFN L F E+++ S   +F TIL  W+   +      EE           LV A I VY  I S +LPTPAKSHYTFNLRDLSKVFQG+LM E   + +  Q+L+LW+HESCRVFQDRLV+++DR WF  LL   +   F  + E+VV  +P+LYGDFM      K Y    + +K+ +V+EE L+D+NQ +T+KM LVLFMDA++HVCRI+RI+RQPLGNALLLG+GGSGRQSLT+LA H+AEY+CFQIELSKNYG+ EWR+D+K IML AG++N  I FLF DTQIK ESFLED+NNILNSGDVPNLY+ ++ ERI   MKP+VQD+G Q TK NL +AY  RVR N+HTV+ MSP+GE+FRARLRQFP+LVNCCTIDWFS WPQEALESVA  FLN++PELE + + I+ L  MC EIHQ VS   E+Y  ELSR+N VTP SYLELL IFS +  +KKQEL  AR R K GLDKLL T E V K+QEELE+M+PQLE+A +++  T E+I+ D+ +A+ET++ V  EE  A +KA+  + I DDAQ+DL+EALPAL  +L SL+ L KND+ EVRAM RPP GV+LVIE VCI+K +KPKK+ G+K G K+DDYWDAGKGLLQDPGKFL+SLF YDKDNI DSVI++++PY+ +  F P +I KVS+ACTSICQWVRAM+ YHFVA+ V PKR+AL+ + ++L  T++IL +A+ KL AVE+ I  LQ K   C  ++ EL+ K  LCE RL RADKLIGGL++EK+RW ++V  LE+++NN+ G+VL++AGYVAYLG FTGEYR++M  EW    K   VPHT++P  NL+ T GD VKIR+WQI GLPKD+LS+EN VI ++S+RWPLFIDPQGQAN+WIKN++++N LDV+KLSD+DFLRSLENAIRFGKPCL+ENVGEELDPAL+P+LL+QT+  +G  V+KLGD II YHDDF+ YITTKLPNPHY+PE+STKVT++NFTLSPSGLEDQLLG +VAEERPDLE AKNQLIVSNA+M+QELKEIED+IL+RLS +EG+PVDD +LI+ L ASK+K+ EI+AKV  AE TERDID TR  Y+PVAVR QILFFCV+DL+ +DPMYQYSLEWFL IF  GI N+ +AD + ERI NIN +FTFSLYSNVCRSLFEKHKL+F+FLL  RIL ++ KID+AEWR++L+GG  + Q  PNPAP W+S R W +IL L++LP+FS  P+ F  K+ + FK IFDS +PHRE LPGEW    D FQ LL+LRCLR D++T+ +QDFV+  LG+RFIEPQT+DL++V+K+SSP+TPLIFVLSPGTDPA+DLYKFA+ MKFSKK++AISLGQGQGP AE ++ +AME+GKWVFFQNCHLAPSWMPSLERL+E ID DKVHRDFRLWLTS+PS KFPV ILQNGSKMT+EPPRGIKANLLK+Y S ++DF+ S  K  E++ LLLSLCLFHG  IER+KFGPLGFNIPYEFTDGDL ICI+QL MFL EY D+P+KVL+YTAG INYGGRVTD+WDRRC++N+L  FY P V++  +IYS SG YRQI   TD+ GY+ Y R LPIND+PEIFGLHDNANI+FA NET  LL  L+KLQP+++ +GGKSREE + E      + +P++ N++ +  +YPVMYE+SMNTVL+QEVIRYNRLL++I  SL DL+KA++GLVVMS  LE MSNSL+ N VP+ W +KAYPSLKPLASWV DL QRI F+Q WI +GIP VFWISGFFFPQAFLTGTLQNFAR  ++SIDTI+F FK++  +   E+TE P  GC+I GLFLEGARWD    QL ESRPKEL+TEM VIW++P  NR  P S +Y CP+YKTLTRAGTLSTTGHSTN+V ++E+PTD+ Q HWIK+GVA
Sbjct:  104 DFYSVSYTPKVQLPYICPPGHVPRKIEIERRRREYQKLDISKLLSEQG-INSNQLIPS----NQTRTETKNQPDPNYLSLEIFDNEEFDCRTPEEWLALGYEPGSMNRKPIPAKALLPTKNSIPPVDPQSPAVEYSWQSVGVLRYSQEKKQYLVHKADCNGWVRDFMGNPILNGGQR-EGMWVLLESQYWVPRIRLLFCAEDPRVFAQRVQFAENLRQNTEASNLYHHSVDCMP---VWHLHPTSLERIRKYALSTSGL--QLKCLQECEKQLEKELNLEYSRTLNQMCFNKVVQDKPED---ITLPQTQPESIPERGFVSVPNYPFEKNRAAFVFNSLLTKAEVIAVLSRVREECNRVAEMSLFYVSFTKSLRLEEFESAQSQKHSQIHLFLEESWLPALCNGISSNLRDERCSWYNLAVSRCDVYRMSKLCRLMALIRSLQQDSLRFLVQGSLASLTKLILDACHSVLQCPQELTWGPDLINSPYKPKKKPLFSVDLVLDQTGVHYSTPLESFETSVINLFDKGILSTHNVPQVDKFVLPNL-FIVGEVLWSVGLWEPEVKNLRESISKALKQAIIPLKAYTREYECYLELYNSDVNTYLDQ-------ENQTPQEVKQEVLEHLMEVEHLNKSIPSAIIIGPFMVNVEAIRQSLVKKRKGLAKALLDRLALRLRQQMQDACKECKAISKKLFEKPSSIEELTEQREWMNQVPEQLKAHEEILSKAMSDYDLIDEFYYSLSDEEFKEKWSAMAWPHKILTQMETVSAQHVDDEERFDKIQVADQNSFLERLSFLEMVVAGFSGYTNLERAHEVANEVRRVGKQLKECQEMAQLYNNRERLFGKPVTN-----KLNRDFQPFHDLWKTTSDWLRWHESWLNDPLAAINPEQLERNVTDAYKTMHQCVKQFKDLPACQEVASEIRTKIEAFRPFIPLIRSLRNPGMRNRHWELLSERININMRSRANLTFSLCLELGLQDHVEEITRVAQEAGKEYSIEQALNKMEEEWSTVMFEVMPYKETGTYILKSPDEASQLLDDHIVMTQSMAFSPYKKPFEERISKWESKLKMTQEVLEEWLICQRSWLYMEPIFSSDDINRQLPVEGKRYQTMERTWRNIMKAAHDNNRVIEVCPEARLLASLKDCNNLLELVQKGLSDYLETKRSAFPRFYFLSDDELLEILSQTKDPTSVQPHLRKCFENIARLHFQSDLLITRMYSSEGEEVHLSVPVSPTGNVEHWLREVENSMKASVRDNISRSLQAYH--PRTEWVLSWPGQVVIAGCQTFWTQEVSESLNKGDLADRLYPQLQKQLGDLVKLVRGQLSKMQRAILSALIVIEVHAKDVAAKLVEEEVSSVNDFEWISQLRYYW-RHDLYIRAVNAEFLYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFIAMGKFLKGLASSGAWACFDEFNRIDVEVLSVVAQQITTIQKAQQQRVKTFVFEGMEIALVSSCAVFITMNPGYAGRTELPDNLKALFRPVAMMIPDYAMIAEISLYSFGFSDAKVLSKKITSTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPDMNEELICLRAIRDVNVPKFLQDDLKLFNGIVSDLFPKIREEPIDYGTLDESIRNVCANKCLKDVDGYITKCIQLYETTVVRHGLMLVGPSGSGKTRCYEVLAAAMTALKGQPSVSGGEYEAVQTYVLNPKSITMGQLYGEFDQLTHEWTDGILSCLIRDGASSMEQEKKWYMFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLSDAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLTPFTECWLRTIPDMFRPYADQINSLFTRFLQDSIRFVRESIKEVITSMDSNLTCSLLKLLDCFFQPFIPRE--------GKKPHSQ----------------------------EKLSRLQELIEPWFIFALIWSVGATGDANSCQRFSVWLRGKM----IQLCFPEEGAVYDYNLDDAGISCFDDEDGEGKERKVQ-----WVSWMKYAQEVVITPETRYSDIIVPTVDTVRMSFLIDMLLSNKNPVLCIGPTGTGKTLTISDKLLKNMPAEYITHFLMFSARTSANQTQDYIDSKLDRRRKGVFGPPLGKYFIFFIDDLNMPMLETYGAQPPIELLRQWMDHGGWYDRKQIGTFKNLVDINFACAMGPPGGGRNPITQRFTRHFNFLSFTEMEDASKGKIFSTILGSWMREQLLSGLSHEEPCGSKRYMLCPLVDATIRVYSTITSALLPTPAKSHYTFNLRDLSKVFQGILMAEAGKIENKIQLLQLWYHESCRVFQDRLVSEEDRSWFDQLLHNHIKK-FGCEIEEVVPYQPILYGDFMFPGAV-KVYQLIQDREKLARVMEEYLDDYNQTSTSKMKLVLFMDAIQHVCRISRILRQPLGNALLLGVGGSGRQSLTRLATHIAEYECFQIELSKNYGLLEWREDIKSIMLKAGMQNVQITFLFVDTQIKSESFLEDVNNILNSGDVPNLYTSEEQERILTAMKPVVQDMGQQPTKANLMAAYVNRVRSNIHTVLCMSPVGEVFRARLRQFPSLVNCCTIDWFSAWPQEALESVATSFLNELPELESNPKTIQSLALMCVEIHQMVSRKCEQYLAELSRHNSVTPKSYLELLSIFSSLIGQKKQELHSARQRMKTGLDKLLSTAEDVAKMQEELEMMRPQLEEAAKDTVITMEKIKEDTVVAEETRVAVQAEETKATEKARVAQAIADDAQKDLNEALPALDAALASLQSLKKNDVVEVRAMQRPPPGVKLVIEAVCILKGIKPKKVAGEKLGEKVDDYWDAGKGLLQDPGKFLESLFKYDKDNIPDSVIKQVQPYMDNPEFHPDSIAKVSKACTSICQWVRAMHVYHFVARAVEPKRQALQEAQEDLAVTQRILDDAKGKLAAVEEGIATLQAKYHECLAKRDELDAKCQLCENRLIRADKLIGGLADEKVRWSETVQQLEYMVNNVAGDVLLAAGYVAYLGPFTGEYRSAMAEEWLRGFKDLAVPHTEQP--NLISTLGDKVKIRSWQIAGLPKDSLSVENGVIAQYSQRWPLFIDPQGQANKWIKNMERDNRLDVMKLSDRDFLRSLENAIRFGKPCLLENVGEELDPALDPVLLRQTYTHEGNTVLKLGDTIIHYHDDFKMYITTKLPNPHYSPEISTKVTLINFTLSPSGLEDQLLGRLVAEERPDLEGAKNQLIVSNAQMKQELKEIEDQILFRLSSSEGNPVDDEELIKVLGASKVKAEEIQAKVTAAEATERDIDATRLEYVPVAVRAQILFFCVSDLSNVDPMYQYSLEWFLGIFMGGIVNSKQADAVIERILNINEFFTFSLYSNVCRSLFEKHKLMFAFLLCARILTNDSKIDMAEWRYMLSGGQTQ-QQTPNPAPNWLSTRAWQDILALSALPSFSNLPQSF-SKHESAFKSIFDSSQPHREPLPGEWESQLDSFQKLLILRCLRADRLTHGLQDFVSSQLGQRFIEPQTSDLSVVFKESSPSTPLIFVLSPGTDPAADLYKFAEIMKFSKKMNAISLGQGQGPSAEVMMHSAMEKGKWVFFQNCHLAPSWMPSLERLIENIDPDKVHRDFRLWLTSLPSNKFPVSILQNGSKMTIEPPRGIKANLLKTYASVTEDFITSCTKTAEFKSLLLSLCLFHGNAIERRKFGPLGFNIPYEFTDGDLNICISQLKMFLDEYQDIPYKVLKYTAGEINYGGRVTDNWDRRCILNILEDFYQPIVLSPHHIYSPSGDYRQIP--TDNNGYLTYFRGLPINDSPEIFGLHDNANISFAQNETFALLGTLVKLQPRVAASGGKSREEEIVEGIV---EKIPDLINVQQVMNKYPVMYEESMNTVLVQEVIRYNRLLSVISQSLSDLVKALKGLVVMSSELELMSNSLFINAVPEIWKAKAYPSLKPLASWVSDLVQRIGFLQNWISDGIPAVFWISGFFFPQAFLTGTLQNFARGSVVSIDTIAFDFKLLTARRSSELTERPDIGCFIHGLFLEGARWDADTGQLAESRPKELYTEMAVIWMVPVPNRKTPQSGVYLCPIYKTLTRAGTLSTTGHSTNYVIAVELPTDRTQGHWIKQGVA 4159          
BLAST of Dynein heavy chain axonemal vs. Ensembl Zebrafish
Match: dnah1 (dynein, axonemal, heavy chain 1 [Source:ZFIN;Acc:ZDB-GENE-081015-3])

HSP 1 Score: 3902.06 bits (10118), Expect = 0.000e+0
Identity = 1955/3289 (59.44%), Postives = 2467/3289 (75.01%), Query Frame = 2
Query:  833 RPVIDGGLLPTGHFLE----MSNQYWIPRIQLMFLAENPIKFSNRVIEAYQSRELHEALLRYHLYLDCMPMDGLGELDQSSLKRMIRLSKDETPILKKQKGLEDAVQSLEKEVMVDYWRSMNTIILHKLVGENPQKFNYITLPKPELPKVPMKGTIPMPKYDWDTKFEEFAFYSLLTKPEVVQAMCKSQYECLEARNKQLFHVPLAKHMRLEEFEQTQSQATQQVSLFLKDTWIDNLQKFIRTSLRDSKKGWFNIYETDFYVYTKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKG-LYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKM-----------------------------STQLIF-----------LPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDL 10564
            +P+    LLPT + +     + +QYW+PRI+L+F AE+P  F+ RV  A   R+  EA   YH  +DCMP   +  L  +SL+R+ + +   + +  + K L++  + LEKE+ ++Y R++N +  +K+V + P+    ITLP+ +   +P +G + +P Y ++     F F SLLTK EV+  + + + EC       LF+V   K +RLEEFE  QSQ   Q+ LFL+++W+  L   I ++LRD +  W+N+  +   VY  SKL + M L++   QDS+R+L   SL +   +I DAC++ ++  Q   W  DL+ S   PKK P+F VDLVLD  G HYSTPL+ F    +NLFDK I +  NVPQ+++F++ ++ +    +L SVG+ EP+VK LRE++ + LK+A+IP+++Y  EY  +L L N D    VN +L  +  ++ T  E+K EV +HL E E L + IP  IIIGPF +N E +RQ L KKRK +A A+LD LA  LR+    AC+  K I++KL+E+P++IEEL E REW+  +P+ L   +E++ K ++DY+LI+EFYY+LS+++F  KW+ + WPHKI   +  V    ++DEERF K+QVAD  +F E+L  L M VA    Y ++ +AHEVANEVRR+ KQL E Q  A L+NNRERLF +PVTNY +L KL +DF+PF +LW   SDW++ H+S +NDPL A++ E +E++VT+ YKTMH+ VK F +LP+ QEVA +I+  IE F+PFIPLI+ LRNPGMR RHWE+LS+ + I++  ++ LTFS CLE+ LQDH+E I+++A+ AGKEY+IEQALNKM  EW  + FEV+ YK TGTYILK  DE +QLLDDHIVMTQSM FSPYKKPFEERI+KWE+ L+ TQ+V++EWL CQR WLY+EPIFSS+DINRQLPVEGKRY TM+R WR IMK A DN  VI +CP+ARLL +LK+CN LLE VQKGLS+YLETKR +FPRFYFLSDDELLEILSQTKDPT+VQPHLRKCFENIA+L F+ DL IT M+S EGE++       PTGNVE W+ E+EN M+ S+R  I + L  Y              +VVIAGCQT+WTQEVS++L   DL   LY +L +QL  L  +VRG ++K+ R  LSALIVIEVHA+DV   ++ E + ++NDFEWISQLRYYW   +L IRAVNAEF YGYEYLGN+ RLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKA AIQ VVFNCSDQLDF+AMGKF KGLAS+GAWACFDEFNRID+EVLSVVAQQI TIQKAQQQR+  F+FEGME+ L  SCAVFITMNPGYAGRTELPDNLKALFRPVAMM+PDYA+IAEISL+SFGFSDA+ LSKKI +TFKLSSEQLSSQDHYDFGMRAVK+VISAAGNLKR+N  M+EELICLRAI+DVNVPKFL DDLKLFNGIVSDLFP I+EEPIDYG L  SI+     K LKDV G++ KCIQL+ETTVVRHGLMLVGP+GSGKT+CYEVL +A+++LK Q S  G  ++ V TYVLNPKSITMGQLYGEFD +THEWTDGILS LIR G ++   +K+WY+FDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKL + MTMMFEV DLAVASPATVSRCGMVYLEPSILGL PF ECW+R++PD   P+ +++  LF  +L++++ F+R +++E++ + +  LT +++KL+D F  PF+P +         KK   Q                            E ++++ E +E WF+F+LIWS GA+ D +S ++F  +LR KM                               Q +F           L FPEEG VYDY  D  G         ++E+   KERK++WV WM    E +I P+ +YSDIIVPT+D VR+  + + LL +K PV+C+GPTGTGKTL+ISDKL K MP EYI+ F++FSA+T+ANQTQD IDSKLD+RRKGVFGPP+GKY IFFIDDLNMP LE +G+QPPIEL+RQW D  GWYDRK IG F++LVDINF  +MGPPGGGRNPITQR  RHFN L F E+++ S   +F TIL  W M+   E+ P  + LV A I VY  I S +LPTPAKSHYTFNLRDLSKVFQG+LM E   + +  Q+L+LW+HESCRVFQDRLV+++DR WF  LL   +   F  + E+VV  +P+LYGDFM      K Y    + +K+ +V+EE L+D+NQ +T+KM LVLFMDA++HVCRI+RI+RQPLGNALLLG+GGSGRQSLT+LA H+AEY+CFQIELSKNYG+ EWR+D+K IML AG++N  I FLF DTQIK ESFLED+NNILNSGDVPNLY+ ++ ERI   MKP+VQD+G Q TK NL +AY  RVR N+HTV+ MSP+GE+FRARLRQFP+LVNCCTIDWFS WPQEALESVA  FLN++PELE + + I+ L  MC EIHQ VS   E+Y  ELSR+N VTP SYLELL IFS +  +KKQEL  AR R K GLDKLL T E V K+QEELE+M+PQLE+A +++  T E+I+ D+ +A+ET++ V  EE  A +KA+  + I DDAQ+DL+EALPAL  +L SL+ L KND+ EVRAM RPP GV+LVIE VCI+K +KPKK+ G+K G K+DDYWDAGKGLLQDPGKFL+SLF YDKDNI DSVI++++PY+ +  F P +I KVS+ACTSICQWVRAM+ YHFVA+ V PKR+AL+ + ++L  T++IL +A+ KL AVE+ I  LQ K   C  ++ EL+ K  LCE RL RADKLIGGL++EK+RW ++V  LE+++NN+ G+VL++AGYVAYLG FTGEYR++M  EW    K   VPHT++P  NL+ T GD VKIR+WQI GLPKD+LS+EN VI ++S+RWPLFIDPQGQAN+WIKN++++N LDV+KLSD+DFLRSLENAIRFGKPCL+ENVGEELDPAL+P+LL+QT+  +G  V+KLGD II YHDDF+ YITTKLPNPHY+PE+STKVT++NFTLSPSGLEDQLLG +VAEERPDLE AKNQLIVSNA+M+QELKEIED+IL+RLS +EG+PVDD +LI+ L ASK+K+ EI+AKV  AE TERDID TR  Y+PVAVR QILFFCV+DL+ +DPMYQYSLEWFL IF  GI N+ +AD + ERI NIN +FTFSLYSNVCRSLFEKHKL+F+FLL  RIL ++ KID+
Sbjct:   84 KPIPAKALLPTKNSIPPGVLLESQYWVPRIRLLFCAEDPRVFAQRVQFAENLRQNTEASNLYHHSVDCMP---VWHLHPTSLERIRKYALSTSGL--QLKCLQECEKQLEKELNLEYSRTLNQMCFNKVVQDKPED---ITLPQTQPESIPERGFVSVPNYPFEKNRAAFVFNSLLTKAEVIAVLSRVREECNRVAEMSLFYVSFTKSLRLEEFESAQSQKHSQIHLFLEESWLPALCNGISSNLRDERCSWYNLAVSRCDVYRMSKLCRLMALIRSLQQDSLRFLVQGSLASLTKLILDACHSVLQCPQELTWGPDLINSPYKPKKKPLFSVDLVLDQTGVHYSTPLESFETSVINLFDKGILSTHNVPQVDKFVLPNL-FIVGEVLWSVGLWEPEVKNLRESISKALKQAIIPLKAYTREYECYLELYNSD----VNTYLELHSQENQTPQEVKQEVLEHLMEVEHLNKSIPSAIIIGPFMVNVEAIRQSLVKKRKGLAKALLDRLALRLRQQMQDACKECKAISKKLFEKPSSIEELTEQREWMNQVPEQLKAHEEILSKAMSDYDLIDEFYYSLSDEEFKEKWSAMAWPHKILTQMETVSAQHVDDEERFDKIQVADQNSFLERLSFLEMVVAGFSGYTNLERAHEVANEVRRVGKQLKECQEMAQLYNNRERLFGKPVTNYTELQKLNRDFQPFHDLWKTTSDWLRWHESWLNDPLAAINPEQLERNVTDAYKTMHQCVKQFKDLPACQEVASEIRTKIEAFRPFIPLIRSLRNPGMRNRHWELLSERININMRSRANLTFSLCLELGLQDHVEEITRVAQEAGKEYSIEQALNKMEEEWSTVMFEVMPYKETGTYILKSPDEASQLLDDHIVMTQSMAFSPYKKPFEERISKWESKLKMTQEVLEEWLICQRSWLYMEPIFSSDDINRQLPVEGKRYQTMERTWRNIMKAAHDNNRVIEVCPEARLLASLKDCNNLLELVQKGLSDYLETKRSAFPRFYFLSDDELLEILSQTKDPTSVQPHLRKCFENIARLHFQSDLLITRMYSSEGEEVHLSVPVSPTGNVEHWLREVENSMKASVRDNISRSLQAYV-------------EVVIAGCQTFWTQEVSESLNKGDLADRLYPQLQKQLGDLVKLVRGQLSKMQRAILSALIVIEVHAKDVAAKLVEEEVSSVNDFEWISQLRYYW-RHDLYIRAVNAEFLYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFIAMGKFLKGLASSGAWACFDEFNRIDVEVLSVVAQQITTIQKAQQQRVKTFVFEGMEIALVSSCAVFITMNPGYAGRTELPDNLKALFRPVAMMIPDYAMIAEISLYSFGFSDAKVLSKKITSTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPDMNEELICLRAIRDVNVPKFLQDDLKLFNGIVSDLFPKIREEPIDYGTLDESIRNVCANKCLKDVDGYITKCIQLYETTVVRHGLMLVGPSGSGKTRCYEVLAAAMTALKGQPSVSGGEYEAVQTYVLNPKSITMGQLYGEFDQLTHEWTDGILSCLIRDGASSMEQEKKWYMFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLSDAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLTPFTECWLRTIPDMFRPYADQINSLFTRFLQDSIRFVRESIKEVITSMDSNLTCSLLKLLDCFFQPFIPRE--------GKKPHSQ----------------------------EKLSRLQELIEPWFIFALIWSVGATGDANSCQRFSVWLRGKMVEEKVNTTMNFSDDLVLPAMIYMLQTMKEKCQKVFVSLFFLCFYIQLCFPEEGAVYDYNLDDAGISCF-----DDEDGEGKERKVQWVSWMKYAQEVVITPETRYSDIIVPTVDTVRMSFLIDMLLSNKNPVLCIGPTGTGKTLTISDKLLKNMPAEYITHFLMFSARTSANQTQDYIDSKLDRRRKGVFGPPLGKYFIFFIDDLNMPMLETYGAQPPIELLRQWMDHGGWYDRKQIGTFKNLVDINFACAMGPPGGGRNPITQRFTRHFNFLSFTEMEDASKGKIFSTILGSW-MQKTPEMKPFCKPLVDATIRVYSTITSALLPTPAKSHYTFNLRDLSKVFQGILMAEAGKIENKIQLLQLWYHESCRVFQDRLVSEEDRSWFDQLLHNHIKK-FGCEIEEVVPYQPILYGDFMFPGAV-KVYQLIQDREKLARVMEEYLDDYNQTSTSKMKLVLFMDAIQHVCRISRILRQPLGNALLLGVGGSGRQSLTRLATHIAEYECFQIELSKNYGLLEWREDIKSIMLKAGMQNVQITFLFVDTQIKSESFLEDVNNILNSGDVPNLYTSEEQERILTAMKPVVQDMGQQPTKANLMAAYVNRVRSNIHTVLCMSPVGEVFRARLRQFPSLVNCCTIDWFSAWPQEALESVATSFLNELPELESNPKTIQSLALMCVEIHQMVSRKCEQYLAELSRHNSVTPKSYLELLSIFSSLIGQKKQELHSARQRMKTGLDKLLSTAEDVAKMQEELEMMRPQLEEAAKDTVITMEKIKEDTVVAEETRVAVQAEETKATEKARVAQAIADDAQKDLNEALPALDAALASLQSLKKNDVVEVRAMQRPPPGVKLVIEAVCILKGIKPKKVAGEKLGEKVDDYWDAGKGLLQDPGKFLESLFKYDKDNIPDSVIKQVQPYMDNPEFHPDSIAKVSKACTSICQWVRAMHVYHFVARAVEPKRQALQEAQEDLAVTQRILDDAKGKLAAVEEGIATLQAKYHECLAKRDELDAKCQLCENRLIRADKLIGGLADEKVRWSETVQQLEYMVNNVAGDVLLAAGYVAYLGPFTGEYRSAMAEEWLRGFKDLAVPHTEQP--NLISTLGDKVKIRSWQIAGLPKDSLSVENGVIAQYSQRWPLFIDPQGQANKWIKNMERDNRLDVMKLSDRDFLRSLENAIRFGKPCLLENVGEELDPALDPVLLRQTYTHEGNTVLKLGDTIIHYHDDFKMYITTKLPNPHYSPEISTKVTLINFTLSPSGLEDQLLGRLVAEERPDLEGAKNQLIVSNAQMKQELKEIEDQILFRLSSSEGNPVDDEELIKVLGASKVKAEEIQAKVTAAEATERDIDATRLEYVPVAVRAQILFFCVSDLSNVDPMYQYSLEWFLGIFMGGIVNSKQADAVIERILNINEFFTFSLYSNVCRSLFEKHKLMFAFLLCARILTNDSKIDM 3299          
BLAST of Dynein heavy chain axonemal vs. Ensembl Zebrafish
Match: dnah7 (dynein, axonemal, heavy chain 7 [Source:ZFIN;Acc:ZDB-GENE-070912-282])

HSP 1 Score: 3106.24 bits (8052), Expect = 0.000e+0
Identity = 1713/3990 (42.93%), Postives = 2449/3990 (61.38%), Query Frame = 2
Query:  995 LLRYHLYL-DCMPMDGLGELDQSSLKRMIRLSKDETPILKKQKGLEDAVQSLEKEVMVDYWRSMNTIILHKLVGENPQKFNYITLPKPELPKVPMKGTIPMPKYDWDTKFEEFA-------FYSLLTKPEVVQAMCKSQYECLEARNKQLFHVPLAKHMRLEEFEQTQSQATQQVSLFLKDTWIDNLQKFIRTSLRDSKKGWFNIYETDFYVYTKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVG------MEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYE-------LIEEFYYNLSNDDFNAKWTMVGWPHKIRMSII--QVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVP-KSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFE---KSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKGLYVKLLE---QLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYP-HRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQL--------------------IFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYI-IKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIV-FSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELHPLEET---LVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLL--VGK--LNSDFNQKYEDVVK----------IEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQ----DLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKI-QGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIE-PYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAP-EWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFS-KKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYT--SFSD-DFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTE-DYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            +LRY  Y+ + +  + +  ++ S LK ++ L      + +  K L   +++L  E+  DY  S+   I+   V ++P++     L   +LP  P +  + +    W   F +         F    T  EV+  + +  ++ L   + + FH    + M L  F+Q  ++  ++ +  L +TWI  +QK      R +K+   N+  ++  V   ++L+ F   V   M   ++ L L+S+ ++ ++I    ++     + YE P               F++ LVLD     +      F +  +N+++  +++L  +P++E  +  +  W       ++       + E Q +K+R  +R    ++  P++   L Y+K+  L +Q   E V +FL     + H+  E+ +EV ++    + ++    + + +G F +++ ++ + L K+ + +   +++ + +  ++  ++ CE + TI  K    P+  EEL ELR ++  +     E++E++   +   E       L++   ++ ++   N+K     +    RM  I  Q  Q + E   +F+           E + +    V   V++ D+++ ++   + + ++ +L          N  E  F+ PV+ Y +   +     P+  L+   +++   H   +  PL AV+ + VE  V  + + ++K  K F +LP   ++A  +K  +E FK  IP++Q L NPG+R RHWE +S  +G  + P +     +  L + L+ H+     I+E A KE+ +E+A+ +M  EW  ++F +L Y+ TGT IL   DE+  LLDDHIV TQ+M  SP+ KPFE  I  WE  L   Q+++DEWL+ Q  WLYLEPIFSS DI  Q+P EG+R+  +D+ WR  MK    +  V+ +    ++L  +K  N+LLE + KGL+EYLE KR  FPRF+FLS+DELLEILS+TKDPT VQPHL+KCFE IA + F   L+IT M S EGE +       ++   G VE+W+LE+EN M  S+  +IGK    Y    R  WV  WPGQ V+   Q YWT+++ +A+  +  K L   L +   Q+D +  +VRG ++K  R+TL AL+V++VHARDV+ +++ + + +  +FEW+SQLRYYWIE  L  + +NA   YGYEYLGNT RLVITPLTDRCY TL GALHL  GGAP GPAGTGKTETTKDL KA A QCVVFNCSD LD++A+GKFFKGL SAGAWACFDEFNRID+EVLSVVAQQI TIQ+      +  +FEG EL L P+CAVFITMNPGYAGR+ELPDNLKALFR VAMMVPDYALIAEI L+S GF  AR LS KIV T++L SEQLSSQ HYD+GMRAVKSV++AAGNLK +    +E+++ LR+I DVN+PKFL  DL LF GI SDLFP IK    DY  LL +I+  + K  L+    F +K +Q++E  +VRHG MLVG    GKT  Y VL +AL+ + ++   + +  Q     V+NPKSITMGQLYG+FD ++HEW+DGIL+   R    +  PD++W IFDGPVDAVWIENMNTVLDDNKKLCL SGEII++  +M+++FE  DL VASPATVSRCGM+Y+EP +LG  P +  W+ ++P  +   H++ +  LFD  L   +  +R   +E+ PT+N  L  +++ LMD  +  F                E QM++ +Q                           +   +E  F+F L+WS GASC  + R KFD  +R  +   L                    + +P P EG +Y+YRF   G                     +W  W   +  +  I  D+++++IIVPT + VR  ++ + L+  +KP + VGPTGTGK++ I D L   +  +  S  ++ FSA+TTA QTQ++I SKLDKRRKGVFGPP+GK ++ F+DD+NMPA E +G+QPP+EL+RQW D   WYD K      +LVDI  + +MGPPGGGRNP+T R +RHFN +  NE    +M T+F  IL + +        P       ++ A + VY      +LPTPAKSHY FNLRD S+V QG+ +  PE+   +  + RLW HE  RV+ DRLV+  D  W    L  V K  LN DF+Q ++ +            +  L++ DF     E++ Y E  + +K+ +V+E +LE++N I+ A MNLVLF  A+ HVCRI+RI++QP G+ALL+G+GGSGRQSLT+LAAHMAE + FQ+E+SK+YGV+EWRDDLK IM  +   +   VFLF+DTQIK ESFLED++N+LN+G+VPNL++ D+ + I   M+ + +    D     +   LF+ + +R R  LH V+ MSPIG+ FR+RLR+FPAL+NCCTIDWF  WP++AL++VA +FL D+   E++     G + MCK  H S  + S  +  EL RYNYVTPTSYLEL+ +F  +  RK+ E+ + + R + GL KL      V  +Q ELE ++PQL  A +E +     I+ +SE   +T+ VV  +EA A ++A   + I+D+   DL  A+P L+ +L +L  L + DIT V+AM  PP GV+LV+E +CI+K +KP +I      G K++DYW   K LL D  KFL SL  Y+KDNI  S +  I   YI +  F P  I   S A   +C+WV AM  Y  VAK VAPK+E L  + ++L+   + L++ +A LK V+D++  LQE LE    ++ +LEN+ ++C  +L RA++LIGGL  EK RW ++  NL  L NN+ G++LISA  VAYLG FT  +R     EW    K+ G+P +     +L+++ G+PVKIR+W I GLP D+ SI+NA+I+  +RRWPL IDPQGQAN+W+KN++K N L VIKLSD DF+R+LEN I+FG P L+ENVGEELDP LEP+LLKQTFKQ G+V I+LGD+ I Y  DFRFYITTKL NPHY PEVS KVT++NF ++P G++DQLLG+VVA ERPDLE+ K  LIV  A+ +++L+EIEDKIL  LS +EG+ ++D   +Q L +SK+ +NEI  K  IAE TE  ID+TR  Y P+A+ + ILFF +ADLA I+PMYQYSL WF+N+F   I N+ K+D L ER+  + ++FT+SLY NVCRSLFEK KLLFSF L   +L+H   +D  EWRFLL GG     D P+  P  W+    W+EI  L  +  F    ++ + +    +K ++DS +PH    P EW +   +FQ +L++RCLR DKV   +Q+FV+  LG++FIE    +L   + DS    PLIF+LSPG+DP + L KF ++  F+  +L+++SLGQGQGP A  +I+  ++ G WV  QNCHLA SWM +LER+ E+++ D  H DFRLWLTS PSP FPV +LQNG KMT E P+G+++N+++S+     SD +F +S +K   ++ LL SLC FH +  ER+KFGPLG+NIPYEF + DLRI + QL MFL +Y ++PF  L+Y  G  NYGGRVTDDWDRR +  +LS FY  +++ + DY +  SG+Y    P  D+  Y+ Y ++LP+N +PEIFG++ NA+IT    ET  L D +L  Q + S     S +++V EV+ +IL  +P+ F+ +   ++YP  Y QSMNTVL+QE+ R+N+LL  I+ S  ++ KAI+GLVVMS  LE + +S+   ++P  W  K+YPSLKPL  ++ D  +R+ F+Q W  +G+P VFW+SGFFF QAFLTG  QN+AR+  I ID +SF F+VM     E    P DG YIRGLFL+GARWD    +L ES PK L   MPVIWL P   + IP  + Y  PVYKT  R GTLSTTGHSTN+V S+ + +D   +HWI+RGVA
Sbjct:  139 ILRYCYYIRNGIGTEDVAAMEDSWLKNVLAL------VPEHLKSLTRTIEALSDEMREDYLLSIKKNIV-DFVLQDPRENK--ELKARDLP--PHRQEMEIIPKPWKKSFLQAQKRMRNNLFTVNHTMLEVL-GLWQVSFKKLRLIDVEAFHSE-EESMELSVFQQLVNKHIERATGILLNTWIPEVQKIYH---RGNKR---NLIPSNSSV---ARLQSFYNCVATLMTSQLQSLALESMQDYTHLIAQNPHSV----RVYEHPG--------------FVLRLVLDQNTIKFEPDFKDFEVTVLNVYNAMLKSLSVIPRVETKLYSE--WPGPETHHTLKPIILPEILEAQQEKVRRVIR---AESAEPLKHVHL-YDKYAPLVSQQAEEDVTQFL----LEQHSFQELMMEVIRYQQLADEIQCSTVKVVRLGMFELHSHDLVRALVKRAEGLLQKLVNHMLQGHQEFNNKLCEEYDTIANKALRSPSNTEELMELRAYVAKV-----EEEEILQLEMKLQESNNRLCFLVDYVTFSPTDIQLNSK----TFQRHARMPSIFDQHRQIIKEKTGQFQDGLKLRCERILEDIKSYEQQVEEFVNFGDLSELNKYLKKAQSLNSKLELVMEKIRGINQEEEAFDWPVSQYPQRKTVQDQLLPYLRLYETAAEFQSQHHQWVTGPLTAVNPDKVEVDVGNYSRGLYKLEKTFQDLPKPLQIATSVKAEVEAFKEHIPIVQVLCNPGLRERHWEAMSAVVGFPLKPSEEDACVAHFLPLHLEAHLSAFESISEGASKEHGLEKAMERMVSEWAGMEFTLLPYRETGTSILSSLDEVQMLLDDHIVKTQTMRGSPFIKPFEAEIRDWEDKLLLLQEIMDEWLKVQGTWLYLEPIFSSPDIMAQMPEEGRRFTAVDKTWRDTMKQVSLDKHVLAVVAIEKMLDKMKHSNELLELILKGLNEYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASVVFTDVLDITHMRSSEGEVVELLDIISTSKARGQVEKWLLELENGMLRSIHKVIGKACEAYLNDLRINWVRAWPGQTVLCVSQVYWTKDIHEAI-AKGPKALQAYLEQNNTQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDVLASLVQKGVDDETNFEWLSQLRYYWIENQLHTKMINAGLAYGYEYLGNTPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAIAKQCVVFNCSDGLDYIALGKFFKGLLSAGAWACFDEFNRIDLEVLSVVAQQILTIQRGISAHAEMLLFEGTELKLNPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYALIAEIVLYSCGFVRARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKFPEENEDVLLLRSIIDVNLPKFLAHDLPLFEGITSDLFPGIKLPKPDYSVLLEAIRENSAKMNLQVTDFFAEKILQIYEMMIVRHGFMLVGEPFGGKTSAYRVLAAALNDICEKNLMEENRVQIT---VINPKSITMGQLYGQFDPVSHEWSDGILAVSYRAFAISQSPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMSLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPVMLSWLNTVPSTLSSMHKDLITGLFDRMLPACLQLIRKGTKELSPTSNTSLVKSLMNLMDCMMDEF--------------GDESQMKRMDQR-------------------------DVCSWLEGIFVFCLLWSVGASCTEEGRVKFDGLVREMLVGGLSEETRTRHGILEHVEPPAKQLTVPLPTEGTLYEYRFLKEGP-------------------GRWELWTEELKAFPPIPKDVQFNEIIVPTENTVRYNALMKLLITHQKPTVFVGPTGTGKSVYILDFLLNRLEKDVYSPLLINFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKKMVVFVDDVNMPARETYGAQPPVELLRQWLDHWNWYDMKDCSMI-NLVDIQIMCAMGPPGGGRNPVTPRFLRHFNTVTINEFDNKTMFTIFSRILDWHLTIRFPFPKPFASVTSQIISATMSVYQEATKNLLPTPAKSHYLFNLRDFSRVIQGICLSRPETADDLTAIKRLWVHEVLRVYYDRLVHPDDCAWMVGFLQEVSKSHLNEDFHQLFKHLDSNSDGLVTEDDLRSLMFCDFHDPKGEDRNYREVGDAEKLRQVVETHLEEYNNISKAPMNLVLFRFAIEHVCRISRILKQPRGHALLVGVGGSGRQSLTRLAAHMAEAELFQVEISKSYGVSEWRDDLKLIMQKSTSGDTHGVFLFTDTQIKMESFLEDVSNLLNTGEVPNLFAVDEKQEICERMRVLDRQRDRDKQTDGSTLALFNMFLERCRSQLHVVLAMSPIGDTFRSRLRRFPALINCCTIDWFQSWPEDALQAVASRFLEDV---EMTNTAREGCISMCKSFHTSTIDLSAHFLSELQRYNYVTPTSYLELISMFKHLLQRKRTEVMKLKSRYEVGLQKLESAATQVSTMQGELEALQPQLRVATKEVEEMMVVIQHESEEVSKTEKVVRVDEAEANEQAMAAKAIKDECDADLAVAVPILEAALAALDTLTQQDITLVKAMKNPPAGVKLVMEAICILKGIKPDRIPDPSGSGKKVEDYWGPAKKLLGD-MKFLQSLHEYNKDNIPVSYMSIIRNKYITNPDFVPEKIRTASAAAEGLCKWVCAMDSYDKVAKVVAPKKEKLAHAEEKLKVAMESLRKKQAALKEVQDKLAKLQETLETNKNKKADLENQVEMCSKKLERAEQLIGGLGGEKSRWSETAFNLGQLYNNLTGDILISAAIVAYLGAFTSSFRQRATEEWIDMCKSRGIPCSKN--MSLMNSLGEPVKIRSWTIAGLPSDSFSIDNAIIISNARRWPLMIDPQGQANKWLKNMEKSNSLHVIKLSDADFVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSVCIRLGDSTIEYAPDFRFYITTKLRNPHYLPEVSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALIVQGAENKRQLQEIEDKILEVLSASEGNILEDETAVQILSSSKVLANEISEKQAIAEVTELKIDQTRLGYTPIAIHSAILFFSIADLANIEPMYQYSLTWFINLFIMSIDNSQKSDLLEERLQILKDHFTYSLYCNVCRSLFEKDKLLFSFCLTVNLLKHNKLVDEKEWRFLLTGGV--GLDNPHSNPCTWLPKTSWDEICRLDEMERFKGLRKD-LARLREGWKEVYDSKDPHHTDFPSEWQEKLGQFQRMLIIRCLRPDKVVPMVQEFVSGNLGQQFIEVPPFNLATAFADSHCCAPLIFILSPGSDPMAALLKFGEEQGFTGNRLTSLSLGQGQGPIAMSMIETGVKEGTWVVLQNCHLATSWMSTLERVCEELNADTTHPDFRLWLTSYPSPNFPVAVLQNGVKMTNEAPKGLRSNIIRSFCMDPISDPEFFDSSSKPAVFKKLLFSLCFFHALTQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDQYEEIPFDALRYMTGECNYGGRVTDDWDRRTLRTILSIFYTSEIINDADYKFDPSGLYYS-PPEGDYNSYIEYTKTLPLNPSPEIFGMNANADITKDQVETQLLFDSILLTQSRSSGGSAASSDDMVFEVAADILNKLPQDFDTDAAMRKYPTSYNQSMNTVLVQEMGRFNKLLQTIRDSCVNIQKAIKGLVVMSAELEEVVSSILKGRIPAMWMKKSYPSLKPLGGYISDFLERLKFLQDWYMDGMPAVFWMSGFFFTQAFLTGGQQNYARRYTIPIDLLSFDFEVMEDK--EYKNPPEDGVYIRGLFLDGARWDRRTKRLAESFPKILHDTMPVIWLKPMKKQDIPERQCYISPVYKTSERRGTLSTTGHSTNYVISMALNSDVPPEHWIRRGVA 3994          
BLAST of Dynein heavy chain axonemal vs. Ensembl Zebrafish
Match: dnah12 (dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:ZDB-GENE-090311-9])

HSP 1 Score: 3023.42 bits (7837), Expect = 0.000e+0
Identity = 1639/3733 (43.91%), Postives = 2319/3733 (62.12%), Query Frame = 2
Query: 1799 KNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMK-DISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQ--QEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKL----DNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQE----------------------------VAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEK---STYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALET--RDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSP--FQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRER--VQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFP-----------EEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHW---MANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPE-YISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELHP----LEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVK-------------IEPLLYGDFMSVAIENKK--YVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQ--DLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLN--DIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQA-VEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQG-DKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEP-YIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKF-SKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSY----TSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTED-YIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQ-PKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSI-PPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            K P+F +DL+ D+    +        +  + + +     +Q V  ++ ++ +  IS  D  L + V +       LR  +R  L+      +SY   Y+  +N   Q   + + E   +++ +H   +E    + K ++        +P  I      ++ E ++QGLAKK  A++  I+  L     + + Q CE F+ I  +  + P T EE+ E+  +I  +     E+    +++       L++   +N  + D N   T++ WP  I     Q ++ +  DE + +     D++   EKL    D +   +      +++    + A +VR + K+L + + +    N  E L+    T+Y ++  + +  EP++ L+  V  W +     M+   + ++ E +E  V E+ + M+K +K F +     E                            +   +   ++EFK +IPL+  L NPG+R RHWE +S+  G  + P S  T  K L+  L  ++E+   I+  A KE+ +E+A+  M   W+ + F    Y++TG  IL   DEI  +LDD IV TQ+M  SP+ KPFE  I  WE  L   QD IDEWL+ Q QWLYLEPIFSSEDI +Q+P EG+ +  +++ WR++M     +P ++       L   L+E   LLE + KGL+ YLE KR  FPRF+FLS+DE+LEILS+TKDPT VQPHL+KCFE IAKL F  +L+I AM+S EGE++ F +   ++   G VE+W++++E++M  S+R +I +  + Y +  R++WV +WPGQVV+   Q YWT EV +A+ +    LK  Y +L  QL+ +  +VRG + K  R TL AL+ I+VHARDV+  +I + + +  DF+W++QLRYYW  +N+++R +N +  Y YEYLGN+ RLVITPLTDRCY TL GA +L  GGAP GPAGTGKTETTKDL KA A+QCVVFNCSD LD++AMGKFFKGLAS+GAWACFDEFNRI++EVLSVVAQQI  IQ+A + RL+ F FEG EL L P+C V ITMNPGYAGR+ELPDNLK LFR VAMMVP+YALIAEISL+S+GF +A+ LS KIV T++L SEQLSSQ HYD+GMRAVK+V+ AAGNLK +    +E+++ LR+I+DVN PKFL  D+ LFNGI SDLFP I     DY   L           ++ V  F+DK IQ +E  +VRHG MLVG   +GKTK   VL   L+ + +    +     +QTV     NPKSITMGQL+G+FD ++HEWTDGI++   R+  ++  P+++W +FDGP+D +WIE+MNTVLDDNKKLCL SGEII++  +M+++FE  DL+ ASPATVSRCGM+Y+EPS LG  P V  W+++LPD +        +Q+LF+  L  T+  +R   RE++P++N     ++ +L +  +   V  D                   N+N++                            + + F F+L+WS G  CDTDSR +FD +LR  +S +    P P           E+GLVYDY ++  G                     +WVHW   ++N P  +   + K  DIIVPTID VR   + +  +   +P++ VGPTGTGK++ + +KL   +  + ++  FI FSA+T+ANQTQ++I S+LDKRRKGV+GPPMGK  I F+DD+NMPA EVFG+QPP+EL+RQ+ D   WYD K   +  +L D+  I +MGPPGGGRN +T R +RHFN+   N   ++SM  +F  I+ F++     E  P    +   +V A ++VY      +LPTPAKSHYTFNLRD S+V QG L+L+ ESLT+   ++RL+ HE  RVF DRLV+DQDR W   L    +   F   ++ V +             +  LL+GD+M   ++  +  Y E    ++  +V+E  L+++NQ +  +MNLV+F   + H+ RI+R+++QP GNALL+G+GGSGRQS+T+LA  M+    FQ E+SK+YG+ EWR+DLKR+M  AG++ +  VFL +D QIKDE+FLED+++ILN+G+VPN+++ D+ + I   ++P  Q  +  L+ +   LF+ +  R + NLH V+  SPIG+ FR RLRQFP+L+NCCTIDWF  WP+EALE VA KFL   D+ +LE  E     ++ +CK  H S  + S ++  EL R+NYVTPTSYLEL+  F  +  +++  +  A++R  NGLDKL + E  V ++++EL  ++P+LEQA ++ +K  +       E+  ++++V   EEA   K  +   + +++ + DL EA+PAL+ +L +L  L   D+T V+AM  PP GV+LV+  VC+MKD+KP++I      G KI DYW   K LL D   FL  L  YDKDNI   V+ KI   Y+ +  F P  + K S A   +C+W+ AM  Y  VAK VAPK+  L  + + L  T  +L + RA+LK VEDR+  LQ+ LE     + +LE + DLC  +L RA+KLIGGL  EK RW  +  +L+   +N+ G+VLISAG +AYLG FT  +R+     W+   K+  +P +D    +L  T GDP+KIR W I GLP D+ SI+N VIV  SRRWPL IDPQGQAN+W+KN ++++ L+VIKL+D D++R+LEN I+FG P L+ENVGEELDP+LEP+LLKQ FKQ G   I+LG+++I Y  DFRFYITTKL NPHY PE++TKV ++NF ++P GLEDQLLG+VVA+ERP+LE+ +N LI+ +A  +++LKEIED+IL  L  +EG+ ++D   IQ L+A+KL SNEI  K  IAE+TE +I E+R  Y  +A  + ILFF +ADLA IDPMYQYSL WF+N++ N I ++ K+  L +R+  + +YFT++LY NVCRSLFEK KLLFSFLL + +L  + +I+ +E+ FLL GG      +PNP P W+ D+ W+EI   + LPA +   E FI K    F  I+DS EP    LP  WCD  +  Q +++ RCLR DK+  A+  FV   LG+ F+EP   DL+  Y DS+ T PL+FVLSPG DP + L KFA+D      +  +ISLGQGQGP A +LI++AM+ G WV  QNCHLA SWM +LE++ E +  D  H +FRLWLTS PSP+FPV ILQNG KMT EPP G++ NLL+SY     S +D F     K   W  LL  +C FH ++ ERKKFGPLG+NIPY F + DLRI I QL +F+ EY +VPF+ + Y  G  NYGGRVTDDWDRR +M +L+ FYN  V+    Y +S SG Y    P + +  Y+ +I+ LP    PE+FG+H+N +I+  + +T  L D LL  Q       GG   +  + +++ +IL  +P  F+IE    ++PV YE+SMNTVL+QE+ RYN L + I+ SL++L+KAI+GLVVM   LE+++ SL   KVP+ WA  +YPSLKPL S+V D   R+ F+Q W D   P VFW+SGFFF QAF+TG LQN+ARK  I ID + F ++V+   +      P DG YI GLFL+GARWD     L E  PK LF  +P+IW+ P   +++  P  +Y CP+YKT  R GTLSTTGHSTNFV ++ +PT K  +HWIKRGVA
Sbjct:  320 KLPLFKMDLIFDDEKMDFYPNFHDLELAVLEIANLISNTMQKVQTIQSWLAEGSISVIDAKLSDHVQVWAQTT--LRNAVRMNLEGPAKHFQSYVDRYDWLVNGTAQAQVDKLMEEEHSFD-EHTKQVEWFRALSKEISS-------LPSLIHFDMVRLDCEELKQGLAKKANALSKIIVGKLVSSHHQCSLQICEEFEAIRDRALKVPETTEEMMEMITYINQVKTKGIEELNNRIMEAQQRMNYLMDVHIFNEEHLDLNT--TVLLWPQNINPIFDQSDEVM--DEAKLKGQN--DLSGRREKLLLELDKVGRRMEEFAECSELDMIQQYAADVRTVLKRLQDIEESIDFINKEEALYQWEKTSYPEVEVIKESIEPYQKLFTLVLKWQRTRKKWMDGSFLDLNGESIELEVEEYVREMYKMLKFFQQKQKKAELKKEKTAGLKKKTKEDQEDDKKESATILICSSVVKQVKEFKEYIPLVSILCNPGIRPRHWEQMSEIAGQDLTPDSGSTLRKILKQNLTPYLELFEGISAGASKEFGLERAMQTMVEAWDTVSFHYHPYRDTGVSILSSVDEIQTMLDDQIVKTQTMRGSPFIKPFETEIKVWEERLIGIQDTIDEWLKVQHQWLYLEPIFSSEDIMKQMPEEGRLFQIVNKHWREVMANCVKDPKILAATSLPGLFEKLQESYNLLENIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPTRVQPHLKKCFEGIAKLDFLPNLDIQAMYSSEGERVEFIQLISTSEARGAVEKWLVQVEDIMLRSIRDVINRSRLAYPETKRSQWVREWPGQVVLCASQMYWTVEVHEAIRSSANGLKKYYEQLQNQLNDIVELVRGKLPKQTRTTLGALVTIDVHARDVILELIEKGVSSETDFQWLAQLRYYWANDNVRVRIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIEMRLEYFDFEGTELRLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKFPDENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGISLPVADYKLFLECAHLCCENHNVQPVKVFLDKIIQTYEMMIVRHGFMLVGEPFAGKTKVLHVLADTLTLMNESGYNEEEKVIYQTV-----NPKSITMGQLFGQFDPVSHEWTDGIVANTFREFASSETPERKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSSQMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWTPLVLSWMKTLPDPLQAQDNSTLLQQLFEWLLPPTLVLLRKQCREVIPSSNSNTVVSLTRLFEMLLTRPVNED-----------------PGNKNMRT--------------------------WIMAAFAFALVWSVGGCCDTDSRSRFDKFLREMISGKAENCPIPAAVSKWECPFDEKGLVYDYSYEFKGK-------------------GRWVHWNESISNAP--LGDKNTKVQDIIVPTIDTVRYTYLMDLCIQYGRPLLLVGPTGTGKSVYVKEKLMNNLDKDLFLPFFINFSARTSANQTQNIIMSRLDKRRKGVYGPPMGKKCIIFVDDMNMPAKEVFGAQPPVELLRQYFDHGNWYDLKDTSKI-TLTDMQLISAMGPPGGGRNAVTPRFLRHFNICSINAFSDESMVRIFSNIVTFYL--RTNEFPPDCFTVGNQIVSATLEVYQKAIENLLPTPAKSHYTFNLRDFSRVVQGCLLLKKESLTNKRTMIRLFVHEIYRVFYDRLVDDQDRAWLFTLTSNIVKQHFKDNFDSVFEHLKDGNKPLCEENMRNLLFGDYMMPDVDESERLYAEVPSVERFGEVVETCLDEYNQTHKNRMNLVIFRYVLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATFMSNMTLFQPEISKSYGMNEWREDLKRLMKNAGVKGEKTVFLLTDAQIKDEAFLEDVDSILNTGEVPNIFAVDEKQEIMEAVRPFAQAGNKNLEFSPLALFAYFVTRCKENLHIVVAFSPIGDAFRNRLRQFPSLINCCTIDWFQPWPEEALERVANKFLETLDLSDLERKE-----VVPICKTFHTSAIDLSNRFLIELGRHNYVTPTSYLELIAAFRLLLTQRRDTVMSAKNRYTNGLDKLAFAESQVSEMKKELVDLQPKLEQAKIDNTKIMEVIEVESVEVEAKSKLVRVDEEAATLKANEAQAL-KNECESDLAEAIPALEAALSALDTLKPADVTIVKAMKNPPAGVKLVMAAVCVMKDIKPERINDPSGTGQKILDYWGPSKKLLGD-MNFLRDLKEYDKDNIPAQVMHKIRSEYMTNPDFDPTKVVKASSAAEGLCRWITAMEVYDRVAKVVAPKKANLIVAQESLATTMALLNQKRAELKEVEDRLAALQKTLEEKTEEKAQLEFQVDLCARKLERAEKLIGGLGGEKNRWLKAANDLQCTYDNLTGDVLISAGVIAYLGAFTARFRHDCTKMWAQLCKSKKIPSSDD--FSLSKTLGDPIKIRAWNIAGLPTDSFSIDNGVIVSNSRRWPLMIDPQGQANKWVKNSERDHNLNVIKLTDADYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQVFKQGGVDCIRLGESVIEYSADFRFYITTKLRNPHYLPELATKVCLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDQILETLQSSEGNILEDESAIQILDAAKLMSNEITKKQQIAEKTEIEIAESREGYRAIAKHSSILFFTIADLANIDPMYQYSLNWFVNLYVNSILDSNKSKNLEKRLRYLIDYFTYNLYCNVCRSLFEKDKLLFSFLLCSNLLLAKKEIEYSEFMFLLTGGVGLQNSIPNPDPNWLPDKSWDEICRASDLPALNGIKESFI-KSPESFLPIYDSKEPFNTALPKPWCDKLNELQKMIIYRCLRPDKIEPAISKFVTDKLGKIFVEPPPFDLSKSYNDSNCTIPLVFVLSPGADPMASLLKFANDKNMGGSQFKSISLGQGQGPIAVKLIRSAMKDGTWVCLQNCHLAVSWMSTLEKICEDLSPDTCHPNFRLWLTSYPSPRFPVTILQNGVKMTNEPPTGLRLNLLQSYLSDPISDADFFAGCPKKELVWEKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFVNEYQEVPFEAITYLTGECNYGGRVTDDWDRRLLMTILADFYNKDVIDHPRYSFSPSGKY-HAPPKSIYEDYVEFIKKLPFTQHPEVFGMHENVDISKDLQQTKLLFDSLLLTQGGGSKGGGGSGGDSTLLDIANDILSKLPGNFDIESALVKFPVCYEESMNTVLVQEMQRYNNLSSTIRVSLQNLIKAIKGLVVMDAELEAVAGSLLVGKVPEKWAKCSYPSLKPLGSYVNDFLARLKFLQDWYDTQKPHVFWLSGFFFTQAFITGALQNYARKYSIPIDLLGFNYEVL--PFDTSDSSPEDGVYIHGLFLDGARWDKKSGVLAEQYPKVLFDAVPIIWIKPTDKKAMDQPHSVYVCPLYKTSERKGTLSTTGHSTNFVITMMLPTSKRPQHWIKRGVA 3951          
BLAST of Dynein heavy chain axonemal vs. Ensembl Zebrafish
Match: CR450723.1 (dynein, axonemal, heavy chain 12 [Source:NCBI gene;Acc:799461])

HSP 1 Score: 3005.31 bits (7790), Expect = 0.000e+0
Identity = 1641/3738 (43.90%), Postives = 2311/3738 (61.82%), Query Frame = 2
Query: 1799 KNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMK-DISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILD----LLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDM-LDEQQEVIDKCLTDYE-LIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKL----DNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQE----------------------------VAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEK---STYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALET--RDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRER--VQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFP-----------EEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHW---MANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPE-YISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELHP----LEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVK-------------IEPLLYGDFMSVAIENKK--YVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQ--DLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLN--DIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQA-VEESKATK----EEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQG-DKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEP-YIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKF-SKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSY----TSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTED-YIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQ-PKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            K P+F +DL+ D+    +        +  + + +     +Q V  ++ ++ +  IS  D  L + V +       LR  +R  L+      +SY   Y+  +N   Q   + + E   +++ +H   LE    + K ++        +P  I      ++ E ++QGLAKK  A++  IL     L  R         CE F+ I  +  + P T EE+ E+  +I  +    ++E    I   ++    L++   +N  + D N   T++ WP  I     Q ++ +  DE + +     D++   EKL    D +   +      +++    + A +VR + K+L + + +    N  E L+    T+Y ++  + +  EP++ L+  V  W +     M+   + ++ E +E  V E+ + M+K +K F +     E                            +   +   ++EFK +IPL+  L NPG+R RHWE +S+  G  + P S  T  K L+  L  ++E+   I+  A KE+ +E+A+  M   W+ + F    Y++TG  IL   DEI  +LDD IV TQ+M  SP+ KPFE  I  WE  L   QD IDEWL+ Q QWLYLEPIFSSEDI +Q+P EG+ +  +++ WR++M     +P ++       L   L+E   LLE + KGL+ YLE KR  FPRF+FLS+DE+LEILS+TKDPT VQPHL+KCFE IAKL F  +L+I AM+S EGE++ F +   ++   G VE+W++++E++M  S+R +I +  + Y +  R++WV +WPGQVV+   Q YWT EV +A+ +    LK  Y +L  QL+ +  +VRG + K  R TL AL+ I+VHARDV+  +I + + +  DF+W++QLRYYW  +N+++R +N +  Y YEYLGN+ RLVITPLTDRCY TL GA +L  GGAP GPAGTGKTETTKDL KA A+QCVVFNCSD LD++AMGKFFKGLAS+GAWACFDEFNRI++EVLSVVAQQI  IQ+A + RL+ F FEG EL L P+C V ITMNPGYAGR+ELPDNLK LFR VAMMVP+YALIAEISL+S+GF +A+ LS KIV T++L SEQLSSQ HYD+GMRAVK+V+ AAGNLK +    +E+++ LR+I+DVN PKFL  D+ LFNGI SDLFP I     DY   L           ++ V  F+DK IQ +E  +VRHG MLVG   +GKTK   VL   L+ L +++  +    + V    +NPKSITMGQL+G+FD ++HEWTDGI++   R+  ++  P+++W +FDGP+D +WIE+MNTVLDDNKKLCL SGEII++  +M+++FE  DL+ ASPATVSRCGM+Y+EPS LG  P V  W+++LPD +        +Q+LF+  L  T+  +R   RE++P++N     ++ +L +  +                                  RPL     NK           +   + + F F+L+WS G  CDTDSR +FD +LR  +S +    P P           E+GLVYDY ++  G                     +WVHW   ++N P  +   + K  DIIVPTID VR   + +  +   +P++ VGPTGTGK++ + +KL   +  + ++  FI FSA+T+ANQTQ++I S+LDKRRKGV+GPPMGK  I F+DD+NMPA EVFG+QPP+EL+RQ+ D   WYD K   +  +L D+  I +MGPPGGGRN +T R +RHFN+   N   ++SM  +F  I+ F++     E  P    +   +V A ++VY      +LPTPAKSHYTFNLRD S+V QG L+L+ ESLT+   ++RL+ HE  RVF DRLV+DQDR W   L    +   F   ++ V +             +  LL+GD+M   ++  +  Y E    ++  +V+E  L+++NQ +  +MNLV+F   + H+ RI+R+++QP GNALL+G+GGSGRQS+T+LA  M+    FQ E+SK+YG+ EWR+DLKR+M  AG++ +  VFL +D QIKDE+FLED+++ILN+G+VPN+++ D+ + I   ++P  Q  +  L+ +   LF+ +  R + NLH V+  SPIG+ FR RLRQFP+L+NCCTIDWF  WP+EALE VA KFL   D+ +LE  E V      +CK  H S  + S ++  EL R+NYVTPTSYLEL+  F  +  +++  +  A++R  NGLDKL + E  V ++++EL  ++P+LEQA ++ +K  +    + + R S  AK   + V  E A       +   ++++ + DL EA+PAL+ +L +L  L   D+T V+AM  PP GV+LV+  VC+MKD+KP++I      G KI DYW   K LL D   FL  L  YDKDNI   V+ KI   Y+ +  F P  + K S A   +C+W+ AM  Y  VAK VAPK+  L  + + L  T  +L + RA+LK VEDR+  LQ+ LE     + +LE + DLC  +L RA+KLIGGL  EK RW  +  +L+   +N+ G+VLISAG +AYLG FT  +R+     W+   K+  +P +D    +L  T GDP+KIR W I GLP D+ SI+N VIV  SRRWPL IDPQGQAN+W+KN ++++ L+VIKL+D D++R+LEN I+FG P L+ENVGEELDP+LEP+LLKQ FKQ G   I+LG+++I Y  DFRFYITTKL NPHY PE++TKV ++NF ++P GLEDQLLG+VVA+ERP+LE+ +N LI+ +A  +++LKEIED+IL  L  +EG+ ++D   IQ L+A+KL SNEI  K  IAE+TE +I E+R  Y  +A  + ILFF +ADLA IDPMYQYSL WF+N++ N I ++ K+  L +R+  + +YFT++LY NVCRSLFEK KLLFSFLL + +L  + +I+ +E+ FLL GG      +PNP P W+ D+ W+EI   + LPA +     F+         I+DS EP    LP  WCD  +  Q +++ RCLR DK+  A+  FV   LG+ F+EP   DL+  Y DS+ T PL+FVLSPG DP + L KFA+D      +  +ISLGQGQGP A +LI++AM+ G WV  QNCHLA SWM +LE++ E +  D  H +FRLWLTS PSP+FPV ILQNG KMT EPP G++ NLL+SY     S +D F     K   W  LL  +C FH ++ ERKKFGPLG+NIPY F + DLRI I QL +F+ EY +VPF+ + Y  G  NYGGRVTDDWDRR +M +L+ FYN  V+    Y +S SG Y    P + +  Y+ +I+ LP    PE+FG+H+N +I+  + +T  L D LL  Q       GG   +  + +++ +IL  +P  F+IE    ++PV YE+SMNTVL+QE+ RYN   N I+ SL++L+KAI+GLVVM   LE+++ SL   KVP+ WA  +YPSLKPL S+V D   R+ F+Q W D   P VFW+SGFFF QAF+TG LQN+ARK  I ID + F ++V+   +      P DG YI GLFL+GARWD     L E  PK LF  +P+IW+ P  +  I P  +Y CP+YKT  R GTLSTTGHSTNFV ++ +PT K  +HWIKRGVA
Sbjct:  246 KLPLFKMDLIFDDEKMDFYPNFHDLELAVLEIANLISNTMQKVQTIQSWLAEGSISVIDAKLSDHVQVWAQTT--LRNAVRMNLEGPAKHFQSYVDRYDWLVNGTAQAQVDKLMEEEHSFD-EHTKVLEWFRALSKEISS-------LPSLIHFDMVRLDCEELKQGLAKKANALSKIILSDGVFLFFR--------ICEEFEAIRDRALKVPETTEEMMEMITYINQVKTKGIEELNNRIMVSISQMNYLMDVHIFNEEHLDLNT--TVLLWPQNINPIFDQSDEVM--DEAKLKGQN--DLSGRREKLLLELDKVGRRMEEFAECSELDMIQQYAADVRTVLKRLQDIEESIDFINKEEALYQWEKTSYPEVEVIKESIEPYQKLFTLVLKWQRTRKKWMDGSFLDLNGESIELEVEEYVREMYKMLKFFQQKQKKAELEKEKTAGLKKKTKEDQEDDKKESATILICSSVVKQVKEFKEYIPLVSILCNPGIRPRHWEQMSEIAGQDLTPDSGSTLRKILKQNLTPYLELFEGISAGASKEFGLERAMQTMVEAWDTVSFHYHPYRDTGVSILSSVDEIQTMLDDQIVKTQTMRGSPFIKPFETEIKVWEERLIGIQDTIDEWLKVQHQWLYLEPIFSSEDIMKQMPEEGRLFQIVNKHWREVMANCVKDPKILAATSLPGLFEKLQESYNLLENIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPTRVQPHLKKCFEGIAKLDFLPNLDIQAMYSSEGERVEFIQLISTSEARGAVEKWLVQVEDIMLRSVRDVINRSRLAYPETKRSQWVREWPGQVVLCASQMYWTVEVHEAIRSSANGLKKYYEQLQNQLNDIVELVRGKLPKQTRTTLGALVTIDVHARDVILELIEKGVSSETDFQWLAQLRYYWANDNVRVRIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIEMRLEYFDFEGTELRLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKFPDENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGISLPVADYKLFLECAHMCCENHNVQPVKVFLDKIIQTYEMMIVRHGFMLVGEPFAGKTKVLHVLADTLT-LMNELGYNEE--EKVIYQTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREFASSETPERKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSSQMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWTPLVLSWMKTLPDPLQAQDNSTLLQQLFEWLLPPTLVLLRKQCREVIPSSNSNTVVSLTRLFEMLL---------------------------------TRPLNEDPGNK----------NMRTWIMAAFAFALVWSVGGCCDTDSRSRFDKFLREMISGKAENCPIPAAVSKWECPFDEKGLVYDYSYEFKGK-------------------GRWVHWNESISNAP--LGDKNTKVQDIIVPTIDTVRYTYLMDLCIQYGRPLLLVGPTGTGKSIYVKEKLMNNLDKDLFLPFFINFSARTSANQTQNIIMSRLDKRRKGVYGPPMGKKCIIFVDDMNMPAKEVFGAQPPVELLRQYFDHGNWYDLKDTSKI-TLTDMQLISAMGPPGGGRNAVTPRFLRHFNICSINAFSDESMVRIFSNIVTFYL--RTNEFPPDCFTVGNQIVSATLEVYQKAIENLLPTPAKSHYTFNLRDFSRVVQGCLLLKKESLTNKRTMIRLFVHEIYRVFYDRLVDDQDRAWLFTLTSNIVKQHFKDNFDSVFEHLKDGNKPLCEENMRNLLFGDYMMPDVDESERLYAEVPSVERFGEVVETCLDEYNQTHKNRMNLVIFRYVLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATFMSNMTLFQPEISKSYGMNEWREDLKRLMKNAGVKGEKTVFLLTDAQIKDEAFLEDVDSILNTGEVPNIFAVDEKQEIMEAVRPFAQAGNKNLEFSPLALFAYFVTRCKENLHIVVAFSPIGDAFRNRLRQFPSLINCCTIDWFQPWPEEALERVANKFLETLDLSDLERQEVVP-----ICKTFHTSAIDLSNRFLLELGRHNYVTPTSYLELIAAFRLLLTQRRDTVMSAKNRYTNGLDKLAFAESQVSEMKKELVDLQPKLEQAKIDNTKIMEVTFIQSMIRFSVEAKSKLVRVDEEAATLKANEAQA--LKNECESDLAEAIPALEAALSALDTLKPADVTIVKAMKNPPAGVKLVMAAVCVMKDIKPERINDPSGTGQKILDYWGPSKKLLGD-MNFLRDLKEYDKDNIPAQVMHKIRSEYMTNPDFDPTKVVKASSAAEGLCRWITAMEVYDRVAKVVAPKKANLIVAQESLATTMALLNQKRAELKEVEDRLAALQKTLEEKTEEKAQLEFQVDLCARKLERAEKLIGGLGGEKNRWLKAANDLQCTYDNLTGDVLISAGVIAYLGAFTARFRHDCTKMWAQLCKSKKIPSSDD--FSLSKTLGDPIKIRAWNIAGLPTDSFSIDNGVIVSNSRRWPLMIDPQGQANKWVKNSERDHNLNVIKLTDADYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQVFKQGGVDCIRLGESVIEYSADFRFYITTKLRNPHYLPELATKVCLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDQILETLQSSEGNILEDESAIQILDAAKLMSNEITKKQQIAEKTEIEIAESREGYRAIAKHSSILFFTIADLANIDPMYQYSLNWFVNLYVNSILDSNKSKNLEKRLRYLIDYFTYNLYCNVCRSLFEKDKLLFSFLLCSNLLLAKKEIEYSEFMFLLTGGVGLQNSIPNPDPNWLPDKSWDEICRASDLPALNGIKYSFLP--------IYDSKEPFNTALPKPWCDKLNELQKMIIYRCLRPDKIEPAISKFVTDKLGKIFVEPPPFDLSKSYNDSNCTIPLVFVLSPGADPMASLLKFANDKNMGGSQFKSISLGQGQGPIAVKLIRSAMKDGTWVCLQNCHLAVSWMSTLEKICEDLSPDTCHPNFRLWLTSYPSPRFPVTILQNGVKMTNEPPTGLRLNLLQSYLSDPISDADFFAGCPKKELVWEKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFVNEYQEVPFEAITYLTGECNYGGRVTDDWDRRLLMTILADFYNKDVIDHPRYSFSPSGKY-HAPPKSIYEDYVEFIKKLPFTQHPEVFGMHENVDISKDLQQTKLLFDSLLLTQGGGSKGGGGSGGDSTLLDIANDILSKLPGNFDIESALVKFPVCYEESMNTVLVQEMQRYN---NTIRVSLQNLIKAIKGLVVMDAELEAVAGSLLVGKVPEKWAKCSYPSLKPLGSYVNDFLARLKFLQDWYDTQKPHVFWLSGFFFTQAFITGALQNYARKYSIPIDLLGFNYEVL--PFDTSDSSPEDGVYIHGLFLDGARWDKKSGVLAEQYPKVLFDAVPIIWIKP--STIISPHSVYVCPLYKTSERKGTLSTTGHSTNFVITMMLPTSKRPQHWIKRGVA 3863          
BLAST of Dynein heavy chain axonemal vs. Ensembl Xenopus
Match: plekhg3 (pleckstrin homology and RhoGEF domain containing G3 [Source:Xenbase;Acc:XB-GENE-6468932])

HSP 1 Score: 5287.62 bits (13715), Expect = 0.000e+0
Identity = 2574/4165 (61.80%), Postives = 3265/4165 (78.39%), Query Frame = 2
Query:  263 VGTFEIPDQLNSNID--VHGESTKIDIIIDFPEKSFEPKLQLMYFVAPGMIPRRVRLEREKRAYXXXXXXXXXXXXGNITSDYLIPKY----HPPNGKKFDGSWAP-YLFLETFDNEEYEIRNPDEWLAMGLEDGV--RKPVPGRALLPVTDDKHDVDIRDPSIDWTWQSVGVLDYDTDTKLWFVQKTDKSGRVIDDIGRPVIDGGLLPTGHFLEMSNQYWIPRIQLMFLAENPIKFSNRVIEAYQSRELHEALLRYHLYLDCMPMDGLGELDQSSLKRMIR--LSKDETPILKKQKGLEDAVQSLEKEVMVDYWRSMNTIILHKLVGENPQKFNYITLPKPELPKVPMKGTIPMPKYDWDTKFEEFAFYSLLTKPEVVQAMCKSQYECLEARNKQLFHVPLAKHMRLEEFEQTQSQATQQVSLFLKDTWIDNLQKFIRTSLRDSKKGWFNIYETDFYVYTKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKG-LYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAE-LHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            V +F+IP    + ID  V G +T++ +  DF +  +EPK+QL + VAPG  PR++ LER ++ Y +L +  LL S+G I S+ L+P++    + P+  +  GS  P YL LE FD+EEY++R   +WL++G E+G   RKP+PG+ALLPV D     D ++P + + W SVGVLDYD + KL+ V KT  +             G +L  GH      +YW+PRI+L+F AENP +F+ R++ A + R+  EALL Y+LY+DCMP +G   +   SL RM +  LS   T  +K+  G+   ++ LE E+ ++Y R+MN +   +LV  NPQKF Y+TLP      VP  G + +P+Y++      F F +LLT+PEV+ ++CK + EC    +  LFH  +AK +RLEEFEQTQSQ   QV LFLKD+W+  L+  +R+SLRD  KGW++++E ++ VY  SKL++ MEL+K+ +QDS+R+L  DSL +F  +I DAC + +   +  +W  DL+ S   P+KNPIFL+DLVLDN+G H+STPL+ F +  ++LFDK I A  +VPQLE+F+++D+     PLLESVG+ EP V++LR+++R  + KALIP+ SYA +Y K+L L N D+  Y+    R++++++ +AL IKL V+++L EKE L+  +P  II+GPF I+ E V+Q L++KR+ ++NA+L+LLA+ LRK  D   + F+ I+R +YE+PN+IEEL ELREW+  +P+ L   +E I K  +DY++I+EF Y+LS +DF+AKW ++ WP+K+ + +  + +   EDEE+FRK+QV D   F E+LD+L M VA   ++ DIT+AHE+ANEVRR+HKQL E+Q  A+L+NNRERLF  PVTNY+KL ++VK F+PFR+LW   SDW++ ++S MNDPL  +D+E +EK+VTE YK MHK +K F ++P+ QEVA  IK  IEEF+P+IPLIQGLRNPGMR RHWE+LS+++ I+I PK+ L F++CLEM LQDHI+ I+K+AE+AGKE+AIEQAL+KM  EW ++ F +L YK TGT+ILK  +E +QLLDDHIVMTQSM FSP+KKPFEERI+ WE  LR TQDV++EWL CQR WLYLEPIFSSEDINRQLPVEGKRY TM+R WRKIMK A +N  VI+LCP+ RLL +L+ECNKLLE VQKGLSEYLETKR +FPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFEN+A+L F+ DL+IT M+S EGE++   K+ YPTGNVE+W+ E+E +M+ S+R  I + +  Y + PRTEWVL WPGQV IAGCQT+WT++VS+AL+  DL   L+ +L  QL GL A+VRG ++++ R  LSALIVIEVHA+DV   +I EN+ ++NDFEWISQLRYYW  ++L +RAVNAEF YGYEYLGNT RLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKA AIQ VVFNCSDQLDFMAMGKFFKGLAS+GAWACFDEFNRIDIEVLSVVAQQI TIQKAQQQR+DRFMFEG+E+ L  +CAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYA+IAEISL+SFGF++A+ L+KKI TTFKLSSEQLSSQDHYDFGMRAVK+VISAAGNLKR+N TM+EELICLRAI+DVNVPKFL DDLKLF+GIVSDLFP I+EE IDYG L  +I+    +K LKDV GFV KCIQL+ETTVVRHGLMLVGPTGSGKT+CY+VL +AL+SLK   S  G  ++TVH Y+LNPKSITMGQLYGEFDL+THEWTDGILS+LIR G T+  PD+RWY+FDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKL E MTMMFEV DLAVASPATVSRCGMVYLEPSILGL PF ECW+R +PD I P  E+++ LF  +L +++ F+R +++E++ +T+  LT +++KL+D F  PF+P +                                KKF      P+E + +I E +ESWF FSLIWS G + D+  R  F T+LR KM ++ I + FPE+GLV+DY+ D  G           E+E   ++ I WV+WM +   + I PD  Y+DIIVPT+D VR+  +   LL +KKPV+CVGPTGTGKTL+I+DKL K  P EYIS F++FSA+T+ANQTQDLIDSKLDKRRKGVFGPP+G+Y IFFIDDLNMP+LE +G+QPPIEL+RQW D  GWYDRK IG F+ LVDINF+ +MGPPGGGRNP++ RL RHFN L F EL++ S   +F +IL  W+ ++ A  +  L E LV A I VY  I SQ+LPTPAKSHYTFNLRDLSKVFQGMLM +   +    Q+L+LW+HESCRVFQDRLVN++DR WF  L  GK+  +F   + +VV  +P+L+GDFMS   + K Y    + +K+ +VIEE +ED+NQINTAKM LVLF+DA++H+CRI+R++RQPLGNALLLG+GGSGRQSLT+LA++MA+Y+CFQIELSKNYG +EWR+D+K I+L AGL+N PI FLF+DTQIKDESFLED+NNILNSGDVPNLY  D+L++I   MKP+VQD+G Q TK NL +AY++RVR N+HTV+ MSPIGE+FR+RLRQFP+LV CCTIDWF +WP EAL+SVA  FL++IPEL+  E++I G++ MC +IHQSV+  S++Y  ELSR+NY+TP SYLELLGIFSK+  +K  E+K A+DR K+GLDKLL T E V K+QEELE+M+P LE+A +++  T ++I+ D+ +A+ T+  V  EEA A +KA+  + I DDAQ+DLDEALPAL  +L SLK LNKND+TEVRAM RPP GV+LVIE VCIMK +KPKK+ GDKPG KIDDYW+ GKGLLQDPGKFL+ LF +DKDNI D+VI+ I+PYI +E F PAAI +VS+ACTSICQWVRAM+KYHFVA+GV PKR+AL  + ++L  T+KIL  A+A+L+ VED I  LQ K   C  +++ELE+K + CE +L RADKLI GLS+E+ RWQD+V+NLE L+ N+ G++L+ AG++AYLG FTG YR ++ ++W+  L+   VP +++P+  L+ T GDPVKIR+WQI GLP DTLS+EN VI ++S+RW   IDPQGQANRWIKN++K+NGL+V KLSD+DFLRSLENAIRFGKP ++ENVGEELDPALEP+LLKQT+KQQG+ V++LGDA+IPYHDDFR YITTKLPNPHY PE+ TKVT++NFTLSPSGLEDQLLG VVAEERPDLE+AKNQLI+SNAKMRQELK+IED+IL RLS ++G+PVDD+DLI+ LEASK K+ EI+ KV +AEQTERDID TR +Y+PVAVRTQILFFCV+DL+ +DPMYQYSLEWFL+IF   I N+ +A+T+ +RI NIN YFTFSL+SNVCRSLFEKHKL+FSFLL  RIL ++G I + EWRFLL+GG+  +    NP PEW+++R W +I  L++L  FSK  E+  H Y  +++ + DS EPHRE+LPG W    D FQ +L+LRCLR DKVTNAMQD+V   LG+RFIEPQTADL  VYK+SSP TPLIF+LSPGTDPA+DLYKFA++MKFSKKLSAISLGQGQGPRAE +++++MERGKWVFFQNCHLAPSWMPSLERL+E ID DKVHRDFR+WLTSMPS +FPV ILQNGSK+T+EPPRG+KANLL++Y S SD  L   +K ++++ LLLSL LFHG  +ER+KFGPLGFNIPYEFTDGDLRICI+QL MFL EY+D+P+KVL+YTAG INYGGRVTDDWDRRC++++L  FY P V+TE + +S SGIY+QISP  D  GY+ YIRSLP+ND  E+FGLH+NANITFA NE+  LL  L+ LQP+  ++GG SR+E+VEE+S+ IL+ +P +  ++++  +YPVMY++SMNTVL+QEVIRYNRLL+++  +L DLLKA++G VVMS  LE M+NSLY+N VP+ W SKAYPSLKPLASWV+DL QRI F+Q WI +GIP  FWISG FFPQAFLTGTLQN+ARK +ISIDTISF FKV+ ++  E+T+ PS+GCYI GLFLEGARWD     L ESRPKEL+TEM VIWLIP   R    S IY CP+YKTLTRAGTLSTTGHSTN+V ++E+P+++ Q HWIKRGVA
Sbjct:   30 VTSFQIPSNFQTYIDKQVIGPTTEVLLKSDFAKGGYEPKVQLPFLVAPGQCPRKIELERRRQEYMKLDIAKLLISKG-IDSNLLMPRHTDAKNLPSIGQRTGSLLPTYLPLEVFDDEEYDVRTWTDWLSLGYEEGSTERKPIPGKALLPVDDVLGHDDPKNPKLVYEWCSVGVLDYDQERKLYLVHKTKCNY------------GVMLLYGHSTLNLYEYWVPRIRLLFCAENPRRFAKRIVAANKLRKKTEALLLYNLYIDCMPGNGRCVIPSESLNRMKQWLLS---TSHMKQDDGVLHQLKILEMEISMEYERTMNKLTFDQLVTSNPQKFAYVTLPDRVEEMVPEHGLVNVPEYNYAKNQAAFTFKTLLTRPEVITSLCKVRVECNRVSSMTLFHSSMAKCVRLEEFEQTQSQTFSQVQLFLKDSWVSTLKNAVRSSLRDVGKGWYDLHECNWEVYQMSKLRQLMELIKFNLQDSLRFLVQDSLVSFTQLIMDACCSVLSCTEDMDWGGDLVNSPYKPRKNPIFLLDLVLDNSGVHFSTPLENFELTLMSLFDKGILATHSVPQLEKFVLEDLFICGTPLLESVGLHEPPVEELRKDIRTAICKALIPLRSYAKQYEKYLELNNTDLETYI----RDFQSKNSSALNIKLAVQENLLEKERLDNALPSSIIVGPFQISIEGVKQNLSRKRRNLSNALLELLAKSLRKEMDDISDQFRAISRSVYEKPNSIEELTELREWMKGVPEKLKTLEEQITKVTSDYDVIDEFLYSLSQEDFSAKWNVIAWPNKVMVLMDSICEQHTEDEEKFRKIQVMDQTNFLERLDSLQMVVAGFSTHVDITRAHEIANEVRRVHKQLKESQQMALLYNNRERLFGLPVTNYDKLVRMVKAFQPFRDLWTTASDWMRWNESWMNDPLTTIDAEQLEKNVTESYKVMHKCIKQFRDIPACQEVAQDIKERIEEFRPYIPLIQGLRNPGMRNRHWELLSEQIQINIKPKANLNFTRCLEMNLQDHIDSIAKVAEIAGKEFAIEQALDKMENEWASVLFTILPYKETGTFILKSPEEASQLLDDHIVMTQSMSFSPFKKPFEERISTWEGKLRLTQDVLEEWLICQRSWLYLEPIFSSEDINRQLPVEGKRYQTMERTWRKIMKNAEENKQVISLCPEPRLLESLRECNKLLELVQKGLSEYLETKRAAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENVARLLFQHDLQITHMYSAEGEEVKLSKAIYPTGNVEDWLFEVEKVMKASVREYIERSIKVYPETPRTEWVLNWPGQVTIAGCQTFWTKDVSEALDAGDLSNRLFPQLESQLSGLVALVRGKLSRMQRSILSALIVIEVHAKDVAARLIEENVSSVNDFEWISQLRYYWARDDLYVRAVNAEFLYGYEYLGNTGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASSGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVDRFMFEGVEIPLVTTCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMIAEISLYSFGFNNAKILAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPTMNEELICLRAIRDVNVPKFLQDDLKLFSGIVSDLFPRIEEEHIDYGTLEEAIRKTCVQKNLKDVDGFVTKCIQLYETTVVRHGLMLVGPTGSGKTQCYKVLAAALTSLKGLPSVSGGTYETVHYYILNPKSITMGQLYGEFDLLTHEWTDGILSSLIRGGATSTDPDRRWYMFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLTPFTECWLRCMPDVIKPFTEKLESLFSHFLLDSIRFVRRSVKEMIASTDNNLTMSLLKLLDCFFQPFIPQE------------------------------GQKKF------PEEKLRRIEELIESWFFFSLIWSVGITGDSQGRVLFSTWLRDKMKSEKIAMLFPEQGLVHDYKLDDAGI-----SNASEEDEEDVQKPICWVNWMDSAGSFSIVPDTSYADIIVPTLDTVRMSHLLGMLLTNKKPVLCVGPTGTGKTLTITDKLLKNFPMEYISHFLMFSARTSANQTQDLIDSKLDKRRKGVFGPPLGRYYIFFIDDLNMPSLETYGAQPPIELLRQWMDHGGWYDRKQIGVFKQLVDINFLCAMGPPGGGRNPVSPRLTRHFNYLSFTELEDSSKSRIFSSILGSWLGKSGASAVQNLTEQLVSATIKVYNTITSQLLPTPAKSHYTFNLRDLSKVFQGMLMADASKMGDKYQLLKLWYHESCRVFQDRLVNEEDRSWFDELFKGKMQ-EFGASFHEVVPQQPVLFGDFMSPGSDAKAYQLIEDREKLHRVIEEYMEDYNQINTAKMKLVLFLDAIQHICRISRVLRQPLGNALLLGVGGSGRQSLTRLASNMAQYECFQIELSKNYGRSEWREDIKGILLKAGLQNTPITFLFTDTQIKDESFLEDINNILNSGDVPNLYGPDELDQIVTVMKPVVQDMGQQPTKANLMAAYTRRVRGNIHTVLCMSPIGEVFRSRLRQFPSLVTCCTIDWFDEWPAEALQSVASSFLSEIPELQSREDIIPGMIQMCVDIHQSVAVKSKQYLAELSRHNYITPKSYLELLGIFSKLIGKKLMEIKTAKDRMKSGLDKLLTTAEDVAKMQEELEVMRPLLEEAAQDTVTTMQKIQEDTVVAEATRGSVQVEEAKATEKAQTAQAIADDAQKDLDEALPALDAALASLKSLNKNDVTEVRAMQRPPVGVKLVIEAVCIMKGIKPKKVAGDKPGSKIDDYWEPGKGLLQDPGKFLEGLFKFDKDNIPDAVIKAIQPYIDNEEFQPAAIARVSKACTSICQWVRAMHKYHFVARGVEPKRQALREAQEDLAVTQKILDAAKARLRDVEDGIATLQAKYRDCVSKKEELEHKCEQCEQKLGRADKLITGLSDERQRWQDTVLNLENLLVNVAGDLLLCAGFLAYLGPFTGPYRTTLFNQWTKKLQELKVPCSEEPS--LIGTLGDPVKIRSWQIAGLPNDTLSVENGVITQYSQRWSHCIDPQGQANRWIKNMEKDNGLEVAKLSDRDFLRSLENAIRFGKPFMLENVGEELDPALEPVLLKQTYKQQGSTVLRLGDAVIPYHDDFRMYITTKLPNPHYPPEICTKVTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLILSNAKMRQELKDIEDQILLRLSTSQGNPVDDVDLIKVLEASKQKAGEIKVKVQVAEQTERDIDSTRRQYVPVAVRTQILFFCVSDLSNVDPMYQYSLEWFLSIFIAAIANSERAETVEKRIININTYFTFSLFSNVCRSLFEKHKLMFSFLLCVRILMNQGLIHMEEWRFLLSGGTASSL-AENPFPEWLTERAWRDIQALSALSNFSKITEQLTH-YAKEYRGLCDSPEPHREQLPGNWGQSLDSFQKILILRCLRGDKVTNAMQDYVCQHLGQRFIEPQTADLGAVYKESSPVTPLIFILSPGTDPAADLYKFAEEMKFSKKLSAISLGQGQGPRAEAMMRSSMERGKWVFFQNCHLAPSWMPSLERLIETIDPDKVHRDFRVWLTSMPSNQFPVSILQNGSKLTIEPPRGVKANLLRTYLSLSDAELQDCSKASQFKALLLSLSLFHGSTLERRKFGPLGFNIPYEFTDGDLRICISQLRMFLEEYSDIPYKVLRYTAGEINYGGRVTDDWDRRCLLSILQDFYQPPVLTEGHNFSVSGIYQQISPAYDLNGYLQYIRSLPLNDLTELFGLHENANITFAQNESFALLGSLVTLQPRAESSGG-SRDEMVEEISENILKKVPPLIPVQEVMAKYPVMYQESMNTVLVQEVIRYNRLLSVLTQTLHDLLKAMKGQVVMSSQLELMANSLYNNSVPEMWRSKAYPSLKPLASWVLDLLQRIQFLQKWISDGIPAAFWISGLFFPQAFLTGTLQNYARKHVISIDTISFDFKVLRESVSELTQRPSEGCYIYGLFLEGARWDKTSSVLAESRPKELYTEMAVIWLIPVPERKPATSGIYFCPIYKTLTRAGTLSTTGHSTNYVIAVELPSNQPQTHWIKRGVA 4127          
BLAST of Dynein heavy chain axonemal vs. Ensembl Xenopus
Match: plekhg3 (pleckstrin homology and RhoGEF domain containing G3 [Source:Xenbase;Acc:XB-GENE-6468932])

HSP 1 Score: 5278.76 bits (13692), Expect = 0.000e+0
Identity = 2572/4165 (61.75%), Postives = 3261/4165 (78.30%), Query Frame = 2
Query:  263 VGTFEIPDQLNSNID--VHGESTKIDIIIDFPEKSFEPKLQLMYFVAPGMIPRRVRLEREKRAYXXXXXXXXXXXXGNITSDYLIPKY----HPPNGKKFDGSWAP-YLFLETFDNEEYEIRNPDEWLAMGLEDGV--RKPVPGRALLPVTDDKHDVDIRDPSIDWTWQSVGVLDYDTDTKLWFVQKTDKSGRVIDDIGRPVIDGGLLPTGHFLEMSNQYWIPRIQLMFLAENPIKFSNRVIEAYQSRELHEALLRYHLYLDCMPMDGLGELDQSSLKRMIR--LSKDETPILKKQKGLEDAVQSLEKEVMVDYWRSMNTIILHKLVGENPQKFNYITLPKPELPKVPMKGTIPMPKYDWDTKFEEFAFYSLLTKPEVVQAMCKSQYECLEARNKQLFHVPLAKHMRLEEFEQTQSQATQQVSLFLKDTWIDNLQKFIRTSLRDSKKGWFNIYETDFYVYTKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKG-LYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAEL-HPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            V +F+IP    + ID  V G +T++ +  DF +  +EPK+QL + VAPG  PR++ LER ++ Y +L +  LL S+G I S+ L+P++    + P+  +  GS  P YL LE FD+EEY++R   +WL++G E+G   RKP+PG+ALLPV D     D ++P + + W SVGVLDYD + KL+ V K             P I    L          +YW+PRI+L+F AENP +F+ R++ A + R+  EALL Y+LY+DCMP +G   +   SL RM +  LS   T  +K+  G+   ++ LE E+ ++Y R+MN +   +LV  NPQKF Y+TLP      VP  G + +P+Y++      F F +LLT+PEV+ ++CK + EC    +  LFH  +AK +RLEEFEQTQSQ   QV LFLKD+W+  L+  +R+SLRD  KGW++++E ++ VY  SKL++ MEL+K+ +QDS+R+L  DSL +F  +I DAC + +   +  +W  DL+ S   P+KNPIFL+DLVLDN+G H+STPL+ F +  ++LFDK I A  +VPQLE+F+++D+     PLLESVG+ EP V++LR+++R  + KALIP+ SYA +Y K+L L N D+  Y+    R++++++ +AL IKL V+++L EKE L+  +P  II+GPF I+ E V+Q L++KR+ ++NA+L+LLA+ LRK  D   + F+ I+R +YE+PN+IEEL ELREW+  +P+ L   +E I K  +DY++I+EF Y+LS +DF+AKW ++ WP+K+ + +  + +   EDEE+FRK+QV D   F E+LD+L M VA   ++ DIT+AHE+ANEVRR+HKQL E+Q  A+L+NNRERLF  PVTNY+KL ++VK F+PFR+LW   SDW++ ++S MNDPL  +D+E +EK+VTE YK MHK +K F ++P+ QEVA  IK  IEEF+P+IPLIQGLRNPGMR RHWE+LS+++ I+I PK+ L F++CLEM LQDHI+ I+K+AE+AGKE+AIEQAL+KM  EW ++ F +L YK TGT+ILK  +E +QLLDDHIVMTQSM FSP+KKPFEERI+ WE  LR TQDV++EWL CQR WLYLEPIFSSEDINRQLPVEGKRY TM+R WRKIMK A +N  VI+LCP+ RLL +L+ECNKLLE VQKGLSEYLETKR +FPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFEN+A+L F+ DL+IT M+S EGE++   K+ YPTGNVE+W+ E+E +M+ S+R  I + +  Y + PRTEWVL WPGQV IAGCQT+WT++VS+AL+  DL   L+ +L  QL GL A+VRG ++++ R  LSALIVIEVHA+DV   +I EN+ ++NDFEWISQLRYYW  ++L +RAVNAEF YGYEYLGNT RLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKA AIQ VVFNCSDQLDFMAMGKFFKGLAS+GAWACFDEFNRIDIEVLSVVAQQI TIQKAQQQR+DRFMFEG+E+ L  +CAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYA+IAEISL+SFGF++A+ L+KKI TTFKLSSEQLSSQDHYDFGMRAVK+VISAAGNLKR+N TM+EELICLRAI+DVNVPKFL DDLKLF+GIVSDLFP I+EE IDYG L  +I+    +K LKDV GFV KCIQL+ETTVVRHGLMLVGPTGSGKT+CY+VL +AL+SLK   S  G  ++TVH Y+LNPKSITMGQLYGEFDL+THEWTDGILS+LIR G T+  PD+RWY+FDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKL E MTMMFEV DLAVASPATVSRCGMVYLEPSILGL PF ECW+R +PD I P  E+++ LF  +L +++ F+R +++E++ +T+  LT +++KL+D F  PF+P +                                KKF      P+E + +I E +ESWF FSLIWS G + D+  R  F T+LR KM ++ I + FPE+GLV+DY+ D  G           E+E   ++ I WV+WM +   + I PD  Y+DIIVPT+D VR+  +   LL +KKPV+CVGPTGTGKTL+I+DKL K  P EYIS F++FSA+T+ANQTQDLIDSKLDKRRKGVFGPP+G+Y IFFIDDLNMP+LE +G+QPPIEL+RQW D  GWYDRK IG F+ LVDINF+ +MGPPGGGRNP++ RL RHFN L F EL++ S   +F +IL  W+ + + E+   L E LV A I VY  I SQ+LPTPAKSHYTFNLRDLSKVFQGMLM +   +    Q+L+LW+HESCRVFQDRLVN++DR WF  L  GK+  +F   + +VV  +P+L+GDFMS   + K Y    + +K+ +VIEE +ED+NQINTAKM LVLF+DA++H+CRI+R++RQPLGNALLLG+GGSGRQSLT+LA++MA+Y+CFQIELSKNYG +EWR+D+K I+L AGL+N PI FLF+DTQIKDESFLED+NNILNSGDVPNLY  D+L++I   MKP+VQD+G Q TK NL +AY++RVR N+HTV+ MSPIGE+FR+RLRQFP+LV CCTIDWF +WP EAL+SVA  FL++IPEL+  E++I G++ MC +IHQSV+  S++Y  ELSR+NY+TP SYLELLGIFSK+  +K  E+K A+DR K+GLDKLL T E V K+QEELE+M+P LE+A +++  T ++I+ D+ +A+ T+  V  EEA A +KA+  + I DDAQ+DLDEALPAL  +L SLK LNKND+TEVRAM RPP GV+LVIE VCIMK +KPKK+ GDKPG KIDDYW+ GKGLLQDPGKFL+ LF +DKDNI D+VI+ I+PYI +E F PAAI +VS+ACTSICQWVRAM+KYHFVA+GV PKR+AL  + ++L  T+KIL  A+A+L+ VED I  LQ K   C  +++ELE+K + CE +L RADKLI GLS+E+ RWQD+V+NLE L+ N+ G++L+ AG++AYLG FTG YR ++ ++W+  L+   VP +++P+  L+ T GDPVKIR+WQI GLP DTLS+EN VI ++S+RW   IDPQGQANRWIKN++K+NGL+V KLSD+DFLRSLENAIRFGKP ++ENVGEELDPALEP+LLKQT+KQQG+ V++LGDA+IPYHDDFR YITTKLPNPHY PE+ TKVT++NFTLSPSGLEDQLLG VVAEERPDLE+AKNQLI+SNAKMRQELK+IED+IL RLS ++G+PVDD+DLI+ LEASK K+ EI+ KV +AEQTERDID TR +Y+PVAVRTQILFFCV+DL+ +DPMYQYSLEWFL+IF   I N+ +A+T+ +RI NIN YFTFSL+SNVCRSLFEKHKL+FSFLL  RIL ++G I + EWRFLL+GG+  +    NP PEW+++R W +I  L++L  FSK  E+  H Y  +++ + DS EPHRE+LPG W    D FQ +L+LRCLR DKVTNAMQD+V   LG+RFIEPQTADL  VYK+SSP TPLIF+LSPGTDPA+DLYKFA++MKFSKKLSAISLGQGQGPRAE +++++MERGKWVFFQNCHLAPSWMPSLERL+E ID DKVHRDFR+WLTSMPS +FPV ILQNGSK+T+EPPRG+KANLL++Y S SD  L   +K ++++ LLLSL LFHG  +ER+KFGPLGFNIPYEFTDGDLRICI+QL MFL EY+D+P+KVL+YTAG INYGGRVTDDWDRRC++++L  FY P V+TE + +S SGIY+QISP  D  GY+ YIRSLP+ND  E+FGLH+NANITFA NE+  LL  L+ LQP+  ++GG SR+E+VEE+S+ IL+ +P +  ++++  +YPVMY++SMNTVL+QEVIRYNRLL+++  +L DLLKA++G VVMS  LE M+NSLY+N VP+ W SKAYPSLKPLASWV+DL QRI F+Q WI +GIP  FWISG FFPQAFLTGTLQN+ARK +ISIDTISF FKV+ ++  E+T+ PS+GCYI GLFLEGARWD     L ESRPKEL+TEM VIWLIP   R    S IY CP+YKTLTRAGTLSTTGHSTN+V ++E+P+++ Q HWIKRGVA
Sbjct:   39 VTSFQIPSNFQTYIDKQVIGPTTEVLLKSDFAKGGYEPKVQLPFLVAPGQCPRKIELERRRQEYMKLDIAKLLISKG-IDSNLLMPRHTDAKNLPSIGQRTGSLLPTYLPLEVFDDEEYDVRTWTDWLSLGYEEGSTERKPIPGKALLPVDDVLGHDDPKNPKLVYEWCSVGVLDYDQERKLYLVHKATI---------MPCISAATLNL-------YEYWVPRIRLLFCAENPRRFAKRIVAANKLRKKTEALLLYNLYIDCMPGNGRCVIPSESLNRMKQWLLS---TSHMKQDDGVLHQLKILEMEISMEYERTMNKLTFDQLVTSNPQKFAYVTLPDRVEEMVPEHGLVNVPEYNYAKNQAAFTFKTLLTRPEVITSLCKVRVECNRVSSMTLFHSSMAKCVRLEEFEQTQSQTFSQVQLFLKDSWVSTLKNAVRSSLRDVGKGWYDLHECNWEVYQMSKLRQLMELIKFNLQDSLRFLVQDSLVSFTQLIMDACCSVLSCTEDMDWGGDLVNSPYKPRKNPIFLLDLVLDNSGVHFSTPLENFELTLMSLFDKGILATHSVPQLEKFVLEDLFICGTPLLESVGLHEPPVEELRKDIRTAICKALIPLRSYAKQYEKYLELNNTDLETYI----RDFQSKNSSALNIKLAVQENLLEKERLDNALPSSIIVGPFQISIEGVKQNLSRKRRNLSNALLELLAKSLRKEMDDISDQFRAISRSVYEKPNSIEELTELREWMKGVPEKLKTLEEQITKVTSDYDVIDEFLYSLSQEDFSAKWNVIAWPNKVMVLMDSICEQHTEDEEKFRKIQVMDQTNFLERLDSLQMVVAGFSTHVDITRAHEIANEVRRVHKQLKESQQMALLYNNRERLFGLPVTNYDKLVRMVKAFQPFRDLWTTASDWMRWNESWMNDPLTTIDAEQLEKNVTESYKVMHKCIKQFRDIPACQEVAQDIKERIEEFRPYIPLIQGLRNPGMRNRHWELLSEQIQINIKPKANLNFTRCLEMNLQDHIDSIAKVAEIAGKEFAIEQALDKMENEWASVLFTILPYKETGTFILKSPEEASQLLDDHIVMTQSMSFSPFKKPFEERISTWEGKLRLTQDVLEEWLICQRSWLYLEPIFSSEDINRQLPVEGKRYQTMERTWRKIMKNAEENKQVISLCPEPRLLESLRECNKLLELVQKGLSEYLETKRAAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENVARLLFQHDLQITHMYSAEGEEVKLSKAIYPTGNVEDWLFEVEKVMKASVREYIERSIKVYPETPRTEWVLNWPGQVTIAGCQTFWTKDVSEALDAGDLSNRLFPQLESQLSGLVALVRGKLSRMQRSILSALIVIEVHAKDVAARLIEENVSSVNDFEWISQLRYYWARDDLYVRAVNAEFLYGYEYLGNTGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASSGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVDRFMFEGVEIPLVTTCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMIAEISLYSFGFNNAKILAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPTMNEELICLRAIRDVNVPKFLQDDLKLFSGIVSDLFPRIEEEHIDYGTLEEAIRKTCVQKNLKDVDGFVTKCIQLYETTVVRHGLMLVGPTGSGKTQCYKVLAAALTSLKGLPSVSGGTYETVHYYILNPKSITMGQLYGEFDLLTHEWTDGILSSLIRGGATSTDPDRRWYMFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLTPFTECWLRCMPDVIKPFTEKLESLFSHFLLDSIRFVRRSVKEMIASTDNNLTMSLLKLLDCFFQPFIPQE------------------------------GQKKF------PEEKLRRIEELIESWFFFSLIWSVGITGDSQGRVLFSTWLRDKMKSEKIAMLFPEQGLVHDYKLDDAGI-----SNASEEDEEDVQKPICWVNWMDSAGSFSIVPDTSYADIIVPTLDTVRMSHLLGMLLTNKKPVLCVGPTGTGKTLTITDKLLKNFPMEYISHFLMFSARTSANQTQDLIDSKLDKRRKGVFGPPLGRYYIFFIDDLNMPSLETYGAQPPIELLRQWMDHGGWYDRKQIGVFKQLVDINFLCAMGPPGGGRNPVSPRLTRHFNYLSFTELEDSSKSRIFSSILGSWLEKGLWEIIENLTEQLVSATIKVYNTITSQLLPTPAKSHYTFNLRDLSKVFQGMLMADASKMGDKYQLLKLWYHESCRVFQDRLVNEEDRSWFDELFKGKMQ-EFGASFHEVVPQQPVLFGDFMSPGSDAKAYQLIEDREKLHRVIEEYMEDYNQINTAKMKLVLFLDAIQHICRISRVLRQPLGNALLLGVGGSGRQSLTRLASNMAQYECFQIELSKNYGRSEWREDIKGILLKAGLQNTPITFLFTDTQIKDESFLEDINNILNSGDVPNLYGPDELDQIVTVMKPVVQDMGQQPTKANLMAAYTRRVRGNIHTVLCMSPIGEVFRSRLRQFPSLVTCCTIDWFDEWPAEALQSVASSFLSEIPELQSREDIIPGMIQMCVDIHQSVAVKSKQYLAELSRHNYITPKSYLELLGIFSKLIGKKLMEIKTAKDRMKSGLDKLLTTAEDVAKMQEELEVMRPLLEEAAQDTVTTMQKIQEDTVVAEATRGSVQVEEAKATEKAQTAQAIADDAQKDLDEALPALDAALASLKSLNKNDVTEVRAMQRPPVGVKLVIEAVCIMKGIKPKKVAGDKPGSKIDDYWEPGKGLLQDPGKFLEGLFKFDKDNIPDAVIKAIQPYIDNEEFQPAAIARVSKACTSICQWVRAMHKYHFVARGVEPKRQALREAQEDLAVTQKILDAAKARLRDVEDGIATLQAKYRDCVSKKEELEHKCEQCEQKLGRADKLITGLSDERQRWQDTVLNLENLLVNVAGDLLLCAGFLAYLGPFTGPYRTTLFNQWTKKLQELKVPCSEEPS--LIGTLGDPVKIRSWQIAGLPNDTLSVENGVITQYSQRWSHCIDPQGQANRWIKNMEKDNGLEVAKLSDRDFLRSLENAIRFGKPFMLENVGEELDPALEPVLLKQTYKQQGSTVLRLGDAVIPYHDDFRMYITTKLPNPHYPPEICTKVTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLILSNAKMRQELKDIEDQILLRLSTSQGNPVDDVDLIKVLEASKQKAGEIKVKVQVAEQTERDIDSTRRQYVPVAVRTQILFFCVSDLSNVDPMYQYSLEWFLSIFIAAIANSERAETVEKRIININTYFTFSLFSNVCRSLFEKHKLMFSFLLCVRILMNQGLIHMEEWRFLLSGGTASSL-AENPFPEWLTERAWRDIQALSALSNFSKITEQLTH-YAKEYRGLCDSPEPHREQLPGNWGQSLDSFQKILILRCLRGDKVTNAMQDYVCQHLGQRFIEPQTADLGAVYKESSPVTPLIFILSPGTDPAADLYKFAEEMKFSKKLSAISLGQGQGPRAEAMMRSSMERGKWVFFQNCHLAPSWMPSLERLIETIDPDKVHRDFRVWLTSMPSNQFPVSILQNGSKLTIEPPRGVKANLLRTYLSLSDAELQDCSKASQFKALLLSLSLFHGSTLERRKFGPLGFNIPYEFTDGDLRICISQLRMFLEEYSDIPYKVLRYTAGEINYGGRVTDDWDRRCLLSILQDFYQPPVLTEGHNFSVSGIYQQISPAYDLNGYLQYIRSLPLNDLTELFGLHENANITFAQNESFALLGSLVTLQPRAESSGG-SRDEMVEEISENILKKVPPLIPVQEVMAKYPVMYQESMNTVLVQEVIRYNRLLSVLTQTLHDLLKAMKGQVVMSSQLELMANSLYNNSVPEMWRSKAYPSLKPLASWVLDLLQRIQFLQKWISDGIPAAFWISGLFFPQAFLTGTLQNYARKHVISIDTISFDFKVLRESVSELTQRPSEGCYIYGLFLEGARWDKTSSVLAESRPKELYTEMAVIWLIPVPERKPATSGIYFCPIYKTLTRAGTLSTTGHSTNYVIAVELPSNQPQTHWIKRGVA 4132          
BLAST of Dynein heavy chain axonemal vs. Ensembl Xenopus
Match: plekhg3 (pleckstrin homology and RhoGEF domain containing G3 [Source:Xenbase;Acc:XB-GENE-6468932])

HSP 1 Score: 5050.72 bits (13100), Expect = 0.000e+0
Identity = 2470/4051 (60.97%), Postives = 3122/4051 (77.07%), Query Frame = 2
Query:  707 DIRDPSIDWTWQSVGVLDYDTDTKLWFVQKTDKSGRVIDDIGRPVIDGGLLPTGHFLEMSNQYWIPRIQLMFLAENPIKFSNRVIEAYQSRELHEALLRYHLYLDCMPMDGLGELDQSSLKRMIR--LSKDETPILKKQKGLEDAVQSLEKEVMVDYWRSMNTIILHKLVGENPQKFNYITLPKPELPKVPMKGTIPMPKYDWDTKFEEFAFYSLLTKPEVVQAMCKSQYECLEARNKQLFHVPLAKHMRLEEFEQTQSQATQQVSLFLKDTWIDNLQKFIRTSLRDSKKGWFNIYETDFYVYTKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLD-------------EQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKG-LYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGG---------------TLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAE-LHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADK---------------LIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            D ++P + + W SVGVLDYD + KL+ V K   S          V+    L          +YW+PRI+L+F AENP +F+ R++ A + R+  EALL Y+LY+DCMP +G   +   SL RM +  LS   T  +K+  G+   ++ LE E+ ++Y R+MN +   +LV  NPQKF Y+TLP      VP  G + +P+Y++      F F +LLT+PEV+ ++CK + EC    +  LFH  +AK +RLEEFEQTQSQ   QV LFLKD+W+  L+  +R+SLRD  KGW++++E ++ VY  SKL++ MEL+K+ +QDS+R+L  DSL +F  +I DAC + +   +  +W  DL+ S   P+KNPIFL+DLVLDN+G H+STPL+ F +  ++LFDK I A  +VPQLE+F+++D+     PLLESVG+ EP V++LR+++R  + KALIP+ SYA +Y K                  ++++++ +AL IKL V+++L EKE L+  +P  II+GPF I+ E V+Q L++KR+ ++NA+L+LLA+ LRK  D   + F+ I+R +YE+PN+IEEL ELREW+  +P+ L              + +E I K  +DY++I+EF Y+LS +DF+AKW ++ WP+K+ + +  + +   EDEE+FRK+QV D   F E+LD+L M VA   ++ DIT+AHE+ANEVRR+HKQL E+Q  A+L+NNRERLF  PVTNY+KL ++VK F+PFR+LW   SDW++ ++S MNDPL  +D+E +EK+VTE YK MHK +K F ++P+ QEVA  IK  IEEF+P+IPLIQGLRNPGMR RHWE+LS+++ I+I PK+ L F++CLEM LQDHI+ I+K+AE+AGKE+AIEQAL+KM  EW ++ F +L YK TGT+ILK  +E +QLLDDHIVMTQSM FSP+KKPFEERI+ WE  LR TQDV++EWL CQR WLYLEPIFSSEDINRQLPVEGKRY TM+R WRKIMK A +N  VI+LCP+ RLL +L+ECNKLLE VQKGLSEYLETKR +FPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFEN+A+L F+ DL+IT M+S EGE++   K+ YPTGNVE+W+ E+E +M+ S+R  I + +  Y + PRTEWVL WPGQV IAGCQT+WT++VS+AL+  DL   L+ +L  QL GL A+VRG ++++ R  LSALIVIEVHA+DV   +I EN+ ++NDFEWISQLRYYW  ++L +RAVNAEF YGYEYLGNT RLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKA AIQ VVFNCSDQLDFMAMGKFFKGLAS+GAWACFDEFNRIDIEVLSVVAQQI TIQKAQQQR+         +     C  F+                 ALFRPVAMMVPDYA+IAEISL+SFGF++A+ L+KKI TTFKLSSEQLSSQDHYDFGMRAVK+VISAAGNLKR+N TM+EELICLRAI+DVNVPKFL DDLKLF+GIVSDLFP I+EE IDYG L  +I+    +K LKDV GFV KCIQL+ETTVVRHGLMLVGPTGSGKT+CY+VL +AL+SLK   S  G  ++TVH Y+LNPKSITMGQLYGEFDL+THEWTDGILS+LIR G T+  PD+RWY+FDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKL E MTMMFEV DLAVASPATVSRCGMVYLEPSILGL PF ECW+R +PD I P  E+++ LF  +L +++ F+R +++E++ +T+  LT +++KL+D F  PF+P +                                KKF      P+E + +I E +ESWF FSLIWS G + D+  R  F T+LR KM ++ I + FPE+GLV+DY+ D  G                +      +           I WV+WM +   + I PD  Y+DIIVPT+D VR+  +   LL +KKPV+CVGPTGTGKTL+I+DKL K  P EYIS F++FSA+T+ANQTQDLIDSKLDKRRKGVFGPP+G+Y IFFIDDLNMP+LE +G+QPPIEL+RQW D  GWYDRK IG F+ LVDINF+ +MGPPGGGRNP++ RL RHFN L F EL++ S   +F +IL  W+ ++ A  +  L E LV A I VY  I SQ+LPTPAKSHYTFNLRDLSKVFQGMLM +   +    Q+L+LW+HESCRVFQDRLVN++DR WF  L  GK+  +F   + +VV  +P+L+GDFMS   + K Y    + +K+ +VIEE +ED+NQINTAKM LVLF+DA++H+CRI+R++RQPLGNALLLG+GGSGRQSLT+LA++MA+Y+CFQIELSKNYG +EWR+D+K I+L AGL+N PI FLF+DTQIKDESFLED+NNILNSGDVPNLY  D+L++I   MKP+VQD+G Q TK NL +AY++RVR N+HTV+ MSPIGE+FR+RLRQFP+LV CCTIDWF +WP EAL+SVA  FL++IPEL+  E++I G++ MC +IHQSV+  S++Y  ELSR+NY+TP SYLELLGIFSK+  +K  E+K A+DR K+GLDKLL T E V K+QEELE+M+P LE+A +++  T ++I+ D+ +A+ T+  V  EEA A +KA+  + I DDAQ+DLDEALPAL  +L SLK LNKND+TEVRAM RPP GV+LVIE VCIMK +KPKK+ GDKPG KIDDYW+ GKGLLQDPGKFL+ LF +DKDNI D+VI+ I+PYI +E F PAAI +VS+ACTSICQWVRAM+KYHFVA+GV PKR+AL  + ++L  T+KIL  A+A+L+ VED I  LQ K   C  +++ELE+K + CE +L RADK               LI GLS+E+ RWQD+V+NLE L+ N+ G++L+ AG++AYLG FTG YR ++ ++W+  L+   VP +++P+  L+ T GDPVKIR+WQI GLP DTLS+EN VI ++S+RW   IDPQGQANRWIKN++K+NGL+V KLSD+DFLRSLENAIRFGKP ++ENVGEELDPALEP+LLKQT+KQQG+ V++LGDA+IPYHDDFR YITTKLPNPHY PE+ TKVT++NFTLSPSGLEDQLLG VVAEERPDLE+AKNQLI+SNAKMRQELK+IED+IL RLS ++G+PVDD+DLI+ LEASK K+ EI+ KV +AEQTERDID TR +Y+PVAVRTQILFFCV+DL+ +DPMYQYSLEWFL+IF   I N+ +A+T+ +RI NIN YFTFSL+SNVCRSLFEKHKL+FSFLL  RIL ++G I + EWRFLL+GG+  +    NP PEW+++R W +I  L++L  FSK  E+  H Y  +++ + DS EPHRE+LPG W    D FQ +L+LRCLR DKVTNAMQD+V   LG+RFIEPQTADL  VYK+SSP TPLIF+LSPGTDPA+DLYKFA++MKFSKKLSAISLGQGQGPRAE +++++MERGKWVFFQNCHLAPSWMPSLERL+E ID DKVHRDFR+WLTSMPS +FPV ILQNGSK+T+EPPRG+KANLL++Y S SD  L   +K ++++ LLLSL LFHG  +ER+KFGPLGFNIPYEFTDGDLRICI+QL MFL EY+D+P+KVL+YTAG INYGGRVTDDWDRRC++++L  FY P V+TE + +S SGIY+QISP  D  GY+ YIRSLP+ND  E+FGLH+NANITFA NE+  LL  L+ LQP+  ++GG SR+E+VEE+S+ IL+ +P +  ++++  +YPVMY++SMNTVL+QEVIRYNRLL+++  +L DLLKA++G VVMS  LE M+NSLY+N VP+ W SKAYPSLKPLASWV+DL QRI F+Q WI +GIP  FWISG FFPQAFLTGTLQN+ARK +ISIDTISF FKV+ ++  E+T+ PS+GCYI GLFLEGARWD     L ESRPKEL+TEM VIWLIP   R    S IY CP+YKTLTRAGTLSTTGHSTN+V ++E+P+++ Q HWIKRGVA
Sbjct:  245 DPKNPKLVYEWCSVGVLDYDQERKLYLVHKFLFS----------VVSAATLNL-------YEYWVPRIRLLFCAENPRRFAKRIVAANKLRKKTEALLLYNLYIDCMPGNGRCVIPSESLNRMKQWLLS---TSHMKQDDGVLHQLKILEMEISMEYERTMNKLTFDQLVTSNPQKFAYVTLPDRVEEMVPEHGLVNVPEYNYAKNQAAFTFKTLLTRPEVITSLCKVRVECNRVSSMTLFHSSMAKCVRLEEFEQTQSQTFSQVQLFLKDSWVSTLKNAVRSSLRDVGKGWYDLHECNWEVYQMSKLRQLMELIKFNLQDSLRFLVQDSLVSFTQLIMDACCSVLSCTEDMDWGGDLVNSPYKPRKNPIFLLDLVLDNSGVHFSTPLENFELTLMSLFDKGILATHSVPQLEKFVLEDLFICGTPLLESVGLHEPPVEELRKDIRTAICKALIPLRSYAKQYEK------------------DFQSKNSSALNIKLAVQENLLEKERLDNALPSSIIVGPFQISIEGVKQNLSRKRRNLSNALLELLAKSLRKEMDDISDQFRAISRSVYEKPNSIEELTELREWMKGVPEKLKTLEVVGGEIHMKIKLEEQITKVTSDYDVIDEFLYSLSQEDFSAKWNVIAWPNKVMVLMDSICEQHTEDEEKFRKIQVMDQTNFLERLDSLQMVVAGFSTHVDITRAHEIANEVRRVHKQLKESQQMALLYNNRERLFGLPVTNYDKLVRMVKAFQPFRDLWTTASDWMRWNESWMNDPLTTIDAEQLEKNVTESYKVMHKCIKQFRDIPACQEVAQDIKERIEEFRPYIPLIQGLRNPGMRNRHWELLSEQIQINIKPKANLNFTRCLEMNLQDHIDSIAKVAEIAGKEFAIEQALDKMENEWASVLFTILPYKETGTFILKSPEEASQLLDDHIVMTQSMSFSPFKKPFEERISTWEGKLRLTQDVLEEWLICQRSWLYLEPIFSSEDINRQLPVEGKRYQTMERTWRKIMKNAEENKQVISLCPEPRLLESLRECNKLLELVQKGLSEYLETKRAAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENVARLLFQHDLQITHMYSAEGEEVKLSKAIYPTGNVEDWLFEVEKVMKASVREYIERSIKVYPETPRTEWVLNWPGQVTIAGCQTFWTKDVSEALDAGDLSNRLFPQLESQLSGLVALVRGKLSRMQRSILSALIVIEVHAKDVAARLIEENVSSVNDFEWISQLRYYWARDDLYVRAVNAEFLYGYEYLGNTGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASSGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRV---------IFCCDLCFCFLI-------------RWIALFRPVAMMVPDYAMIAEISLYSFGFNNAKILAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPTMNEELICLRAIRDVNVPKFLQDDLKLFSGIVSDLFPRIEEEHIDYGTLEEAIRKTCVQKNLKDVDGFVTKCIQLYETTVVRHGLMLVGPTGSGKTQCYKVLAAALTSLKGLPSVSGGTYETVHYYILNPKSITMGQLYGEFDLLTHEWTDGILSSLIRGGATSTDPDRRWYMFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLTPFTECWLRCMPDVIKPFTEKLESLFSHFLLDSIRFVRRSVKEMIASTDNNLTMSLLKLLDCFFQPFIPQE------------------------------GQKKF------PEEKLRRIEELIESWFFFSLIWSVGITGDSQGRVLFSTWLRDKMKSEKIAMLFPEQGLVHDYKLDDAGISNASEEDEEDVQKPVIIKTSLMKHGFRVCKLNVNICWVNWMDSAGSFSIVPDTSYADIIVPTLDTVRMSHLLGMLLTNKKPVLCVGPTGTGKTLTITDKLLKNFPMEYISHFLMFSARTSANQTQDLIDSKLDKRRKGVFGPPLGRYYIFFIDDLNMPSLETYGAQPPIELLRQWMDHGGWYDRKQIGVFKQLVDINFLCAMGPPGGGRNPVSPRLTRHFNYLSFTELEDSSKSRIFSSILGSWLGKSGASAVQNLTEQLVSATIKVYNTITSQLLPTPAKSHYTFNLRDLSKVFQGMLMADASKMGDKYQLLKLWYHESCRVFQDRLVNEEDRSWFDELFKGKMQ-EFGASFHEVVPQQPVLFGDFMSPGSDAKAYQLIEDREKLHRVIEEYMEDYNQINTAKMKLVLFLDAIQHICRISRVLRQPLGNALLLGVGGSGRQSLTRLASNMAQYECFQIELSKNYGRSEWREDIKGILLKAGLQNTPITFLFTDTQIKDESFLEDINNILNSGDVPNLYGPDELDQIVTVMKPVVQDMGQQPTKANLMAAYTRRVRGNIHTVLCMSPIGEVFRSRLRQFPSLVTCCTIDWFDEWPAEALQSVASSFLSEIPELQSREDIIPGMIQMCVDIHQSVAVKSKQYLAELSRHNYITPKSYLELLGIFSKLIGKKLMEIKTAKDRMKSGLDKLLTTAEDVAKMQEELEVMRPLLEEAAQDTVTTMQKIQEDTVVAEATRGSVQVEEAKATEKAQTAQAIADDAQKDLDEALPALDAALASLKSLNKNDVTEVRAMQRPPVGVKLVIEAVCIMKGIKPKKVAGDKPGSKIDDYWEPGKGLLQDPGKFLEGLFKFDKDNIPDAVIKAIQPYIDNEEFQPAAIARVSKACTSICQWVRAMHKYHFVARGVEPKRQALREAQEDLAVTQKILDAAKARLRDVEDGIATLQAKYRDCVSKKEELEHKCEQCEQKLGRADKPCFAQPHQPCHTHQGLITGLSDERQRWQDTVLNLENLLVNVAGDLLLCAGFLAYLGPFTGPYRTTLFNQWTKKLQELKVPCSEEPS--LIGTLGDPVKIRSWQIAGLPNDTLSVENGVITQYSQRWSHCIDPQGQANRWIKNMEKDNGLEVAKLSDRDFLRSLENAIRFGKPFMLENVGEELDPALEPVLLKQTYKQQGSTVLRLGDAVIPYHDDFRMYITTKLPNPHYPPEICTKVTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLILSNAKMRQELKDIEDQILLRLSTSQGNPVDDVDLIKVLEASKQKAGEIKVKVQVAEQTERDIDSTRRQYVPVAVRTQILFFCVSDLSNVDPMYQYSLEWFLSIFIAAIANSERAETVEKRIININTYFTFSLFSNVCRSLFEKHKLMFSFLLCVRILMNQGLIHMEEWRFLLSGGTASSL-AENPFPEWLTERAWRDIQALSALSNFSKITEQLTH-YAKEYRGLCDSPEPHREQLPGNWGQSLDSFQKILILRCLRGDKVTNAMQDYVCQHLGQRFIEPQTADLGAVYKESSPVTPLIFILSPGTDPAADLYKFAEEMKFSKKLSAISLGQGQGPRAEAMMRSSMERGKWVFFQNCHLAPSWMPSLERLIETIDPDKVHRDFRVWLTSMPSNQFPVSILQNGSKLTIEPPRGVKANLLRTYLSLSDAELQDCSKASQFKALLLSLSLFHGSTLERRKFGPLGFNIPYEFTDGDLRICISQLRMFLEEYSDIPYKVLRYTAGEINYGGRVTDDWDRRCLLSILQDFYQPPVLTEGHNFSVSGIYQQISPAYDLNGYLQYIRSLPLNDLTELFGLHENANITFAQNESFALLGSLVTLQPRAESSGG-SRDEMVEEISENILKKVPPLIPVQEVMAKYPVMYQESMNTVLVQEVIRYNRLLSVLTQTLHDLLKAMKGQVVMSSQLELMANSLYNNSVPEMWRSKAYPSLKPLASWVLDLLQRIQFLQKWISDGIPAAFWISGLFFPQAFLTGTLQNYARKHVISIDTISFDFKVLRESVSELTQRPSEGCYIYGLFLEGARWDKTSSVLAESRPKELYTEMAVIWLIPVPERKPATSGIYFCPIYKTLTRAGTLSTTGHSTNYVIAVELPSNQPQTHWIKRGVA 4193          

HSP 2 Score: 108.227 bits (269), Expect = 4.135e-22
Identity = 65/152 (42.76%), Postives = 99/152 (65.13%), Query Frame = 2
Query:  263 VGTFEIPDQLNSNID--VHGESTKIDIIIDFPEKSFEPKLQLMYFVAPGMIPRRVRLEREKRAYXXXXXXXXXXXXGNITSDYLIPKY----HPPNGKKFDGSWAP-YLFLETFDNEEYEIRNPDEWLAMGLEDGV--RKPVPGRALLPVTD 691
            V +F+IP    + ID  V G +T++ +  DF +  +EPK+QL + VAPG  PR++ LER ++ Y +L +  LL S+G I S+ L+P++    + P+  +  GS  P YL LE FD+EEY++R   +WL++G E+G   RKP+PG+ALLPV D
Sbjct:   30 VTSFQIPSNFQTYIDKQVIGPTTEVLLKSDFAKGGYEPKVQLPFLVAPGQCPRKIELERRRQEYMKLDIAKLLISKG-IDSNLLMPRHTDAKNLPSIGQRTGSLLPTYLPLEVFDDEEYDVRTWTDWLSLGYEEGSTERKPIPGKALLPVDD 180          
BLAST of Dynein heavy chain axonemal vs. Ensembl Xenopus
Match: olfm4 (olfactomedin 4 [Source:Xenbase;Acc:XB-GENE-5725072])

HSP 1 Score: 3146.68 bits (8157), Expect = 0.000e+0
Identity = 1736/3944 (44.02%), Postives = 2455/3944 (62.25%), Query Frame = 2
Query: 1130 DAVQSLEKEVMVDYWRSMNTIILHKLVGENPQKFNYITLPKPELPKVPMKGTIPMPKYDWDTKFEEFAFYSLLTKPEVVQAMCKSQYECLEARNKQLFHVPLAKHMRLEEFEQTQS-QATQQVSLFLKDTWIDNLQKFIRTSLRDSK----KGWFNIYETDFYVYTK----------SKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRE-TLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIP--DMLDEQQEVIDK-----CLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGE--KIVFEKSTYPT-GNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALET--RDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYP-HRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQL--------------------IFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPE-YISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIM---RAVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWF----KNLLVGKLNSDFNQKYEDVV----------KIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTN------LFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKI-QGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKI-EPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAP-EWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKF-SKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSY--TSFSD-DFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQV-MTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            ++++ L  E+  DY  S+   I+  ++ +  +K  Y T        +P +  I +    W   F      +  T  E + A+  +    L+     L+H    + +RL + ++  S Q + ++S+F         Q  +   +  +K    K WF   +  FY   K           KL+ F       M   ++ L L S+ ++ ++I              + P+ +L       ++P F++ L+LDN    +    +++    +N++D  I+A+  VP++E  +  +        L+ +  EE  ++K +  ++E   K++ +PME   L Y+K+  L ++     V++FL    A+ HT  EI  EV K+      ++    ++I +G F ++ + + + L K+ +A++  ++  +    ++     C+ F+ I  K    P++  EL +L+ +I  +    M++ +Q+++D       L DY +       L+N  F+       W  ++     + ++ + E  E+F++        F E+L+N    V    SY D+ +  +   + + ++ +L +A       N  E  F    + Y +  K+     P+  L+   S++   + S M  P  +V+ ++VE+ V  ++++++K  K FNE PS   +  +IK  +EEFK ++PLIQ + NPG+R RHW+ +S  +G SI P+      K +E+ LQ  +E    I+E A KE+++E+A+ KM  EW+ ++F +  Y+ TGTYIL   D+I  LLDDH+V TQ+M  SP+ K FE  I +WE+ L   Q+++DEWL+ Q  WLYLEPIFSS DI  Q+P EG+R++T+D+ WR +MK    +  V+T+    ++L   K+ N+ LE + KGL+EYLE KR  FPRF+FLS+DELLEILS+TKDPT VQPHL+KCFE IA ++F   L+IT + S EGE  ++V   ST    G VE+W++E+E  M +S+  +IG+ +  Y + PR +WV +WPGQ V+   Q +WTQEV  +++   + L+    K  +Q+D + A+VRG ++K  R+TL AL+V++VHARDV+ +++ + + + NDFEW+SQLRYYW E +L+ + +NA   YGYEYLGNT RLVITPLTDRCY TL GAL+L  GGAP GPAGTGKTETTKDL KA A QCVVFNCSD LD++A+GKFFKGL S GAWACFDEFNRID+EVLSVVAQQI TIQ+      +  +FEG EL L P+CAVFITMNPGYAGR+ELPDNLKALFR VAMMVPDYA+IAEI L+S GF  AR LS KIV T++L SEQLSSQ HYD+GMRAVKSV++AAGNLK +    DEE++ LR+I DVN+PKFL  DL LF GI SDLFP +K    DY   + +I+   +   L+  + F +K +Q++E  +VRHG M+VG    GKT  Y VL +AL+ + ++   D +  Q     VLNPKSITMGQLYG+FD ++HEW+DGIL+   R   ++  PD++W IFDGPVDAVWIENMNTVLDDNKKLCL SGEII++  +M+++FE  DL VASPATVSRCGM+Y+EP +LG  P +  W+  LP  +   H++ ++ LFD  +   +  +R   +E+ PT++  L  +++ LMD  +  F  SD S+    S+++                                     I   +E  FLFSLIWS G SC  D R KFD  LR  +   L                      +P P+E  VYDY+F                 +    R   W   +++ P   I  +M +++IIVPT+D VR   +   L   +K  + VGPTGTGK+  I D L   +  E Y    I FSA+TTA QTQ++I SKLDKRRKGVFGPP+GK  + F+DD+NMPA EV+G+QPP+EL+RQW D   WYD K     + LVDI  + +MGP GGGRNPIT R +RHFN +  NE  ++SM T+F  IL + +        E   L   ++ + + VY      +LPTPAKSHY FNLRD S+V QG+ +  PE+  S   + RLW HE  RV+ DRLV++ DR W     + ++   +  DFN+ ++ +            +  L++ DF  +  E+  Y E  + +K+  V+E +LE+FN I+   MNLVLF  A+ H+CRI+RI++QP  +ALL+G+GGSGRQSLT+LA HMA+Y  FQ+E+SK+YG  EWR+DLK I+  +       VFLF+D+QIK ESFLED+NN+LN+G+VPNL++ D+ + I   M+ I  D     TK        LF+ +  R R  LH V+ MSPIG+ FR RLR+FPALVNCCTIDWF  WP++AL++VA +FL D+   E+SEEV  G + MCK  H S  N S+++R EL RYNYVTPTSYLEL+  F  +  +K+ E+ + + R + GL+KL      V  +Q ELE ++PQL+ A +E       IER+S    +T+ VV  +EAVA ++A   + I+D+   DL +ALP L+ +L +L  L   DIT V++M  PP GV+LV+E +CI+K VKP KI      G KI+D+W   K +L +  KFL SL  YDKDNI  + +  I + YI +  F P  +   S A   +C+WV AM  Y  VAK VAPK+  L ++  EL+   + LK+ +A LK V+D++  L++KLE   +++ +LEN+ DLC  +L RA++LIGGL  EK RW  + + L  L  N++G++L+S+G VAY G FT  YR    +EW+   K+  +P ++    +L ++ G+PVKIR W I GLP D+ SI+N +I+  +RRWPL IDPQGQAN+W+KN++K N L VIKLSD DF+R+LEN I+FG P L+ENVGEELDP LEP+LLKQTFKQ G+V I+LGD+ I Y  DFRFYITTKL NPHY PE S KVT++NF ++P G++DQLLG+VVA ERPDLE+ K  LI+  A+ +++LKEIEDKIL  LS +EG+ ++D   I+ L +SK  ++EI  K  +AE+TE+ ID TR  Y P+A+ + ILFF +ADLA I+PMYQYSL WF+N+F   I N+ K++ L +R+  + ++FT+SLY NVCRSLFEK KLLFSF L   +++HE  ID  EW+FLL GG     D P+  P  W+  + W+E+  L ++  F    ++F+ +  + +K ++DSLEPH    P +W +   +FQ +L++RCLR DK+   +Q+FV+ +LG+ FIEP   DL+  + DS    PLIFVLSPG DP + L KFADD  F   KLS++SLGQGQGP A  + + A++ G WV  QNCHLA SWMP LE++ E+++ D  H DFRLWLTS PSP FPV +LQNG KMT E P+G+++N+++SY     SD +F  S  K  E++ LL  LC FH ++ ER+KFGPLG+NIPYEF + D+RI + QL MFL +Y +VP+  LQY  G  NYGGRVTDDWDRR + ++L+ FYN ++    +YI+  SGIY    P  D+  Y+ Y ++LP+N +PEIFG++ NA+IT   +ET  L D++L  Q + S  G KS +E+V EVS +IL  +P  F+ E   +RYP  Y QSMNTVL+QE+ R+N+LL+ I+ S  ++ KAI+GLVVMS  LE + +S+   K+P  W  K+YPSLKPL S+V D   R+ F+Q W +NG PPVFW+SGFFF QAFLTG  QN+ARK  I ID + F F+V+     E    P DG YI GLFL+GARWD    +L ES PK L+  +PV+WL PC    IP    Y  PVYKT  R GTLSTTGHSTNFV ++ +P+DK Q+HWI RGVA
Sbjct:   49 ESIEMLSDEIREDYLLSVKKAIVDFVLKDPRKKEEYKT------SNIPHRAEIEIVPKPWKKSF----LVNCNTIKENLNAINPTMAAVLD-----LWHSSFGQ-LRLVDTDEFHSRQESMELSIF---------QNLVTRHIDSAKDKLLKKWFPEIQNIFYQGNKRKQIPSSSNYKKLESFFNCAATLMNGQLQSLALVSIQDYTDLI-------------VQPPDSVLAY-----EHPGFIIRLILDNTSIKFKPDFNEYETALLNVYDMMIKAVNVVPRVETKLYSEWVNISKSTLKPIIPEEI-LEKHKWAVKEFVAKESFLPMEHLKL-YDKYNFLISKQADLDVDQFL----AEEHTFEEIMREVLKYKALTSEIQYTSRKFIRLGMFELHCDELIRALTKRSEAISGKLVAKMFSVHQEVNKILCDEFERIAEKALSTPSSTHELMDLKAYIAKVEAQHMVEMEQKLVDAKNRLVFLVDYAIFSPSDIRLNNSTFH-------WHSRMGDIFEEHKRIVKEKTEQFQEELKLRCEKFVEELENCAKQVEEFQSYGDMQEVTKYLKKAQTLNSKLDQAVDKIDQLNAEEEAFGWGASQYPQRKKIQDALNPYLRLYEITSEFNAKYKSWMEGPYTSVNPDLVEQDVGNYWRSLYKLEKTFNESPSALSLTAKIKTKVEEFKEYLPLIQIVCNPGLRDRHWDSMSAIVGYSIKPQEDTNMMKFIEINLQPFLEKFEGISEAASKEFSLEKAMEKMICEWDKIEFGLHPYRETGTYILSSVDDIQMLLDDHLVKTQTMRGSPFIKAFENEIREWESKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFSTVDKTWRDLMKQVLLDKHVLTVVTIEKMLEKFKKSNEFLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIANVEFTDVLDITHIKSSEGEVVQLVNTISTSKARGQVEKWLVEVETAMIQSVHKVIGEAIEAYPKTPRIDWVKEWPGQTVLCVSQCFWTQEVQTSIQKGQQALEEYLEKNNKQIDDIVALVRGTLSKQNRVTLGALVVLDVHARDVLASLVKKQVNDENDFEWLSQLRYYWEEGHLQTKMINAGLQYGYEYLGNTPRLVITPLTDRCYRTLFGALNLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINTGSNLLVFEGTELKLNPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVRARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNEDEEILLLRSIIDVNLPKFLSQDLPLFEGITSDLFPGVKLPKADYQVFMDAIKENCQNMNLQMTSFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAAALNDICEKGLADENKVQIT---VLNPKSITMGQLYGQFDPVSHEWSDGILAVSYRAFASSTSPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMSLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPIMLSWLNVLPAGLSQMHKKFIEGLFDRMVPPCLQMIRKCAKELSPTSDTNLVRSLMNLMDCMMDEF--SDESLVQNMSERE-------------------------------------ICSWLEGIFLFSLIWSVGGSCKEDDRVKFDRLLREIIEGPLSEESRTRFKILHPVDPPEKPFTVPIPKENTVYDYKF----------------VKQDVGRWELWTEALSSAPS--IPREMMFNEIIVPTLDTVRYTELMNLLTTHQKSAVFVGPTGTGKSTYIIDFLLNRLDKETYKPLLINFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKKTVVFVDDVNMPAREVYGAQPPVELLRQWLDHWNWYDLKDCSMIK-LVDIQIMCAMGPAGGGRNPITPRFLRHFNTVTINEFDDNSMYTIFSRILDWHLTIRYNFPNEYKALTPQIIHSTMAVYKEALKHLLPTPAKSHYLFNLRDFSRVIQGICLSRPETSDSPLLIKRLWVHEVLRVYFDRLVDNGDRSWLVGYIEEVVKSHMREDFNKLFQHLDFDGDGKVQEDDLRSLMFCDFHDLKREDTNYKEINDVEKLRLVVESHLEEFNNISKKTMNLVLFRFAIEHICRISRILKQPRSHALLVGVGGSGRQSLTRLAVHMADYRLFQVEISKSYGNNEWREDLKLILRKSTEGEMQGVFLFTDSQIKKESFLEDINNLLNAGEVPNLFAVDEKQEICERMRQI--DRQRDKTKQTDGSPLALFNLFIDRCRDQLHVVLAMSPIGDAFRDRLRKFPALVNCCTIDWFQPWPEDALQAVATRFLEDV---EISEEVRNGCIDMCKSFHTSTINLSDRFRSELQRYNYVTPTSYLELISTFKTLLQKKQTEVMKMKRRYEVGLEKLESASSQVATMQSELEALQPQLKVASKEVDEMMVVIERESIEVAKTEKVVKADEAVANEQAMAAKAIKDECDSDLAQALPILESALAALDTLTAQDITVVKSMKSPPSGVKLVMEAICILKGVKPDKIPDPSGSGKKIEDFWGPAKRVLGE-MKFLQSLHEYDKDNIPPAYMNIIRKQYITNAEFVPEKVRNASTAAEGLCKWVIAMDSYDKVAKVVAPKKIKLNQAESELKVAMEGLKKKQAALKEVQDKLAKLEQKLEENKQKKADLENQVDLCSKKLDRAEQLIGGLGGEKTRWSLTAIELGKLYINLIGDILVSSGIVAYQGAFTSSYRQMQTNEWTMLCKSKNIPCSED--FSLANSLGEPVKIRAWNIAGLPSDSFSIDNGIIISNARRWPLMIDPQGQANKWVKNMEKTNSLHVIKLSDPDFVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSVCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALILQGAENKRQLKEIEDKILEVLSSSEGNILEDETAIKILSSSKALASEISVKQAVAEETEKKIDATRMGYRPIAIHSSILFFSIADLANIEPMYQYSLTWFINLFVMSIDNSEKSEDLQKRLQILKDHFTYSLYENVCRSLFEKDKLLFSFCLTANLMKHEQLIDEEEWKFLLTGGI--GLDNPHSNPCTWLPQKSWDEVCRLDNILLFKGIRKDFM-RLRDGWKAVYDSLEPHHSTFPPDWQEKLGQFQRMLMIRCLRPDKIIPMVQEFVSSYLGKPFIEPPPFDLSKAFGDSHCCAPLIFVLSPGADPMAALLKFADDQGFGGGKLSSLSLGQGQGPIALRMTEKAIKEGSWVVLQNCHLATSWMPMLEKVCEELNPDTTHPDFRLWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRSNIIRSYLMDPISDPEFFTSCKKLPEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDMRISVQQLHMFLNQYEEVPYDALQYMTGECNYGGRVTDDWDRRALRSILNKFYNIEMNKNPNYIFDSSGIYYA-PPDGDYDSYIEYTKTLPLNSSPEIFGMNANADITKDQSETQQLFDNILLTQSRSSGGGAKSSDEVVFEVSADILSKLPSNFDTESAMRRYPTTYTQSMNTVLVQEMGRFNKLLSTIRDSCINIQKAIKGLVVMSADLEEVVSSILKGKIPGMWMKKSYPSLKPLGSYVSDFLARLKFLQDWYENGTPPVFWLSGFFFTQAFLTGAQQNYARKYTIPIDLLGFDFEVLEDK--EYKHAPEDGVYIHGLFLDGARWDRKTKKLGESFPKILYDTVPVMWLKPCKRTDIPNRPCYIAPVYKTSERRGTLSTTGHSTNFVIAMTLPSDKPQEHWIGRGVA 3861          
BLAST of Dynein heavy chain axonemal vs. Ensembl Xenopus
Match: olfm4 (olfactomedin 4 [Source:Xenbase;Acc:XB-GENE-5725072])

HSP 1 Score: 3146.3 bits (8156), Expect = 0.000e+0
Identity = 1743/3989 (43.70%), Postives = 2475/3989 (62.05%), Query Frame = 2
Query:  998 LRYHLYLD-CMPMDGLGELDQSSLKRMIRLSKDETPILKKQKGLEDAVQSLEKEVMVDYWRSMNTIILHKLVGENPQKFNYITLPKPELPKVPMKGTIPMPKYDWDTKFEEFAFYSLLTKPEVVQAMCKSQYECLEARNKQLFHVPLAKHMRLEEFEQTQS-QATQQVSLFLKDTWIDNLQKFIRTSLRDSK----KGWFNIYETDFYVYTK----------SKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRE-TLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIP--DMLDEQQEVIDK-----CLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGE--KIVFEKSTYPT-GNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALET--RDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYP-HRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQL--------------------IFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPE-YISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIM---RAVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWF----KNLLVGKLNSDFNQKYEDVV----------KIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTN------LFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKI-QGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKI-EPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAP-EWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKF-SKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSY--TSFSD-DFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQV-MTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            LRY+ Y+   +  + +  ++ S L+ +++L  +     +      ++++ L  E+  DY  S+   I+  ++ +  +K  Y T        +P +  I +    W   F      +  T  E + A+  +    L+     L+H    + +RL + ++  S Q + ++S+F         Q  +   +  +K    K WF   +  FY   K           KL+ F       M   ++ L L S+ ++ ++I              + P+ +L       ++P F++ L+LDN    +    +++    +N++D  I+A+  VP++E  +  +        L+ +  EE  ++K +  ++E   K++ +PME   L Y+K+  L ++     V++FL    A+ HT  EI  EV K+      ++    ++I +G F ++ + + + L K+ +A++  ++  +    ++     C+ F+ I  K    P++  EL +L+ +I  +    M++ +Q+++D       L DY +       L+N  F+       W  ++     + ++ + E  E+F++        F E+L+N    V    SY D+ +  +   + + ++ +L +A       N  E  F    + Y +  K+     P+  L+   S++   + S M  P  +V+ ++VE+ V  ++++++K  K FNE PS   +  +IK  +EEFK ++PLIQ + NPG+R RHW+ +S  +G SI P+      K +E+ LQ  +E    I+E A KE+++E+A+ KM  EW+ ++F +  Y+ TGTYIL   D+I  LLDDH+V TQ+M  SP+ K FE  I +WE+ L   Q+++DEWL+ Q  WLYLEPIFSS DI  Q+P EG+R++T+D+ WR +MK    +  V+T+    ++L   K+ N+ LE + KGL+EYLE KR  FPRF+FLS+DELLEILS+TKDPT VQPHL+KCFE IA ++F   L+IT + S EGE  ++V   ST    G VE+W++E+E  M +S+  +IG+ +  Y + PR +WV +WPGQ V+   Q +WTQEV  +++   + L+    K  +Q+D + A+VRG ++K  R+TL AL+V++VHARDV+ +++ + + + NDFEW+SQLRYYW E +L+ + +NA   YGYEYLGNT RLVITPLTDRCY TL GAL+L  GGAP GPAGTGKTETTKDL KA A QCVVFNCSD LD++A+GKFFKGL S GAWACFDEFNRID+EVLSVVAQQI TIQ+      +  +FEG EL L P+CAVFITMNPGYAGR+ELPDNLKALFR VAMMVPDYA+IAEI L+S GF  AR LS KIV T++L SEQLSSQ HYD+GMRAVKSV++AAGNLK +    DEE++ LR+I DVN+PKFL  DL LF GI SDLFP +K    DY   + +I+   +   L+  + F +K +Q++E  +VRHG M+VG    GKT  Y VL +AL+ + ++   D +  Q     VLNPKSITMGQLYG+FD ++HEW+DGIL+   R   ++  PD++W IFDGPVDAVWIENMNTVLDDNKKLCL SGEII++  +M+++FE  DL VASPATVSRCGM+Y+EP +LG  P +  W+  LP  +   H++ ++ LFD  +   +  +R   +E+ PT++  L  +++ LMD  +  F  SD S+    S+++                                     I   +E  FLFSLIWS G SC  D R KFD  LR  +   L                      +P P+E  VYDY+F                 +    R   W   +++ P   I  +M +++IIVPT+D VR   +   L   +K  + VGPTGTGK+  I D L   +  E Y    I FSA+TTA QTQ++I SKLDKRRKGVFGPP+GK  + F+DD+NMPA EV+G+QPP+EL+RQW D   WYD K     + LVDI  + +MGP GGGRNPIT R +RHFN +  NE  ++SM T+F  IL + +        E   L   ++ + + VY      +LPTPAKSHY FNLRD S+V QG+ +  PE+  S   + RLW HE  RV+ DRLV++ DR W     + ++   +  DFN+ ++ +            +  L++ DF  +  E+  Y E  + +K+  V+E +LE+FN I+   MNLVLF  A+ H+CRI+RI++QP  +ALL+G+GGSGRQSLT+LA HMA+Y  FQ+E+SK+YG  EWR+DLK I+  +       VFLF+D+QIK ESFLED+NN+LN+G+VPNL++ D+ + I   M+ I  D     TK        LF+ +  R R  LH V+ MSPIG+ FR RLR+FPALVNCCTIDWF  WP++AL++VA +FL D+   E+SEEV  G + MCK  H S  N S+++R EL RYNYVTPTSYLEL+  F  +  +K+ E+ + + R + GL+KL      V  +Q ELE ++PQL+ A +E       IER+S    +T+ VV  +EAVA ++A   + I+D+   DL +ALP L+ +L +L  L   DIT V++M  PP GV+LV+E +CI+K VKP KI      G KI+D+W   K +L +  KFL SL  YDKDNI  + +  I + YI +  F P  +   S A   +C+WV AM  Y  VAK VAPK+  L ++  EL+   + LK+ +A LK V+D++  L++KLE   +++ +LEN+ DLC  +L RA++LIGGL  EK RW  + + L  L  N++G++L+S+G VAY G FT  YR    +EW+   K+  +P ++    +L ++ G+PVKIR W I GLP D+ SI+N +I+  +RRWPL IDPQGQAN+W+KN++K N L VIKLSD DF+R+LEN I+FG P L+ENVGEELDP LEP+LLKQTFKQ G+V I+LGD+ I Y  DFRFYITTKL NPHY PE S KVT++NF ++P G++DQLLG+VVA ERPDLE+ K  LI+  A+ +++LKEIEDKIL  LS +EG+ ++D   I+ L +SK  ++EI  K  +AE+TE+ ID TR  Y P+A+ + ILFF +ADLA I+PMYQYSL WF+N+F   I N+ K++ L +R+  + ++FT+SLY NVCRSLFEK KLLFSF L   +++HE  ID  EW+FLL GG     D P+  P  W+  + W+E+  L ++  F    ++F+ +  + +K ++DSLEPH    P +W +   +FQ +L++RCLR DK+   +Q+FV+ +LG+ FIEP   DL+  + DS    PLIFVLSPG DP + L KFADD  F   KLS++SLGQGQGP A  + + A++ G WV  QNCHLA SWMP LE++ E+++ D  H DFRLWLTS PSP FPV +LQNG KMT E P+G+++N+++SY     SD +F  S  K  E++ LL  LC FH ++ ER+KFGPLG+NIPYEF + D+RI + QL MFL +Y +VP+  LQY  G  NYGGRVTDDWDRR + ++L+ FYN ++    +YI+  SGIY    P  D+  Y+ Y ++LP+N +PEIFG++ NA+IT   +ET  L D++L  Q + S  G KS +E+V EVS +IL  +P  F+ E   +RYP  Y QSMNTVL+QE+ R+N+LL+ I+ S  ++ KAI+GLVVMS  LE + +S+   K+P  W  K+YPSLKPL S+V D   R+ F+Q W +NG PPVFW+SGFFF QAFLTG  QN+ARK  I ID + F F+V+     E    P DG YI GLFL+GARWD    +L ES PK L+  +PV+WL PC    IP    Y  PVYKT  R GTLSTTGHSTNFV ++ +P+DK Q+HWI RGVA
Sbjct:   26 LRYNYYIHHGIDTEHVAPMEDSWLENVLKLVPEHLNTYR------ESIEMLSDEIREDYLLSVKKAIVDFVLKDPRKKEEYKT------SNIPHRAEIEIVPKPWKKSF----LVNCNTIKENLNAINPTMAAVLD-----LWHSSFGQ-LRLVDTDEFHSRQESMELSIF---------QNLVTRHIDSAKDKLLKKWFPEIQNIFYQGNKRKQIPSSSNYKKLESFFNCAATLMNGQLQSLALVSIQDYTDLI-------------VQPPDSVLAY-----EHPGFIIRLILDNTSIKFKPDFNEYETALLNVYDMMIKAVNVVPRVETKLYSEWVNISKSTLKPIIPEEI-LEKHKWAVKEFVAKESFLPMEHLKL-YDKYNFLISKQADLDVDQFL----AEEHTFEEIMREVLKYKALTSEIQYTSRKFIRLGMFELHCDELIRALTKRSEAISGKLVAKMFSVHQEVNKILCDEFERIAEKALSTPSSTHELMDLKAYIAKVEAQHMVEMEQKLVDAKNRLVFLVDYAIFSPSDIRLNNSTFH-------WHSRMGDIFEEHKRIVKEKTEQFQEELKLRCEKFVEELENCAKQVEEFQSYGDMQEVTKYLKKAQTLNSKLDQAVDKIDQLNAEEEAFGWGASQYPQRKKIQDALNPYLRLYEITSEFNAKYKSWMEGPYTSVNPDLVEQDVGNYWRSLYKLEKTFNESPSALSLTAKIKTKVEEFKEYLPLIQIVCNPGLRDRHWDSMSAIVGYSIKPQEDTNMMKFIEINLQPFLEKFEGISEAASKEFSLEKAMEKMICEWDKIEFGLHPYRETGTYILSSVDDIQMLLDDHLVKTQTMRGSPFIKAFENEIREWESKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFSTVDKTWRDLMKQVLLDKHVLTVVTIEKMLEKFKKSNEFLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIANVEFTDVLDITHIKSSEGEVVQLVNTISTSKARGQVEKWLVEVETAMIQSVHKVIGEAIEAYPKTPRIDWVKEWPGQTVLCVSQCFWTQEVQTSIQKGQQALEEYLEKNNKQIDDIVALVRGTLSKQNRVTLGALVVLDVHARDVLASLVKKQVNDENDFEWLSQLRYYWEEGHLQTKMINAGLQYGYEYLGNTPRLVITPLTDRCYRTLFGALNLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINTGSNLLVFEGTELKLNPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVRARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNEDEEILLLRSIIDVNLPKFLSQDLPLFEGITSDLFPGVKLPKADYQVFMDAIKENCQNMNLQMTSFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAAALNDICEKGLADENKVQIT---VLNPKSITMGQLYGQFDPVSHEWSDGILAVSYRAFASSTSPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMSLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPIMLSWLNVLPAGLSQMHKKFIEGLFDRMVPPCLQMIRKCAKELSPTSDTNLVRSLMNLMDCMMDEF--SDESLVQNMSERE-------------------------------------ICSWLEGIFLFSLIWSVGGSCKEDDRVKFDRLLREIIEGPLSEESRTRFKILHPVDPPEKPFTVPIPKENTVYDYKF----------------VKQDVGRWELWTEALSSAPS--IPREMMFNEIIVPTLDTVRYTELMNLLTTHQKSAVFVGPTGTGKSTYIIDFLLNRLDKETYKPLLINFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKKTVVFVDDVNMPAREVYGAQPPVELLRQWLDHWNWYDLKDCSMIK-LVDIQIMCAMGPAGGGRNPITPRFLRHFNTVTINEFDDNSMYTIFSRILDWHLTIRYNFPNEYKALTPQIIHSTMAVYKEALKHLLPTPAKSHYLFNLRDFSRVIQGICLSRPETSDSPLLIKRLWVHEVLRVYFDRLVDNGDRSWLVGYIEEVVKSHMREDFNKLFQHLDFDGDGKVQEDDLRSLMFCDFHDLKREDTNYKEINDVEKLRLVVESHLEEFNNISKKTMNLVLFRFAIEHICRISRILKQPRSHALLVGVGGSGRQSLTRLAVHMADYRLFQVEISKSYGNNEWREDLKLILRKSTEGEMQGVFLFTDSQIKKESFLEDINNLLNAGEVPNLFAVDEKQEICERMRQI--DRQRDKTKQTDGSPLALFNLFIDRCRDQLHVVLAMSPIGDAFRDRLRKFPALVNCCTIDWFQPWPEDALQAVATRFLEDV---EISEEVRNGCIDMCKSFHTSTINLSDRFRSELQRYNYVTPTSYLELISTFKTLLQKKQTEVMKMKRRYEVGLEKLESASSQVATMQSELEALQPQLKVASKEVDEMMVVIERESIEVAKTEKVVKADEAVANEQAMAAKAIKDECDSDLAQALPILESALAALDTLTAQDITVVKSMKSPPSGVKLVMEAICILKGVKPDKIPDPSGSGKKIEDFWGPAKRVLGE-MKFLQSLHEYDKDNIPPAYMNIIRKQYITNAEFVPEKVRNASTAAEGLCKWVIAMDSYDKVAKVVAPKKIKLNQAESELKVAMEGLKKKQAALKEVQDKLAKLEQKLEENKQKKADLENQVDLCSKKLDRAEQLIGGLGGEKTRWSLTAIELGKLYINLIGDILVSSGIVAYQGAFTSSYRQMQTNEWTMLCKSKNIPCSED--FSLANSLGEPVKIRAWNIAGLPSDSFSIDNGIIISNARRWPLMIDPQGQANKWVKNMEKTNSLHVIKLSDPDFVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSVCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALILQGAENKRQLKEIEDKILEVLSSSEGNILEDETAIKILSSSKALASEISVKQAVAEETEKKIDATRMGYRPIAIHSSILFFSIADLANIEPMYQYSLTWFINLFVMSIDNSEKSEDLQKRLQILKDHFTYSLYENVCRSLFEKDKLLFSFCLTANLMKHEQLIDEEEWKFLLTGGI--GLDNPHSNPCTWLPQKSWDEVCRLDNILLFKGIRKDFM-RLRDGWKAVYDSLEPHHSTFPPDWQEKLGQFQRMLMIRCLRPDKIIPMVQEFVSSYLGKPFIEPPPFDLSKAFGDSHCCAPLIFVLSPGADPMAALLKFADDQGFGGGKLSSLSLGQGQGPIALRMTEKAIKEGSWVVLQNCHLATSWMPMLEKVCEELNPDTTHPDFRLWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRSNIIRSYLMDPISDPEFFTSCKKLPEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDMRISVQQLHMFLNQYEEVPYDALQYMTGECNYGGRVTDDWDRRALRSILNKFYNIEMNKNPNYIFDSSGIYYA-PPDGDYDSYIEYTKTLPLNSSPEIFGMNANADITKDQSETQQLFDNILLTQSRSSGGGAKSSDEVVFEVSADILSKLPSNFDTESAMRRYPTTYTQSMNTVLVQEMGRFNKLLSTIRDSCINIQKAIKGLVVMSADLEEVVSSILKGKIPGMWMKKSYPSLKPLGSYVSDFLARLKFLQDWYENGTPPVFWLSGFFFTQAFLTGAQQNYARKYTIPIDLLGFDFEVLEDK--EYKHAPEDGVYIHGLFLDGARWDRKTKKLGESFPKILYDTVPVMWLKPCKRTDIPNRPCYIAPVYKTSERRGTLSTTGHSTNFVIAMTLPSDKPQEHWIGRGVA 3877          
BLAST of Dynein heavy chain axonemal vs. Ensembl Mouse
Match: Dnah1 (dynein, axonemal, heavy chain 1 [Source:MGI Symbol;Acc:MGI:107721])

HSP 1 Score: 5395.48 bits (13995), Expect = 0.000e+0
Identity = 2645/4222 (62.65%), Postives = 3310/4222 (78.40%), Query Frame = 2
Query:  119 KYPEVKQRGYYSEILSDGAIEQLENVTHGPPEVQNLLSQTIHYENTPKVGTFEIPDQLNSNID--VHGESTKIDIIIDFPEKSFEPKLQLMYFVAPGMIPRRVRLEREKRAYXXXXXXXXXXXXGNITSDYLIPKY----HPPNGKKFDGSWAP-YLFLETFDNEEYEIRNPDEWLAMGLEDGV--RKPVPGRALLPVTDDKHDVDIRDPSIDWTWQSVGVLDYDTDTKLWFVQKTDKSGRVIDDIGRPVIDGGLLPTGHFLEMSNQYWIPRIQLMFLAENPIKFSNRVIEAYQSRELHEALLRYHLYLDCMPMDGLGELDQSSLKRMIRLSKDETPILKKQKGLEDAVQSLEKEVMVDYWRSMNTIILHKLVGENPQKFNYITLPKPELPKVPMKGTIPMPKYDWDTKFEEFAFYSLLTKPEVVQAMCKSQYECLEARNKQLFHVPLAKHMRLEEFEQTQSQATQQVSLFLKDTWIDNLQKFIRTSLRDSKKGWFNIYETDFYVYTKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKG-LYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAE------------LHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            KYP +KQRG+YS+ILS G +++L NV  GP   QNL+ Q    + TPKV +F IP+     ++  + G +T++    DFP +S+EPK+Q+ + V PG  PR++ +ER K+ Y  L +E LL SEG I S+ L+P++    HP   ++      P YL L+ FDNEE++ R P EWL MGLE G   RKPVPG+ALLP  DD    D ++  +D+ W  VGVLDYD + KL+ VQKTDK G V D++G P+++GG+ P G    ++ QYW+PRIQL+F AE+P  F+ RV++A   R+  EALL Y+LY+DCMP +G   +++ SL + I+     TP ++K + + + +  L +EV +DY RSMN I   ++V  NP+ F+Y+TLP+ E  KVP +G + +P+Y +  + E+F F SLLT+PEV+ A+ K + EC +  +  LFH  L+K+ RLEEFEQ QSQ   QV +FLKD+WI  L+  +R SLRD  KGW+N+YET++ VY  SKL+K MEL+KY +QD++R+L  DSL +F   I DAC + ++     +W  DL+ S   P+KNP+F+VDLVLDN+G HYSTPL+ F ++ +NLFDK I A   VPQLE+ +M+DI  + +PLLESVG+ EP V++LR N+   + KA++P+++YA EY K+L L N DI+     FL+ Y+ Q  +A E++  V  HL EKEIL+  +P  IIIGPFYIN +NV+Q L+KKRKA+A ++LD+LA+ L K  D  CE F++I+RK+YE+PN+IEELAELR+W+  IP+ L   +E I K ++DYE+++EF+YNL+ DDFN KW    WP KI   I  V Q  +EDEE+FRK+Q+ D   F EKL+ L + VA    + +I +AHE+ANEVRR+ KQL + Q  A+L+NNRER+F  P+TNY+KLS++VK+F+P+ +LW   SDW++  +S MNDPL A+D+E +EK+V E +KTMHK VK F ++P+ QEVA  I+  IEEFKP+IPLIQGLRNPGMR RHWE+LS+E+ I++ PK+ LTF++CLEM LQDHIE ISK+AEVAGKEYAIEQAL+KM  EW ++ F VL YK T TYILK  DE +QLLDDHIVMTQSM FSPYKKPFE+RI  WET L+ TQ+V++EWL CQR WLYLEPIFSSEDI RQLPVE KRY TM+R+WRKIMK A++N  VI +C D RLL +L++CNKLL+ VQKGLSEYLETKR +FPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIA+L F++DLEIT M+S EGE++    S YP+ NVE+W+LE+E  M+ S+  II   +  Y  + RTEWVL WPGQV IAGCQTYWT EV++ALE  ++   L+ +L +QL  L A+VRG ++++ RM LSALIVIEVHA+DVV+ +I EN+ +++DFEWISQLRYYW +++L IRAVNAEF YGYEYLGN+ RLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKA AIQ VVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQI TIQKAQQQR++RFMFEG+E+ L PSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYA+IAEISL+SFGF++A  L+KKI TTFKLSSEQLSSQDHYDFGMRAVK+VISAAGNLKR+N TM+EELICLRAI+DVNVPKFL +DLKLF+GIVSDLFP IKEE  DYG L  +I+ +  K  LKDV GF+ KCIQL+ETTVVRHGLMLVGPTGSGK+ CY VL +A++ LK + S  G  ++ V+ YVLNPKSITMGQLYGEFDL+THEWTDGI S+LIR G  A+  +K+WY+FDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKL E MTMMFEV DLAVASPATVSRCGMVYLEPSILGL PFVECW++ LP  I P+ E+ + LF  YLE +++F+R+ ++E++ +TN  LT +++KL+D F  PF+P                      + LK               +IP E ++ I E +E WF+FSL+WS GA+ D  SR  F  +LR KM  + + L FPE+GLVYDYR D  G  S     E+++EE  + +++ WV WM     + + PD  Y +IIVPT+D V++  +   LL + KPV+C+GPTGTGKTL++S+KL KY+P EYIS F+ FSA+T+ANQTQDLIDSKLDKRRKGVFGPP+G+  IFFIDDLNMPALE +G+QPPIEL+RQW D  GWYDRK IG F++LVDINF+ +MGPPGGGRN IT RL RHFN L F E+ E S K +F  IL+ W+   + E            +  L E LV A I+VY  I SQ+LPTPAKSHYTFNLRDLSKVFQGMLM EP  +    Q+LRLW+HE+CRVF+DRLVN++DR WF  LL  ++  +F   +  V   +P+LYGDFMS   + K Y       KM++VIEE +ED+NQINTAK+ LVLF+DA+ H+CRI+R +RQ LGNALLLG+GGSGR SLT+LA+HMAEY+CFQIELSKNYG++EWR+D+K+++L AGL+N PI FLFSDTQIK+ESFLED+NN+LNSGD+PN+YS D+ ++I   M+P +Q+ GLQ TK NL +AY+ RVR N+H V+ MSPIGE+FRARLRQFP+LVNCCTIDWF++WP EAL+SVA  FL++IPELE SEEVI+GL+ +C  IHQSV++   +Y  EL+R+NYVTP SYLELL IFS +  +KK ELK A++R K+GLDKLL T E V K+QEELEIM+P LE+A +++  T E+I+ D+ +A+ET+  V  EE  A +KA + + I DDAQ+DLDEALPAL  +L SL+ LNKND+TEVRAM RPP GV+LVIE VCIMK +KPKK+ G+KPG K+DDYW+ GKGLLQDPG+FL+SLF +DKDNI ++VI+ I+PYI +E F PAAI KVS+ACTSICQWVRAM+KYHFVAK V PKR+AL  +  +LE T++IL+EA+  L  VED I  +Q K   C  +++ELE K + CE RL RADKLI GL++EK+RWQ++V NLE +++NI G+VL++AG+VAYLG FTG+YR ++   W   L  + VPHT KP   L+ T G+PVKIR+WQI GLP DTLS+EN VI +FS+RW  FIDPQGQAN+WIKN+++E+GLDV KLSD+DFLRS+ENAIRFGKPCL+ENVGEELDPALEP+LLKQT+KQQG +V+KLGD +IPYH+DFR YITTKLPNPHY+PE+STK+T++NFTLSPSGLEDQLLG VVAEERPDLE+AKNQLIVSNAKMRQELK+IED+ILYRLS +EG+PVDD++LI+ LEASK+K+ EI+AKV IAEQTE+DID TR  YIPVAVRTQILFFCV+DLA +DPMYQYSLEWFLNIF +GI N+ +AD L +RI NIN Y TFSLYSNVCRSLFEKHKL+F+FLL  RI+ +EGKI+ AEWR+LL+GGS++     NPAP+W+SDR W +IL L++LP F+ F  +F+  YL++F+ IFDS EPHRE LPG W    D FQ LL+LRCLR DKVTNAMQDFVA  L  RFIEPQTA+L+ V+K+S+ TTPLIFVLSPGTDPA+DLYKFA++MKFSKK SAISLGQGQGPRAE +++N++ERGKWVFFQNCHLAPSWMP+LERL+E I+ DKVHRDFRLWLTS+PS KFPV ILQNGSKMT+EPPRG+KANLLKSY S SDDFL+S  K  E++ LLLSLCLFHG  +ER+KFGPLGFNIPYEFTDGDLRICI+QL MFL EY D+P+KVL+YTAG INYGGRVTDDWDRRCVMN+L  FYNP V++ ++ YS SGIY QI P  D  GY++YI+SLP+ND PEIFGLHDNANITFA NET  L + +L+LQPK S+ GG+SREE+VE+V++ IL  +P    +++++K++PV+YE+SMNTVL+QEVIRYN+LL +I  +L D+LKAI+GLVVMS  LE MS SLY+N VP+ W SKAYPSLKPLASW++DL  R+ F+ +WI++GIPPVFWISGFFFPQAFLTGTLQNFARK +ISIDTI+F FKV+ +A  EI E P  GCYI GLFLEGARWD    QL ESRPKEL+TEM VIWL+P ANR +   + Y CP+YKTLTRAGTLSTTGHSTN+V ++E+P+++ Q+HWIKRGVA
Sbjct:   73 KYPLMKQRGFYSDILSPGTLDKLGNVCCGPYMSQNLIRQADLDKFTPKVDSFVIPEDFQERVEQQIIGATTRLLTQTDFPLQSYEPKVQVPFQVLPGQCPRKIEIERRKQQYLRLDIEQLLTSEG-IDSNKLMPRHPDLQHPQTIEQGRDPLFPIYLPLKVFDNEEFDCRTPTEWLNMGLEPGSQNRKPVPGKALLPTDDDLGHEDPKNQELDYRWCEVGVLDYDEEKKLYLVQKTDKRGLVRDEMGMPILNGGITPAGRPPLLATQYWVPRIQLLFCAEDPRVFTQRVVQANALRKYTEALLMYNLYVDCMPTEGRRVINEQSLSK-IKQWALSTPRMRKGQSVLEHLSCLAREVNLDYERSMNKINFDQIVSSNPETFSYVTLPEKEEEKVPNQGLVSVPEYPFREQKEDFTFVSLLTRPEVITALSKVRAECNKVTSMSLFHSSLSKYSRLEEFEQIQSQTFSQVQMFLKDSWISTLKVAMRGSLRDMSKGWYNLYETNWEVYLMSKLRKLMELIKYMLQDTLRFLVQDSLGSFTQFIGDACCSVLECVDDMDWGEDLVNSPYKPRKNPLFIVDLVLDNSGVHYSTPLEHFEMILLNLFDKGILATHAVPQLEKLVMEDIFISGDPLLESVGLHEPLVEELRANITNAMHKAMMPLQAYAKEYRKYLELNNNDIST----FLKTYQTQCPSAEEVREVVITHLKEKEILDNSLPSSIIIGPFYINVDNVKQSLSKKRKALATSMLDILAKNLHKEVDSICEEFRSISRKIYEKPNSIEELAELRDWMKGIPEKLVFLEERIVKVMSDYEVMDEFFYNLTTDDFNDKWAANNWPSKILGQIDMVRQQHVEDEEKFRKIQLMDQNNFQEKLEGLQLVVAGFSIHVEIARAHEIANEVRRVKKQLKDCQQLAMLYNNRERIFGLPITNYDKLSRMVKEFQPYLDLWTTASDWLRWSESWMNDPLSAIDAEQLEKNVIESFKTMHKCVKQFKDIPACQEVALDIRTRIEEFKPYIPLIQGLRNPGMRNRHWEVLSNEININVRPKANLTFARCLEMNLQDHIESISKVAEVAGKEYAIEQALDKMEKEWSSILFNVLPYKETDTYILKSPDEASQLLDDHIVMTQSMSFSPYKKPFEQRINSWETKLKLTQEVLEEWLNCQRAWLYLEPIFSSEDITRQLPVESKRYQTMERIWRKIMKNAYENREVINVCSDQRLLDSLRDCNKLLDLVQKGLSEYLETKRTAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIARLLFQEDLEITHMYSAEGEEVKLSFSIYPSSNVEDWLLEVERSMKASVHDIIEMAIKAYPTMLRTEWVLNWPGQVTIAGCQTYWTMEVAEALEAGNISSKLFPQLSKQLSDLVALVRGKLSRMQRMVLSALIVIEVHAKDVVSKLIDENVVSVHDFEWISQLRYYWTKDDLYIRAVNAEFIYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVERFMFEGVEIPLVPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMIAEISLYSFGFNEANVLAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPTMNEELICLRAIRDVNVPKFLQEDLKLFSGIVSDLFPTIKEEETDYGILDQAIRRSCEKNNLKDVEGFLIKCIQLYETTVVRHGLMLVGPTGSGKSNCYRVLAAAMTLLKGKPSISGGVYEAVNYYVLNPKSITMGQLYGEFDLLTHEWTDGIFSSLIRAGAIASDTNKKWYMFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLMPFVECWLKRLPAIIKPYEEQFKSLFTKYLENSINFVRNTVKEVIASTNSNLTMSLLKLLDCFFRPFLP---------------------REGLK---------------KIPSEKLSHIPELIEPWFIFSLVWSVGATGDHTSRISFSQWLRLKMRLEQVKLGFPEDGLVYDYRLDDAGISS----TEDDDEEEDENKQVSWVKWMDYSAPFTMMPDTNYCNIIVPTMDTVQMSYLLGMLLTNHKPVLCIGPTGTGKTLTVSNKLLKYLPLEYISHFLTFSARTSANQTQDLIDSKLDKRRKGVFGPPLGRNFIFFIDDLNMPALETYGAQPPIELLRQWMDHGGWYDRKVIGAFKNLVDINFVCAMGPPGGGRNAITPRLTRHFNYLSFIEMDEVSKKRIFSIILECWMDGLLGEKSYREPVPGAPNIDDLTEPLVDATINVYGIITSQLLPTPAKSHYTFNLRDLSKVFQGMLMAEPSKVEDKVQLLRLWYHENCRVFRDRLVNEEDRSWFDELLEAQM-EEFGVAFNKVCPFQPILYGDFMSPGSDVKSYELITSESKMMQVIEEYMEDYNQINTAKLRLVLFVDAMSHICRISRTLRQALGNALLLGVGGSGRSSLTRLASHMAEYECFQIELSKNYGMSEWREDVKKVLLKAGLQNLPITFLFSDTQIKNESFLEDINNVLNSGDIPNIYSADEQDQIINTMRPYIQEQGLQPTKANLMAAYTGRVRSNIHMVLCMSPIGEVFRARLRQFPSLVNCCTIDWFNEWPAEALKSVATTFLSEIPELECSEEVIQGLIQVCVFIHQSVASKCVEYLAELARHNYVTPKSYLELLNIFSILIGQKKMELKTAKNRMKSGLDKLLRTSEDVAKMQEELEIMRPLLEEAAKDTMLTMEQIKVDTAIAEETRKSVQAEEIKANEKANKAQAIADDAQKDLDEALPALDAALASLRNLNKNDVTEVRAMQRPPPGVKLVIEAVCIMKGIKPKKVPGEKPGSKVDDYWEPGKGLLQDPGRFLESLFKFDKDNIGEAVIKAIQPYIDNEEFQPAAIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQALREAQDDLEVTQRILEEAKHHLHEVEDGIATMQAKYRECVAKKEELEMKCEQCEQRLGRADKLINGLADEKVRWQETVENLENMLDNIFGDVLVAAGFVAYLGPFTGQYRTTLYEYWVNQLTVHHVPHTSKPT--LITTLGNPVKIRSWQIAGLPNDTLSVENGVINQFSQRWTHFIDPQGQANKWIKNMERESGLDVFKLSDRDFLRSMENAIRFGKPCLLENVGEELDPALEPVLLKQTYKQQGNIVLKLGDTVIPYHEDFRMYITTKLPNPHYSPEISTKLTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLIVSNAKMRQELKDIEDQILYRLSSSEGNPVDDMELIKVLEASKMKAAEIQAKVRIAEQTEKDIDLTRMEYIPVAVRTQILFFCVSDLANVDPMYQYSLEWFLNIFLSGIANSERADNLKKRIVNINRYLTFSLYSNVCRSLFEKHKLMFAFLLCVRIMMNEGKINQAEWRYLLSGGSIQTM-FENPAPQWLSDRAWRDILALSNLPTFATFSNDFVM-YLSEFQAIFDSAEPHRELLPGIWNAYLDEFQKLLILRCLRGDKVTNAMQDFVATHLEPRFIEPQTANLSAVFKESNSTTPLIFVLSPGTDPAADLYKFAEEMKFSKKFSAISLGQGQGPRAEAMMRNSIERGKWVFFQNCHLAPSWMPALERLIEHINPDKVHRDFRLWLTSLPSNKFPVSILQNGSKMTIEPPRGVKANLLKSYNSLSDDFLHSCQKVVEFKSLLLSLCLFHGNALERRKFGPLGFNIPYEFTDGDLRICISQLKMFLDEYEDIPYKVLKYTAGEINYGGRVTDDWDRRCVMNILEDFYNPAVLSSEHSYSNSGIYHQIPPTYDLNGYLSYIKSLPLNDMPEIFGLHDNANITFAQNETFALFNAILQLQPKSSSMGGQSREELVEDVAENILLQVPGPIELQEVTKKFPVLYEESMNTVLVQEVIRYNKLLEVITQTLSDMLKAIKGLVVMSLELELMSISLYNNTVPELWKSKAYPSLKPLASWIMDLLLRLDFMHSWINDGIPPVFWISGFFFPQAFLTGTLQNFARKFVISIDTITFDFKVLPEASSEIKERPQTGCYIHGLFLEGARWDSMNFQLAESRPKELYTEMAVIWLLPEANRKVQNQDFYLCPIYKTLTRAGTLSTTGHSTNYVIAVEIPSNQPQRHWIKRGVA 4243          
BLAST of Dynein heavy chain axonemal vs. Ensembl Mouse
Match: Dnah7b (dynein, axonemal, heavy chain 7B [Source:MGI Symbol;Acc:MGI:2684953])

HSP 1 Score: 3101.61 bits (8040), Expect = 0.000e+0
Identity = 1686/3776 (44.65%), Postives = 2372/3776 (62.82%), Query Frame = 2
Query: 1610 TKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPK-----KNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPL-LESVGMEEPQVKKLRENLRET-LKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWI--LTIPDMLDEQQEVIDK--CLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDE-ERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGE--KIVFEKSTYPT-GNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALET--RDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAI-YPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKM---------------------STQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIV-FSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVA----ELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVK--------------IEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTN--------LFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKI-QGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKI-EPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKF-SKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSY--TSFSD-DFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQ-VMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            + +KL  F       M   ++ L L S+ +F ++I                       + PP+     ++P F++ L+LD     ++   + +  + +N+++  I+ +  VP++E  +         P  L+ + + E  +   +E +RE  L++++ P E   + Y+K+  L        ++EFL  +++Q++  L    E+ K+   +E ++    + + +G F ++ E + + L K+   +   ++  + R+ ++     C+ F+ I  K    P    EL E++  +  L   DML+ +Q ++D   CL    LIE    N S  D     ++  W  ++   I    + +++D+ E++++        F E+L++    V    ++ D+        + + ++ +L  A      FN  E  +    + Y +  K+     P+  L+    ++   H      P   V+ + VE  V  +++ ++K  K+F++ P+   +  +++  +EEFK +IPLIQ + NPG+R RHWE +S  +G  ++P    T    ++M L+  ++    I+E A KEY++E+A++KM  EW++++F +L Y+ +GTYIL   D+I  LLDDHI+ TQ+M  SP+ KP+E+++ +WE  L   Q+++DEWL+ Q  WLYLEPIFSS DI  Q+P EG+R+  +D+ WR +MKT   +  V+ +    R+L  LK+ N+LLE + KGL+EYLE KR  FPRF+FLS+DELLEILS+TKDPT VQPHL+KCFE IAK++F + L+IT M S EGE  ++V   ST    G VE+W++E+E  M +S+  +IG  +  Y +  R  WV  WPGQ V+   QT+WT EV  A+    R L+G   K   Q+D +  +VRG ++K  R+TL AL+V++VHARDV+ +++ + I + +DF+W+SQLRYYW E NL+ + +NA   YGYEYLGN+ RLVITPLTDRCY TL GALHL  GGAP GPAGTGKTETTKDL KA A QCVVFNCSD LD++A+GKFFKGL S GAWACFDEFNRID+EVLSVVAQQI TIQ+      +  +FEG EL L P+CAVFITMNPGYAGR+ELPDNLKALFR VAMMVPDYA+IAEI L+S GF  AR LS KIV T++L SEQLSSQ HY++GMRAVKSV++AAGNLK +    +EE++ LR+I DVN+PKFL  DL LF GI SDLFP +K    DY +LL +I+       L+    F +K +Q++E  +VRHG M+VG    GKT  Y VL  AL+ + ++   + +  Q     VLNPKS+TMGQLYG+FDL++HEW+DGIL+   R    ++ PD++W IFDGPVDAVWIENMNTVLDDNKKLCL SGEII++  +M ++FE  DL VASPATVSRCGM+Y+EP +LG  P +  WI +LP ++    +E ++ LFD  +  +V+F+R + +E+ PT++  L  +++ L+D F+  F   +             +Q ++N++           + F+                +E  F+FSL WS GA+C  D R KFD  LR  M                     S+++  +PFPE+G +Y+Y+F   G                  R  KW+  +A+ P   I  D+++ +IIVPT+D +R  ++   L   +KP + VGPTGTGK++ I + L   +  +     IV FSA+TTA QTQ++I SKLDKRRKGVFGPP+GK +I F+DD+NMPA EV+G+QPPIEL+RQW D   WYD K     + LVDI  + +MGPPGGGRNPIT R MRHFN++  NE  + SM T+F  IL  W +R       +   L   +V   + +Y      +LPTPAKSHY FNLRD S+V QG+ +  PE+  + + + RLW HE  RV+ DRLV++ DR W  + +   L +   + + D+ K              +  L++ DF     E+  Y E    D +  ++E +L+++N ++   MNLVLF  A+ H+ RI+RI++QP  +ALL+G+GGSGRQS+T+LAAHMA+Y  FQ+E+SK YG  EW +DLK I+      +   VFLF+DTQIK ESFLED+NN+LN+G+VPNL++ D+ + I   M+     L  Q  KT         LF+ +  R R  LH V+ MSPIG+ FR RLR+FPALVNCCTIDWF  WP++ALE+VA +FL DI   E+SEE+  G + MCK  H S  N S  +  EL RYNYVTPTSYLEL+  F  +  +K+ E+ + + R + GLDKL      V  +Q ELE + PQL+ A  E       IER+S    +T+ +V  +E VA  +A   + I+D+   DL EALP L+ +L +L  L   DIT V++M  PP GV+LV+E +CI+K +K  KI      G KI+D+W   K LL D  +FL SL  YDKDNI  + +  I + YI +  F P  I   S A   +C+WV AM  Y  VAK VAPK+  L  +  +L    + L++ +A L  V+D++  LQ+ LE   +++ +LEN+ DLC  +L RA++LIGGL  EK RW +S + L  L  N+ G++LIS+G VAYLG FT  YR +   EWS + K   +P +D    +L+ T G+ V IR W I GLP D+ SI+N +I+  +RRWPL IDPQGQAN+WIKN++K N L +IKLSD D++R+LEN I+FG P L+ENVGEELDP LEP+LLKQTFKQ G+  I+LGD+ I Y  DFRFYITTKL NPHY PE S KVT++NF ++P G++DQLLG+VVA ERPDLE+ K  LIV  A  +++LKEIEDKIL  LS++EG+ ++D   I+ L +SK  +NEI  K  +AE+TE+ ID TR  Y  +A+ + ILFF +ADLA I+PMYQYSL WF+N+F   I N+ K+D L++R+  + ++FT+SLY N+CRSLFEK KLLFSF L   +L HE  I+  EWRFLL GG        NP   W+  + W+EI  L  LPAF     EF+ +  + +K+++DS+EPH E  P +W +  + FQ +L++RCLR DKV   +Q+F+   LG  FIEP   DL   + DS+   PLIFVLSPG DP + L KFADD  +   KLS++SLGQGQGP A ++++ A++ G WV  QNCHLA SWMP+LE++ E++  +  H DFR+WLTS PSP FPV +LQNG KMT E P+G++AN+++SY     SD +F  S  K  E++ LL  LC FH ++ ER+KFGPLG+NIPYEF + DLRI + QL MFL +Y ++P+  L+Y  G  NYGGRVTDDWDRR + ++L+ F+  + V    Y +  SGIY  + P  DH  Y+ Y ++LP+   PE+FG++ NA+IT   +ET  L D++L  Q + S +G KS +E+V EV+ +IL  +P  F++E   +RYP  Y QSMNTVL+QE+ R+N+LL  I+ S  ++ KAI+GLVVMS  LE + +S+ + K+P  W  K+YPSLKPL S+V D  +R+ F+Q W + G PPVFW+SGFFF QAFLTG  QNFARK  I ID + F ++VM     E    P DG YI GLFL+GA W+    +L ES PK L+  +PV+WL PC    IP    Y  P+YKT  R GTLSTTGHSTNFV ++ +P+D+ ++HWI RGVA
Sbjct:  397 SSAKLDSFFNCAATLMTLQLQDLILVSMQDFTDLI-----------------------AQPPESTRAFEHPGFIMRLILDKKTIKFAPDFNDYIDILINVYEIMIKMVSFVPRVETKLYSQWESKSKPTTLKPIILNE-IIDTHKEKIREVVLRESVAPTEHLKM-YDKYQFLITGKAERDIDEFL--FQSQNYERL--IEEIRKYQKLEEEIQYTSRKAVRLGMFEMHCEELIKSLVKRADVICGKLIAKMFRDHQEVNTMLCDEFEKIAEKALSMPLNTAELMEMKAHVQKLETTDMLELRQRLVDSKNCLA--FLIE--CVNFSPADIRLNNSVFQWYGRMG-EIFDEHRKIIKDKTEQYQEALKFRCERFVEELESYAKQVEEFHTFGDLLDVQRYLKKAQVLNGKLDAAADKIEQFNAEEEAYGWVPSVYPQRKKIQDGLNPYLRLYETAVEFSTKHRGWTEGPYHKVNPDQVEADVGNYWRGLYKLEKVFHDSPNALAMTKKVQSMVEEFKQYIPLIQVICNPGLRPRHWEAMSTIVGFPLLPSDDSTVFSFIDMNLEPFLDRFEGISEAASKEYSLEKAMDKMMTEWDSMEFVILPYRESGTYILSSVDDIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFKAVDKTWRDVMKTVVQDKRVLAVVTIERMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELVDTISTAKARGQVEKWLVELERTMIKSIHKVIGDAIAAYTKNSRISWVRDWPGQTVLCVSQTFWTVEVQTAIPKGHRALEGYLAKCNHQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDVLASLVDKKISDDSDFQWLSQLRYYWQENNLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGTELLVFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSIKIVATYRLCSEQLSSQHHYNYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNELLAAIRENCHTMNLQMTDFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQIT---VLNPKSVTMGQLYGQFDLVSHEWSDGILAVSFRAFAASSTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMVSWINTLPQSVSIIQKEFIEGLFDRMVPLSVEFIRRHTKELSPTSDTNLVQSLMNLIDCFMDDFADEN-------------KQKERNDR-----------ESFS---------------LLEGIFMFSLAWSVGATCTDDDRLKFDKILRELMEGPISDLTRNKFKLLSGTEQTSSKVFIVPFPEKGTIYEYQFIPEG----------------LGRWDKWIKKLADTPP--IPKDVQFIEIIVPTLDTIRYSALMHLLTTHQKPSIFVGPTGTGKSVYIINFLLNQLNKDIYKPLIVNFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKRMIVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSVIK-LVDIQIMCAMGPPGGGRNPITPRYMRHFNIVTINEFSDKSMFTIFSRILA-WHLRTCYKFPDDFLDLTTQIVNGTMALYKDAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETAENKEAIKRLWVHEVLRVYYDRLVDNADRSWLIHYIQEILKNYMQEDFHDLFKNLDFNQDGTVEEDDLRSLMFCDFHDPKREDFGYREIANVDALRMIVEGHLDEYNNMSKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQVEISKGYGSHEWHEDLKVILRKCAENDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNLFALDEKQEICEKMR----QLDRQRDKTRQTDGSPIALFNMFIDRCRNQLHVVLAMSPIGDAFRIRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDI---EMSEEIQEGCIDMCKRFHTSTINLSTSFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQVATMQSELEALHPQLKVASREVDEMMIIIERESMEVAKTEKIVKADETVANDQAMAAKAIKDECDADLAEALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDI-RFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGKLRIAMEGLRKKQAALYEVQDKLAKLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSNSALELGHLYINLTGDILISSGVVAYLGAFTSNYRQNQTQEWSQSCKERDIPCSDD--YSLMGTLGEAVTIRAWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQGQANKWIKNMEKTNSLQLIKLSDPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQSLIVQGADNKRQLKEIEDKILEVLSLSEGNILEDETAIKILSSSKSLANEISQKQEVAEETEKKIDNTRMGYRIIAIHSSILFFSIADLANIEPMYQYSLTWFINLFILSIENSEKSDILSKRLQILRDHFTYSLYVNICRSLFEKDKLLFSFCLTVNLLIHENAINKTEWRFLLTGGIGLDNPYTNPC-TWLPQKSWDEICRLDDLPAFKTIRREFM-RLKDGWKKVYDSMEPHHEMFPEDWENKANDFQRMLIIRCLRPDKVIPMLQEFIIKKLGRPFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMNALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKDGTWVVLQNCHLATSWMPTLEKVCEELSAESTHPDFRIWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNKFFCTELVENPQYKFDSSGIYF-VPPSGDHKSYINYTKTLPLIPAPEVFGMNANADITKDQSETQLLFDNILLTQSQSSGSGTKSSDEVVNEVAGDILSKLPNNFDVEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAIKGLVVMSTELEEVVSSILNVKIPVMWMGKSYPSLKPLGSYVNDFLERLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNFARKFTIPIDLLGFDYEVMDDK--EYKNAPEDGVYIHGLFLDGASWNRKTKKLAESHPKVLYDTVPVMWLKPCKKSDIPKRPSYVAPLYKTSERRGTLSTTGHSTNFVIAMILPSDQPKEHWIGRGVA 4061          
BLAST of Dynein heavy chain axonemal vs. Ensembl Mouse
Match: Dnah7b (dynein, axonemal, heavy chain 7B [Source:MGI Symbol;Acc:MGI:2684953])

HSP 1 Score: 3101.61 bits (8040), Expect = 0.000e+0
Identity = 1686/3776 (44.65%), Postives = 2372/3776 (62.82%), Query Frame = 2
Query: 1610 TKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPK-----KNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPL-LESVGMEEPQVKKLRENLRET-LKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWI--LTIPDMLDEQQEVIDK--CLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDE-ERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGE--KIVFEKSTYPT-GNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALET--RDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAI-YPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKM---------------------STQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIV-FSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVA----ELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVK--------------IEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTN--------LFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKI-QGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKI-EPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKF-SKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSY--TSFSD-DFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQ-VMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            + +KL  F       M   ++ L L S+ +F ++I                       + PP+     ++P F++ L+LD     ++   + +  + +N+++  I+ +  VP++E  +         P  L+ + + E  +   +E +RE  L++++ P E   + Y+K+  L        ++EFL  +++Q++  L    E+ K+   +E ++    + + +G F ++ E + + L K+   +   ++  + R+ ++     C+ F+ I  K    P    EL E++  +  L   DML+ +Q ++D   CL    LIE    N S  D     ++  W  ++   I    + +++D+ E++++        F E+L++    V    ++ D+        + + ++ +L  A      FN  E  +    + Y +  K+     P+  L+    ++   H      P   V+ + VE  V  +++ ++K  K+F++ P+   +  +++  +EEFK +IPLIQ + NPG+R RHWE +S  +G  ++P    T    ++M L+  ++    I+E A KEY++E+A++KM  EW++++F +L Y+ +GTYIL   D+I  LLDDHI+ TQ+M  SP+ KP+E+++ +WE  L   Q+++DEWL+ Q  WLYLEPIFSS DI  Q+P EG+R+  +D+ WR +MKT   +  V+ +    R+L  LK+ N+LLE + KGL+EYLE KR  FPRF+FLS+DELLEILS+TKDPT VQPHL+KCFE IAK++F + L+IT M S EGE  ++V   ST    G VE+W++E+E  M +S+  +IG  +  Y +  R  WV  WPGQ V+   QT+WT EV  A+    R L+G   K   Q+D +  +VRG ++K  R+TL AL+V++VHARDV+ +++ + I + +DF+W+SQLRYYW E NL+ + +NA   YGYEYLGN+ RLVITPLTDRCY TL GALHL  GGAP GPAGTGKTETTKDL KA A QCVVFNCSD LD++A+GKFFKGL S GAWACFDEFNRID+EVLSVVAQQI TIQ+      +  +FEG EL L P+CAVFITMNPGYAGR+ELPDNLKALFR VAMMVPDYA+IAEI L+S GF  AR LS KIV T++L SEQLSSQ HY++GMRAVKSV++AAGNLK +    +EE++ LR+I DVN+PKFL  DL LF GI SDLFP +K    DY +LL +I+       L+    F +K +Q++E  +VRHG M+VG    GKT  Y VL  AL+ + ++   + +  Q     VLNPKS+TMGQLYG+FDL++HEW+DGIL+   R    ++ PD++W IFDGPVDAVWIENMNTVLDDNKKLCL SGEII++  +M ++FE  DL VASPATVSRCGM+Y+EP +LG  P +  WI +LP ++    +E ++ LFD  +  +V+F+R + +E+ PT++  L  +++ L+D F+  F   +             +Q ++N++           + F+                +E  F+FSL WS GA+C  D R KFD  LR  M                     S+++  +PFPE+G +Y+Y+F   G                  R  KW+  +A+ P   I  D+++ +IIVPT+D +R  ++   L   +KP + VGPTGTGK++ I + L   +  +     IV FSA+TTA QTQ++I SKLDKRRKGVFGPP+GK +I F+DD+NMPA EV+G+QPPIEL+RQW D   WYD K     + LVDI  + +MGPPGGGRNPIT R MRHFN++  NE  + SM T+F  IL  W +R       +   L   +V   + +Y      +LPTPAKSHY FNLRD S+V QG+ +  PE+  + + + RLW HE  RV+ DRLV++ DR W  + +   L +   + + D+ K              +  L++ DF     E+  Y E    D +  ++E +L+++N ++   MNLVLF  A+ H+ RI+RI++QP  +ALL+G+GGSGRQS+T+LAAHMA+Y  FQ+E+SK YG  EW +DLK I+      +   VFLF+DTQIK ESFLED+NN+LN+G+VPNL++ D+ + I   M+     L  Q  KT         LF+ +  R R  LH V+ MSPIG+ FR RLR+FPALVNCCTIDWF  WP++ALE+VA +FL DI   E+SEE+  G + MCK  H S  N S  +  EL RYNYVTPTSYLEL+  F  +  +K+ E+ + + R + GLDKL      V  +Q ELE + PQL+ A  E       IER+S    +T+ +V  +E VA  +A   + I+D+   DL EALP L+ +L +L  L   DIT V++M  PP GV+LV+E +CI+K +K  KI      G KI+D+W   K LL D  +FL SL  YDKDNI  + +  I + YI +  F P  I   S A   +C+WV AM  Y  VAK VAPK+  L  +  +L    + L++ +A L  V+D++  LQ+ LE   +++ +LEN+ DLC  +L RA++LIGGL  EK RW +S + L  L  N+ G++LIS+G VAYLG FT  YR +   EWS + K   +P +D    +L+ T G+ V IR W I GLP D+ SI+N +I+  +RRWPL IDPQGQAN+WIKN++K N L +IKLSD D++R+LEN I+FG P L+ENVGEELDP LEP+LLKQTFKQ G+  I+LGD+ I Y  DFRFYITTKL NPHY PE S KVT++NF ++P G++DQLLG+VVA ERPDLE+ K  LIV  A  +++LKEIEDKIL  LS++EG+ ++D   I+ L +SK  +NEI  K  +AE+TE+ ID TR  Y  +A+ + ILFF +ADLA I+PMYQYSL WF+N+F   I N+ K+D L++R+  + ++FT+SLY N+CRSLFEK KLLFSF L   +L HE  I+  EWRFLL GG        NP   W+  + W+EI  L  LPAF     EF+ +  + +K+++DS+EPH E  P +W +  + FQ +L++RCLR DKV   +Q+F+   LG  FIEP   DL   + DS+   PLIFVLSPG DP + L KFADD  +   KLS++SLGQGQGP A ++++ A++ G WV  QNCHLA SWMP+LE++ E++  +  H DFR+WLTS PSP FPV +LQNG KMT E P+G++AN+++SY     SD +F  S  K  E++ LL  LC FH ++ ER+KFGPLG+NIPYEF + DLRI + QL MFL +Y ++P+  L+Y  G  NYGGRVTDDWDRR + ++L+ F+  + V    Y +  SGIY  + P  DH  Y+ Y ++LP+   PE+FG++ NA+IT   +ET  L D++L  Q + S +G KS +E+V EV+ +IL  +P  F++E   +RYP  Y QSMNTVL+QE+ R+N+LL  I+ S  ++ KAI+GLVVMS  LE + +S+ + K+P  W  K+YPSLKPL S+V D  +R+ F+Q W + G PPVFW+SGFFF QAFLTG  QNFARK  I ID + F ++VM     E    P DG YI GLFL+GA W+    +L ES PK L+  +PV+WL PC    IP    Y  P+YKT  R GTLSTTGHSTNFV ++ +P+D+ ++HWI RGVA
Sbjct:  353 SSAKLDSFFNCAATLMTLQLQDLILVSMQDFTDLI-----------------------AQPPESTRAFEHPGFIMRLILDKKTIKFAPDFNDYIDILINVYEIMIKMVSFVPRVETKLYSQWESKSKPTTLKPIILNE-IIDTHKEKIREVVLRESVAPTEHLKM-YDKYQFLITGKAERDIDEFL--FQSQNYERL--IEEIRKYQKLEEEIQYTSRKAVRLGMFEMHCEELIKSLVKRADVICGKLIAKMFRDHQEVNTMLCDEFEKIAEKALSMPLNTAELMEMKAHVQKLETTDMLELRQRLVDSKNCLA--FLIE--CVNFSPADIRLNNSVFQWYGRMG-EIFDEHRKIIKDKTEQYQEALKFRCERFVEELESYAKQVEEFHTFGDLLDVQRYLKKAQVLNGKLDAAADKIEQFNAEEEAYGWVPSVYPQRKKIQDGLNPYLRLYETAVEFSTKHRGWTEGPYHKVNPDQVEADVGNYWRGLYKLEKVFHDSPNALAMTKKVQSMVEEFKQYIPLIQVICNPGLRPRHWEAMSTIVGFPLLPSDDSTVFSFIDMNLEPFLDRFEGISEAASKEYSLEKAMDKMMTEWDSMEFVILPYRESGTYILSSVDDIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFKAVDKTWRDVMKTVVQDKRVLAVVTIERMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELVDTISTAKARGQVEKWLVELERTMIKSIHKVIGDAIAAYTKNSRISWVRDWPGQTVLCVSQTFWTVEVQTAIPKGHRALEGYLAKCNHQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDVLASLVDKKISDDSDFQWLSQLRYYWQENNLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGTELLVFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSIKIVATYRLCSEQLSSQHHYNYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNELLAAIRENCHTMNLQMTDFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQIT---VLNPKSVTMGQLYGQFDLVSHEWSDGILAVSFRAFAASSTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMVSWINTLPQSVSIIQKEFIEGLFDRMVPLSVEFIRRHTKELSPTSDTNLVQSLMNLIDCFMDDFADEN-------------KQKERNDR-----------ESFS---------------LLEGIFMFSLAWSVGATCTDDDRLKFDKILRELMEGPISDLTRNKFKLLSGTEQTSSKVFIVPFPEKGTIYEYQFIPEG----------------LGRWDKWIKKLADTPP--IPKDVQFIEIIVPTLDTIRYSALMHLLTTHQKPSIFVGPTGTGKSVYIINFLLNQLNKDIYKPLIVNFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKRMIVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSVIK-LVDIQIMCAMGPPGGGRNPITPRYMRHFNIVTINEFSDKSMFTIFSRILA-WHLRTCYKFPDDFLDLTTQIVNGTMALYKDAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETAENKEAIKRLWVHEVLRVYYDRLVDNADRSWLIHYIQEILKNYMQEDFHDLFKNLDFNQDGTVEEDDLRSLMFCDFHDPKREDFGYREIANVDALRMIVEGHLDEYNNMSKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQVEISKGYGSHEWHEDLKVILRKCAENDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNLFALDEKQEICEKMR----QLDRQRDKTRQTDGSPIALFNMFIDRCRNQLHVVLAMSPIGDAFRIRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDI---EMSEEIQEGCIDMCKRFHTSTINLSTSFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQVATMQSELEALHPQLKVASREVDEMMIIIERESMEVAKTEKIVKADETVANDQAMAAKAIKDECDADLAEALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDI-RFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGKLRIAMEGLRKKQAALYEVQDKLAKLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSNSALELGHLYINLTGDILISSGVVAYLGAFTSNYRQNQTQEWSQSCKERDIPCSDD--YSLMGTLGEAVTIRAWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQGQANKWIKNMEKTNSLQLIKLSDPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQSLIVQGADNKRQLKEIEDKILEVLSLSEGNILEDETAIKILSSSKSLANEISQKQEVAEETEKKIDNTRMGYRIIAIHSSILFFSIADLANIEPMYQYSLTWFINLFILSIENSEKSDILSKRLQILRDHFTYSLYVNICRSLFEKDKLLFSFCLTVNLLIHENAINKTEWRFLLTGGIGLDNPYTNPC-TWLPQKSWDEICRLDDLPAFKTIRREFM-RLKDGWKKVYDSMEPHHEMFPEDWENKANDFQRMLIIRCLRPDKVIPMLQEFIIKKLGRPFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMNALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKDGTWVVLQNCHLATSWMPTLEKVCEELSAESTHPDFRIWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNKFFCTELVENPQYKFDSSGIYF-VPPSGDHKSYINYTKTLPLIPAPEVFGMNANADITKDQSETQLLFDNILLTQSQSSGSGTKSSDEVVNEVAGDILSKLPNNFDVEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAIKGLVVMSTELEEVVSSILNVKIPVMWMGKSYPSLKPLGSYVNDFLERLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNFARKFTIPIDLLGFDYEVMDDK--EYKNAPEDGVYIHGLFLDGASWNRKTKKLAESHPKVLYDTVPVMWLKPCKKSDIPKRPSYVAPLYKTSERRGTLSTTGHSTNFVIAMILPSDQPKEHWIGRGVA 4017          
BLAST of Dynein heavy chain axonemal vs. Ensembl Mouse
Match: Dnah7b (dynein, axonemal, heavy chain 7B [Source:MGI Symbol;Acc:MGI:2684953])

HSP 1 Score: 3101.61 bits (8040), Expect = 0.000e+0
Identity = 1686/3776 (44.65%), Postives = 2372/3776 (62.82%), Query Frame = 2
Query: 1610 TKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPK-----KNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPL-LESVGMEEPQVKKLRENLRET-LKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWI--LTIPDMLDEQQEVIDK--CLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDE-ERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGE--KIVFEKSTYPT-GNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALET--RDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAI-YPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKM---------------------STQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIV-FSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVA----ELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVK--------------IEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTN--------LFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKI-QGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKI-EPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKF-SKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSY--TSFSD-DFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQ-VMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            + +KL  F       M   ++ L L S+ +F ++I                       + PP+     ++P F++ L+LD     ++   + +  + +N+++  I+ +  VP++E  +         P  L+ + + E  +   +E +RE  L++++ P E   + Y+K+  L        ++EFL  +++Q++  L    E+ K+   +E ++    + + +G F ++ E + + L K+   +   ++  + R+ ++     C+ F+ I  K    P    EL E++  +  L   DML+ +Q ++D   CL    LIE    N S  D     ++  W  ++   I    + +++D+ E++++        F E+L++    V    ++ D+        + + ++ +L  A      FN  E  +    + Y +  K+     P+  L+    ++   H      P   V+ + VE  V  +++ ++K  K+F++ P+   +  +++  +EEFK +IPLIQ + NPG+R RHWE +S  +G  ++P    T    ++M L+  ++    I+E A KEY++E+A++KM  EW++++F +L Y+ +GTYIL   D+I  LLDDHI+ TQ+M  SP+ KP+E+++ +WE  L   Q+++DEWL+ Q  WLYLEPIFSS DI  Q+P EG+R+  +D+ WR +MKT   +  V+ +    R+L  LK+ N+LLE + KGL+EYLE KR  FPRF+FLS+DELLEILS+TKDPT VQPHL+KCFE IAK++F + L+IT M S EGE  ++V   ST    G VE+W++E+E  M +S+  +IG  +  Y +  R  WV  WPGQ V+   QT+WT EV  A+    R L+G   K   Q+D +  +VRG ++K  R+TL AL+V++VHARDV+ +++ + I + +DF+W+SQLRYYW E NL+ + +NA   YGYEYLGN+ RLVITPLTDRCY TL GALHL  GGAP GPAGTGKTETTKDL KA A QCVVFNCSD LD++A+GKFFKGL S GAWACFDEFNRID+EVLSVVAQQI TIQ+      +  +FEG EL L P+CAVFITMNPGYAGR+ELPDNLKALFR VAMMVPDYA+IAEI L+S GF  AR LS KIV T++L SEQLSSQ HY++GMRAVKSV++AAGNLK +    +EE++ LR+I DVN+PKFL  DL LF GI SDLFP +K    DY +LL +I+       L+    F +K +Q++E  +VRHG M+VG    GKT  Y VL  AL+ + ++   + +  Q     VLNPKS+TMGQLYG+FDL++HEW+DGIL+   R    ++ PD++W IFDGPVDAVWIENMNTVLDDNKKLCL SGEII++  +M ++FE  DL VASPATVSRCGM+Y+EP +LG  P +  WI +LP ++    +E ++ LFD  +  +V+F+R + +E+ PT++  L  +++ L+D F+  F   +             +Q ++N++           + F+                +E  F+FSL WS GA+C  D R KFD  LR  M                     S+++  +PFPE+G +Y+Y+F   G                  R  KW+  +A+ P   I  D+++ +IIVPT+D +R  ++   L   +KP + VGPTGTGK++ I + L   +  +     IV FSA+TTA QTQ++I SKLDKRRKGVFGPP+GK +I F+DD+NMPA EV+G+QPPIEL+RQW D   WYD K     + LVDI  + +MGPPGGGRNPIT R MRHFN++  NE  + SM T+F  IL  W +R       +   L   +V   + +Y      +LPTPAKSHY FNLRD S+V QG+ +  PE+  + + + RLW HE  RV+ DRLV++ DR W  + +   L +   + + D+ K              +  L++ DF     E+  Y E    D +  ++E +L+++N ++   MNLVLF  A+ H+ RI+RI++QP  +ALL+G+GGSGRQS+T+LAAHMA+Y  FQ+E+SK YG  EW +DLK I+      +   VFLF+DTQIK ESFLED+NN+LN+G+VPNL++ D+ + I   M+     L  Q  KT         LF+ +  R R  LH V+ MSPIG+ FR RLR+FPALVNCCTIDWF  WP++ALE+VA +FL DI   E+SEE+  G + MCK  H S  N S  +  EL RYNYVTPTSYLEL+  F  +  +K+ E+ + + R + GLDKL      V  +Q ELE + PQL+ A  E       IER+S    +T+ +V  +E VA  +A   + I+D+   DL EALP L+ +L +L  L   DIT V++M  PP GV+LV+E +CI+K +K  KI      G KI+D+W   K LL D  +FL SL  YDKDNI  + +  I + YI +  F P  I   S A   +C+WV AM  Y  VAK VAPK+  L  +  +L    + L++ +A L  V+D++  LQ+ LE   +++ +LEN+ DLC  +L RA++LIGGL  EK RW +S + L  L  N+ G++LIS+G VAYLG FT  YR +   EWS + K   +P +D    +L+ T G+ V IR W I GLP D+ SI+N +I+  +RRWPL IDPQGQAN+WIKN++K N L +IKLSD D++R+LEN I+FG P L+ENVGEELDP LEP+LLKQTFKQ G+  I+LGD+ I Y  DFRFYITTKL NPHY PE S KVT++NF ++P G++DQLLG+VVA ERPDLE+ K  LIV  A  +++LKEIEDKIL  LS++EG+ ++D   I+ L +SK  +NEI  K  +AE+TE+ ID TR  Y  +A+ + ILFF +ADLA I+PMYQYSL WF+N+F   I N+ K+D L++R+  + ++FT+SLY N+CRSLFEK KLLFSF L   +L HE  I+  EWRFLL GG        NP   W+  + W+EI  L  LPAF     EF+ +  + +K+++DS+EPH E  P +W +  + FQ +L++RCLR DKV   +Q+F+   LG  FIEP   DL   + DS+   PLIFVLSPG DP + L KFADD  +   KLS++SLGQGQGP A ++++ A++ G WV  QNCHLA SWMP+LE++ E++  +  H DFR+WLTS PSP FPV +LQNG KMT E P+G++AN+++SY     SD +F  S  K  E++ LL  LC FH ++ ER+KFGPLG+NIPYEF + DLRI + QL MFL +Y ++P+  L+Y  G  NYGGRVTDDWDRR + ++L+ F+  + V    Y +  SGIY  + P  DH  Y+ Y ++LP+   PE+FG++ NA+IT   +ET  L D++L  Q + S +G KS +E+V EV+ +IL  +P  F++E   +RYP  Y QSMNTVL+QE+ R+N+LL  I+ S  ++ KAI+GLVVMS  LE + +S+ + K+P  W  K+YPSLKPL S+V D  +R+ F+Q W + G PPVFW+SGFFF QAFLTG  QNFARK  I ID + F ++VM     E    P DG YI GLFL+GA W+    +L ES PK L+  +PV+WL PC    IP    Y  P+YKT  R GTLSTTGHSTNFV ++ +P+D+ ++HWI RGVA
Sbjct:  353 SSAKLDSFFNCAATLMTLQLQDLILVSMQDFTDLI-----------------------AQPPESTRAFEHPGFIMRLILDKKTIKFAPDFNDYIDILINVYEIMIKMVSFVPRVETKLYSQWESKSKPTTLKPIILNE-IIDTHKEKIREVVLRESVAPTEHLKM-YDKYQFLITGKAERDIDEFL--FQSQNYERL--IEEIRKYQKLEEEIQYTSRKAVRLGMFEMHCEELIKSLVKRADVICGKLIAKMFRDHQEVNTMLCDEFEKIAEKALSMPLNTAELMEMKAHVQKLETTDMLELRQRLVDSKNCLA--FLIE--CVNFSPADIRLNNSVFQWYGRMG-EIFDEHRKIIKDKTEQYQEALKFRCERFVEELESYAKQVEEFHTFGDLLDVQRYLKKAQVLNGKLDAAADKIEQFNAEEEAYGWVPSVYPQRKKIQDGLNPYLRLYETAVEFSTKHRGWTEGPYHKVNPDQVEADVGNYWRGLYKLEKVFHDSPNALAMTKKVQSMVEEFKQYIPLIQVICNPGLRPRHWEAMSTIVGFPLLPSDDSTVFSFIDMNLEPFLDRFEGISEAASKEYSLEKAMDKMMTEWDSMEFVILPYRESGTYILSSVDDIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFKAVDKTWRDVMKTVVQDKRVLAVVTIERMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELVDTISTAKARGQVEKWLVELERTMIKSIHKVIGDAIAAYTKNSRISWVRDWPGQTVLCVSQTFWTVEVQTAIPKGHRALEGYLAKCNHQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDVLASLVDKKISDDSDFQWLSQLRYYWQENNLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGTELLVFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSIKIVATYRLCSEQLSSQHHYNYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNELLAAIRENCHTMNLQMTDFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQIT---VLNPKSVTMGQLYGQFDLVSHEWSDGILAVSFRAFAASSTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMVSWINTLPQSVSIIQKEFIEGLFDRMVPLSVEFIRRHTKELSPTSDTNLVQSLMNLIDCFMDDFADEN-------------KQKERNDR-----------ESFS---------------LLEGIFMFSLAWSVGATCTDDDRLKFDKILRELMEGPISDLTRNKFKLLSGTEQTSSKVFIVPFPEKGTIYEYQFIPEG----------------LGRWDKWIKKLADTPP--IPKDVQFIEIIVPTLDTIRYSALMHLLTTHQKPSIFVGPTGTGKSVYIINFLLNQLNKDIYKPLIVNFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKRMIVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSVIK-LVDIQIMCAMGPPGGGRNPITPRYMRHFNIVTINEFSDKSMFTIFSRILA-WHLRTCYKFPDDFLDLTTQIVNGTMALYKDAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETAENKEAIKRLWVHEVLRVYYDRLVDNADRSWLIHYIQEILKNYMQEDFHDLFKNLDFNQDGTVEEDDLRSLMFCDFHDPKREDFGYREIANVDALRMIVEGHLDEYNNMSKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQVEISKGYGSHEWHEDLKVILRKCAENDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNLFALDEKQEICEKMR----QLDRQRDKTRQTDGSPIALFNMFIDRCRNQLHVVLAMSPIGDAFRIRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDI---EMSEEIQEGCIDMCKRFHTSTINLSTSFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQVATMQSELEALHPQLKVASREVDEMMIIIERESMEVAKTEKIVKADETVANDQAMAAKAIKDECDADLAEALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDI-RFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGKLRIAMEGLRKKQAALYEVQDKLAKLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSNSALELGHLYINLTGDILISSGVVAYLGAFTSNYRQNQTQEWSQSCKERDIPCSDD--YSLMGTLGEAVTIRAWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQGQANKWIKNMEKTNSLQLIKLSDPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQSLIVQGADNKRQLKEIEDKILEVLSLSEGNILEDETAIKILSSSKSLANEISQKQEVAEETEKKIDNTRMGYRIIAIHSSILFFSIADLANIEPMYQYSLTWFINLFILSIENSEKSDILSKRLQILRDHFTYSLYVNICRSLFEKDKLLFSFCLTVNLLIHENAINKTEWRFLLTGGIGLDNPYTNPC-TWLPQKSWDEICRLDDLPAFKTIRREFM-RLKDGWKKVYDSMEPHHEMFPEDWENKANDFQRMLIIRCLRPDKVIPMLQEFIIKKLGRPFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMNALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKDGTWVVLQNCHLATSWMPTLEKVCEELSAESTHPDFRIWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNKFFCTELVENPQYKFDSSGIYF-VPPSGDHKSYINYTKTLPLIPAPEVFGMNANADITKDQSETQLLFDNILLTQSQSSGSGTKSSDEVVNEVAGDILSKLPNNFDVEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAIKGLVVMSTELEEVVSSILNVKIPVMWMGKSYPSLKPLGSYVNDFLERLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNFARKFTIPIDLLGFDYEVMDDK--EYKNAPEDGVYIHGLFLDGASWNRKTKKLAESHPKVLYDTVPVMWLKPCKKSDIPKRPSYVAPLYKTSERRGTLSTTGHSTNFVIAMILPSDQPKEHWIGRGVA 4017          
BLAST of Dynein heavy chain axonemal vs. Ensembl Mouse
Match: Dnah7a (dynein, axonemal, heavy chain 7A [Source:MGI Symbol;Acc:MGI:2685838])

HSP 1 Score: 3100.84 bits (8038), Expect = 0.000e+0
Identity = 1672/3704 (45.14%), Postives = 2338/3704 (63.12%), Query Frame = 2
Query: 1799 KNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPL-LESVGMEEPQVKKLRENLRET-LKKALIPMESYALEYNKFLNLQNQDITEYVNEFL---RNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWI--LTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGE--KIVFEKSTYPT-GNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALET--RDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAI-YPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRR---------------------KMSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIV-FSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVA----ELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVK--------------IEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPI--VQDLGLQ--ATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKI-QGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKI-EPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKF-SKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSY--TSFSD-DFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQ-VMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            ++P F++ LVLD     +    +++    +N+++  I+A+  VP++E  +         P  L+ + + E  +   +E +RE  L++++ P E   + Y+K+  L        ++E L   +NYE        +  E+ K+    E ++    + + +G F ++ E + + L K+   +   ++  + R+ ++     C+ F+ I  K    P    EL E++  +  L   DML+  Q ++D  +    LIE    N S  D     ++  W  ++     +  + + E  E +++        F E+L++    V    ++ D+        + + ++ +L  A      FN  E  F    + Y +  K+     P+ +L+    ++   H      P   V+ + VE  V  +++ ++K  K+F++ P+   +  ++   +EEFK +IPLIQ   NPG+R RHWE +S  +G  + P    T    ++M L+  ++    I+E A KEY++E+A++KM  EW++++F +L Y+ +GTYIL   D+I  LLDDHI+ TQ+M  SP+ KP+E+++ +WE  L   Q+++DEWL+ Q  WLYLEPIFSS DI  Q+P EG+R+  +D+ WR +MKT   +  V+ +    R+L  LK+ N+LLE + KGL+EYLE KR  FPRF+FLS+DELLEILS+TKDPT VQPHL+KCFE IAK++F + L+IT M S EGE  ++V   ST    G VE+W++E+E  M +S+  +I   +V Y +  R  WV  WPGQ V+   QT+WT EV  A+    R L+G   K   Q+D +  +VRG ++K  R+TL AL+V++VHARDV+ +++ + I + +DF+W+SQLRYYW E NL+ + +NA   YGYEYLGN+ RLVITPLTDRCY TL GALHL  GGAP GPAGTGKTETTKDL KA A QCVVFNCSD LD++A+GKFFKGL S GAWACFDEFNRID+EVLSVVAQQI TIQ+      D  +FEG EL L P+CAVFITMNPGYAGR+ELPDNLKALFR VAMMVPDYA+IAEI L+S GF  AR LS KIV T++L SEQLSSQ HYD+GMRAVKSV++AAGNLK +    +EE++ LR+I DVN+PKFL  DL LF GI SDLFP +K    DY DLL +I+       L+    F +K +Q++E  +VRHG M+VG    GKT  Y VL  AL+ + ++   + +  Q     VLNPKS+TMGQLYG+FDL++HEW+DG+L+   R    ++ PD++W IFDGPVDAVWIENMNTVLDDNKKLCL SGEII++  +M ++FE  DL VASPATVSRCGM+Y+EP +LG  P +  WI +LP ++    +E ++ LFD  +  +V+F+R + +E+ PT++  L  +++ L+D F+  F   +             +Q ++N++           + F+                +E  FLFSLIWS GA+C  D R KFD  LR                      + S+++  +PFPE+G +YDY+F   G                  R  KW+  +A+ P   I  D+++++IIVPT+D +R  ++   L   +KP + VGPTGTGK++ I + L   +  +     IV FSA+TTA QTQ++I SKLDKRRKGVFGPP+GK +I F+DD+NMPA EV+G+QPPIEL+RQW D   WYD K     + LVDI  + +MGPPGGGRNPIT R MRHFN++  NE    SM T+F  IL  W +R       +   L   +V   + +Y      +LPTPAKSHY FNLRD S+V QG+ +  PE+  + + + RLW HE  RV+ DRLV++ DR W  N +   L +   + + D+ K              +  L++ DF     E+  Y E    D +  ++E +L+++N ++   MNLVLF  A+ H+ RI+RI++QP  +ALL+G+GGSGRQS+T+LAAHMA+Y  FQ+E+SK YG  EW +DLK I+      +   VFLF+DTQIK ESFLED+NN+LN+G+VPNL++ D+ + I   M+ I   +D   Q   +   LF+ +    R  LH V+ MSPIG+ FR RLR+FPALVNCCTIDWF  WP++ALE+VA +FL DI   E+SEE+  G + MCK  H S  N S  +  EL RYNYVTPTSYLEL+  F  +  +K+ E+ + + R + GLDKL      V  +Q ELE + PQL+ A  E       IER+S    +T+ +V  +E VA  +A   + I+D+   DL  ALP L+ +L +L  L   DIT V++M  PP GV+LV+E VCI+K +K  KI      G K +D+W   K LL D  +FL SL  YDKDNI  + +  I + YI +  F P  I   S A   +C+WV AM  Y  VAK VAPK+  L  +  +L+   + L++ +A L  V+D++  LQ+ LE   +++ +LE++ DLC  +L RA++LIGGL  EK RW +S + L  L  N+ G++LIS+G VAYLG FT  YR +   +WS + K   +P +D    +L+ T G+ V IR W I GLP D+ SI+N +I+  +RRWPL IDPQGQAN+WIKN++K N L +IKLSD  ++R+LEN I+FG P L+ENVGEELDP LEP+LLKQTFKQ G+  I+LGD+ I Y  DFRFYITTKL NPHY PE S KVT++NF ++P G++DQLLG+VVA ERPDLE+ K  LI+  A  +++LKEIEDKIL  LS++EG+ ++D   I+ L +SK  +NEI  K  +AE+TE+ ID TR  Y P+A+ + ILFF +ADLA I+PMYQYSL WF+N+F   I N+ K+D L++R+  + ++FT+SLY N+CRSLFEK KLLFSF L   +L H+  I+  EWRFLL GG        NP   W+  + W+EI  L  LPAF    EEF+ +  + +K+++DS+EPH E  P +W +  + FQ +L++RCLR DKV   +Q+F+   LG  FIEP   DL   + DS+   PLIFVLSPG DP + L KFADD  +   KLS++SLGQGQGP A ++++ A++ G WV  QNCHLA SWMP+LE++ E++  +  H DFR+WLTS PSP FPV +LQNG KMT E P+G++AN+++SY     SD +F  S  K  E++ LL  LC FH ++ ER+KFGPLG+NIPYEF + DLRI + QL MFL +Y ++P+  L+Y  G  NYGGRVTDDWDRR + ++L+ F+  + V    Y +  SGIY  + P  DH  Y+ Y ++LP+   PE+FG++ NA+IT   +ET  L D++L  Q   S +G KS +E+V EV+ +IL  +P  F++E   +RYP  Y QSMNTVL+QE+ R+N+LL  I+ S  ++ KA++GLVVMS  LE + +S+ + K+P  W  K+YPSLKPL S+V D  +R+ F+Q W + G PPVFW+SGFFF QAFLTG  QN+ARK  I ID + F ++VM     E  + P DG YI GLFL+GA WD    +L ES PK L+  +PV+WL PC    IP    Y  P+YKT  R GTLSTTGHSTNFV ++ +P+   ++HWI RGVA
Sbjct:  398 EHPGFIMRLVLDKEAIKFEPEFNEYIDSLINIYEIMIKAVSFVPRVETKLYSQWESKSKPTTLKPIILNE-IIDTHKEKIREVILRESVAPTEHLKM-YDKYQFLITGKAERDIDELLFQNQNYE-------RLIEEIRKYQKLGEEIQYTSQKTVCLGMFEMHCEELIRSLVKRADVICGKLIAKMFRDHQEVNTMLCDEFEKIAEKALSTPLNTAELMEMKAHVQKLETTDMLELGQRLVDSKICLAFLIE--CVNFSPADIRLNKSVFQWYGRMGEIFDEHRKIIKEKTELYQEFLKFRCERFVEELESYAKQVEEFHAFGDLLDVQRYLQKAQVLNGKLDAAADKIDQFNAEEEAFGWVPSAYPQRKKIQDALNPYLHLYETAVEFSTKHRGWTEGPYHKVNPDQVEADVGNYWRGLYKLEKVFHDSPNALAMTKKVHSMVEEFKQYIPLIQVFCNPGLRPRHWEAMSTIVGYPLQPSDDSTVFSFIDMNLEPFLDRFGSISEAASKEYSLEKAMDKMMTEWDSMEFVILPYRESGTYILSSVDDIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSRDIMSQMPEEGRRFTAVDKTWRDVMKTVVQDKQVLAVVTIERMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELVDTISTAKARGQVEKWLVELERTMIKSIHKVIRDAIVAYTKTSRISWVRDWPGQTVLCVSQTFWTVEVQIAIPEGHRALEGYLAKCNHQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDVLASLVDKKISDDSDFQWLSQLRYYWQENNLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGTDLLVFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSIKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNDLLAAIRDNCHSMNLQMTDFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQIT---VLNPKSVTMGQLYGQFDLVSHEWSDGVLAVSFRAFAASSTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMVSWINTLPQSVSIIQKEFIEGLFDRMVPLSVEFIRRHTKELSPTSDTNLVRSLMNLIDCFMDDFADEN-------------KQKERNDR-----------ESFS---------------LLEGIFLFSLIWSVGATCTDDDRLKFDKILRELLEGPISNLTRNKFKLLSGTEQTSSKVFIVPFPEKGTIYDYQFIPEG----------------LGRWDKWIKDLADTPP--IPKDVQFNEIIVPTLDTIRYSALMNLLTTHQKPSIFVGPTGTGKSVYIINFLLNQLNKDIYKPLIVNFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKRMIVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSVIK-LVDIQIMCAMGPPGGGRNPITPRYMRHFNIVTINEFSNKSMFTIFSRILA-WHLRTCYKFPDDFLDLTTQIVNGTMALYKDAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETAENKEAIKRLWVHEVLRVYYDRLVDNADRSWLINYIQEILKNYMQEDFHDLFKNLDFNHDGTVEEDDLRSLMFCDFHDPKREDFGYREIANVDALRMIVEGHLDEYNNMSKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQVEISKGYGSHEWHEDLKVILRKCAESDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNLFALDEKQEICEKMRQIDRQRDKSKQTDGSPIALFNMFIDCCRNQLHVVLAMSPIGDAFRIRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDI---EMSEEIREGCIDMCKRFHTSTINLSTSFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQVATMQSELEALHPQLKVASREVDEMMIIIERESMEVAKTEKIVKADETVANDQAMAAKAIKDECDADLAGALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAVCILKGIKADKIPDPTGSGKKTEDFWGPAKRLLGDI-RFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGKLKVAMEGLRKKQAALHEVQDKLAKLQDTLELNKQKKADLEHQVDLCSKKLERAEQLIGGLGGEKTRWSNSALELGHLYINLTGDILISSGVVAYLGAFTSNYRQNQTKQWSQSCKERDIPCSDD--YSLMGTLGEAVTIRAWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQGQANKWIKNMEKTNSLQLIKLSDPSYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYSPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALILQGADNKRQLKEIEDKILEVLSLSEGNILEDETAIKILSSSKSLANEISQKQEVAEETEKKIDITRMGYRPIAIHSSILFFSIADLANIEPMYQYSLTWFINLFILSIENSEKSDILSKRLQILRDHFTYSLYVNICRSLFEKDKLLFSFCLTVNLLIHDNAINKTEWRFLLTGGIGLDNPYTNPC-TWLPQKSWDEICRLDDLPAFKTIREEFM-RLKDGWKKVYDSMEPHHEMFPEDWGNKANDFQRMLIIRCLRPDKVIPMLQEFIIKKLGRSFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMNALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKDGTWVVLQNCHLATSWMPTLEKVCEELSAESTHPDFRIWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNKFFCTELVENPQYKFDSSGIYF-VPPSGDHKSYIDYTKTLPLIPAPEVFGMNANADITKDQSETQLLFDNILLTQSHSSGSGTKSSDEVVNEVAGDILGKLPNNFDVEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAVKGLVVMSTELEEVVSSILNVKIPAMWMGKSYPSLKPLGSYVNDFLERLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNYARKFTIPIDLLGFDYEVMDDK--EYKKAPEDGVYIHGLFLDGASWDRKTKKLAESHPKVLYDTVPVMWLKPCKKSDIPRRPSYVAPLYKTSERRGTLSTTGHSTNFVIAMILPSVHPKEHWIGRGVA 4017          
BLAST of Dynein heavy chain axonemal vs. UniProt
Match: sp|E9Q8T7|DYH1_MOUSE (Dynein heavy chain 1, axonemal OS=Mus musculus OX=10090 GN=Dnah1 PE=1 SV=1)

HSP 1 Score: 5395.48 bits (13995), Expect = 0.000e+0
Identity = 2645/4222 (62.65%), Postives = 3310/4222 (78.40%), Query Frame = 2
Query:  119 KYPEVKQRGYYSEILSDGAIEQLENVTHGPPEVQNLLSQTIHYENTPKVGTFEIPDQLNSNID--VHGESTKIDIIIDFPEKSFEPKLQLMYFVAPGMIPRRVRLEREKRAYXXXXXXXXXXXXGNITSDYLIPKY----HPPNGKKFDGSWAP-YLFLETFDNEEYEIRNPDEWLAMGLEDGV--RKPVPGRALLPVTDDKHDVDIRDPSIDWTWQSVGVLDYDTDTKLWFVQKTDKSGRVIDDIGRPVIDGGLLPTGHFLEMSNQYWIPRIQLMFLAENPIKFSNRVIEAYQSRELHEALLRYHLYLDCMPMDGLGELDQSSLKRMIRLSKDETPILKKQKGLEDAVQSLEKEVMVDYWRSMNTIILHKLVGENPQKFNYITLPKPELPKVPMKGTIPMPKYDWDTKFEEFAFYSLLTKPEVVQAMCKSQYECLEARNKQLFHVPLAKHMRLEEFEQTQSQATQQVSLFLKDTWIDNLQKFIRTSLRDSKKGWFNIYETDFYVYTKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKG-LYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAE------------LHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            KYP +KQRG+YS+ILS G +++L NV  GP   QNL+ Q    + TPKV +F IP+     ++  + G +T++    DFP +S+EPK+Q+ + V PG  PR++ +ER K+ Y  L +E LL SEG I S+ L+P++    HP   ++      P YL L+ FDNEE++ R P EWL MGLE G   RKPVPG+ALLP  DD    D ++  +D+ W  VGVLDYD + KL+ VQKTDK G V D++G P+++GG+ P G    ++ QYW+PRIQL+F AE+P  F+ RV++A   R+  EALL Y+LY+DCMP +G   +++ SL + I+     TP ++K + + + +  L +EV +DY RSMN I   ++V  NP+ F+Y+TLP+ E  KVP +G + +P+Y +  + E+F F SLLT+PEV+ A+ K + EC +  +  LFH  L+K+ RLEEFEQ QSQ   QV +FLKD+WI  L+  +R SLRD  KGW+N+YET++ VY  SKL+K MEL+KY +QD++R+L  DSL +F   I DAC + ++     +W  DL+ S   P+KNP+F+VDLVLDN+G HYSTPL+ F ++ +NLFDK I A   VPQLE+ +M+DI  + +PLLESVG+ EP V++LR N+   + KA++P+++YA EY K+L L N DI+     FL+ Y+ Q  +A E++  V  HL EKEIL+  +P  IIIGPFYIN +NV+Q L+KKRKA+A ++LD+LA+ L K  D  CE F++I+RK+YE+PN+IEELAELR+W+  IP+ L   +E I K ++DYE+++EF+YNL+ DDFN KW    WP KI   I  V Q  +EDEE+FRK+Q+ D   F EKL+ L + VA    + +I +AHE+ANEVRR+ KQL + Q  A+L+NNRER+F  P+TNY+KLS++VK+F+P+ +LW   SDW++  +S MNDPL A+D+E +EK+V E +KTMHK VK F ++P+ QEVA  I+  IEEFKP+IPLIQGLRNPGMR RHWE+LS+E+ I++ PK+ LTF++CLEM LQDHIE ISK+AEVAGKEYAIEQAL+KM  EW ++ F VL YK T TYILK  DE +QLLDDHIVMTQSM FSPYKKPFE+RI  WET L+ TQ+V++EWL CQR WLYLEPIFSSEDI RQLPVE KRY TM+R+WRKIMK A++N  VI +C D RLL +L++CNKLL+ VQKGLSEYLETKR +FPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIA+L F++DLEIT M+S EGE++    S YP+ NVE+W+LE+E  M+ S+  II   +  Y  + RTEWVL WPGQV IAGCQTYWT EV++ALE  ++   L+ +L +QL  L A+VRG ++++ RM LSALIVIEVHA+DVV+ +I EN+ +++DFEWISQLRYYW +++L IRAVNAEF YGYEYLGN+ RLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKA AIQ VVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQI TIQKAQQQR++RFMFEG+E+ L PSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYA+IAEISL+SFGF++A  L+KKI TTFKLSSEQLSSQDHYDFGMRAVK+VISAAGNLKR+N TM+EELICLRAI+DVNVPKFL +DLKLF+GIVSDLFP IKEE  DYG L  +I+ +  K  LKDV GF+ KCIQL+ETTVVRHGLMLVGPTGSGK+ CY VL +A++ LK + S  G  ++ V+ YVLNPKSITMGQLYGEFDL+THEWTDGI S+LIR G  A+  +K+WY+FDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKL E MTMMFEV DLAVASPATVSRCGMVYLEPSILGL PFVECW++ LP  I P+ E+ + LF  YLE +++F+R+ ++E++ +TN  LT +++KL+D F  PF+P                      + LK               +IP E ++ I E +E WF+FSL+WS GA+ D  SR  F  +LR KM  + + L FPE+GLVYDYR D  G  S     E+++EE  + +++ WV WM     + + PD  Y +IIVPT+D V++  +   LL + KPV+C+GPTGTGKTL++S+KL KY+P EYIS F+ FSA+T+ANQTQDLIDSKLDKRRKGVFGPP+G+  IFFIDDLNMPALE +G+QPPIEL+RQW D  GWYDRK IG F++LVDINF+ +MGPPGGGRN IT RL RHFN L F E+ E S K +F  IL+ W+   + E            +  L E LV A I+VY  I SQ+LPTPAKSHYTFNLRDLSKVFQGMLM EP  +    Q+LRLW+HE+CRVF+DRLVN++DR WF  LL  ++  +F   +  V   +P+LYGDFMS   + K Y       KM++VIEE +ED+NQINTAK+ LVLF+DA+ H+CRI+R +RQ LGNALLLG+GGSGR SLT+LA+HMAEY+CFQIELSKNYG++EWR+D+K+++L AGL+N PI FLFSDTQIK+ESFLED+NN+LNSGD+PN+YS D+ ++I   M+P +Q+ GLQ TK NL +AY+ RVR N+H V+ MSPIGE+FRARLRQFP+LVNCCTIDWF++WP EAL+SVA  FL++IPELE SEEVI+GL+ +C  IHQSV++   +Y  EL+R+NYVTP SYLELL IFS +  +KK ELK A++R K+GLDKLL T E V K+QEELEIM+P LE+A +++  T E+I+ D+ +A+ET+  V  EE  A +KA + + I DDAQ+DLDEALPAL  +L SL+ LNKND+TEVRAM RPP GV+LVIE VCIMK +KPKK+ G+KPG K+DDYW+ GKGLLQDPG+FL+SLF +DKDNI ++VI+ I+PYI +E F PAAI KVS+ACTSICQWVRAM+KYHFVAK V PKR+AL  +  +LE T++IL+EA+  L  VED I  +Q K   C  +++ELE K + CE RL RADKLI GL++EK+RWQ++V NLE +++NI G+VL++AG+VAYLG FTG+YR ++   W   L  + VPHT KP   L+ T G+PVKIR+WQI GLP DTLS+EN VI +FS+RW  FIDPQGQAN+WIKN+++E+GLDV KLSD+DFLRS+ENAIRFGKPCL+ENVGEELDPALEP+LLKQT+KQQG +V+KLGD +IPYH+DFR YITTKLPNPHY+PE+STK+T++NFTLSPSGLEDQLLG VVAEERPDLE+AKNQLIVSNAKMRQELK+IED+ILYRLS +EG+PVDD++LI+ LEASK+K+ EI+AKV IAEQTE+DID TR  YIPVAVRTQILFFCV+DLA +DPMYQYSLEWFLNIF +GI N+ +AD L +RI NIN Y TFSLYSNVCRSLFEKHKL+F+FLL  RI+ +EGKI+ AEWR+LL+GGS++     NPAP+W+SDR W +IL L++LP F+ F  +F+  YL++F+ IFDS EPHRE LPG W    D FQ LL+LRCLR DKVTNAMQDFVA  L  RFIEPQTA+L+ V+K+S+ TTPLIFVLSPGTDPA+DLYKFA++MKFSKK SAISLGQGQGPRAE +++N++ERGKWVFFQNCHLAPSWMP+LERL+E I+ DKVHRDFRLWLTS+PS KFPV ILQNGSKMT+EPPRG+KANLLKSY S SDDFL+S  K  E++ LLLSLCLFHG  +ER+KFGPLGFNIPYEFTDGDLRICI+QL MFL EY D+P+KVL+YTAG INYGGRVTDDWDRRCVMN+L  FYNP V++ ++ YS SGIY QI P  D  GY++YI+SLP+ND PEIFGLHDNANITFA NET  L + +L+LQPK S+ GG+SREE+VE+V++ IL  +P    +++++K++PV+YE+SMNTVL+QEVIRYN+LL +I  +L D+LKAI+GLVVMS  LE MS SLY+N VP+ W SKAYPSLKPLASW++DL  R+ F+ +WI++GIPPVFWISGFFFPQAFLTGTLQNFARK +ISIDTI+F FKV+ +A  EI E P  GCYI GLFLEGARWD    QL ESRPKEL+TEM VIWL+P ANR +   + Y CP+YKTLTRAGTLSTTGHSTN+V ++E+P+++ Q+HWIKRGVA
Sbjct:   73 KYPLMKQRGFYSDILSPGTLDKLGNVCCGPYMSQNLIRQADLDKFTPKVDSFVIPEDFQERVEQQIIGATTRLLTQTDFPLQSYEPKVQVPFQVLPGQCPRKIEIERRKQQYLRLDIEQLLTSEG-IDSNKLMPRHPDLQHPQTIEQGRDPLFPIYLPLKVFDNEEFDCRTPTEWLNMGLEPGSQNRKPVPGKALLPTDDDLGHEDPKNQELDYRWCEVGVLDYDEEKKLYLVQKTDKRGLVRDEMGMPILNGGITPAGRPPLLATQYWVPRIQLLFCAEDPRVFTQRVVQANALRKYTEALLMYNLYVDCMPTEGRRVINEQSLSK-IKQWALSTPRMRKGQSVLEHLSCLAREVNLDYERSMNKINFDQIVSSNPETFSYVTLPEKEEEKVPNQGLVSVPEYPFREQKEDFTFVSLLTRPEVITALSKVRAECNKVTSMSLFHSSLSKYSRLEEFEQIQSQTFSQVQMFLKDSWISTLKVAMRGSLRDMSKGWYNLYETNWEVYLMSKLRKLMELIKYMLQDTLRFLVQDSLGSFTQFIGDACCSVLECVDDMDWGEDLVNSPYKPRKNPLFIVDLVLDNSGVHYSTPLEHFEMILLNLFDKGILATHAVPQLEKLVMEDIFISGDPLLESVGLHEPLVEELRANITNAMHKAMMPLQAYAKEYRKYLELNNNDIST----FLKTYQTQCPSAEEVREVVITHLKEKEILDNSLPSSIIIGPFYINVDNVKQSLSKKRKALATSMLDILAKNLHKEVDSICEEFRSISRKIYEKPNSIEELAELRDWMKGIPEKLVFLEERIVKVMSDYEVMDEFFYNLTTDDFNDKWAANNWPSKILGQIDMVRQQHVEDEEKFRKIQLMDQNNFQEKLEGLQLVVAGFSIHVEIARAHEIANEVRRVKKQLKDCQQLAMLYNNRERIFGLPITNYDKLSRMVKEFQPYLDLWTTASDWLRWSESWMNDPLSAIDAEQLEKNVIESFKTMHKCVKQFKDIPACQEVALDIRTRIEEFKPYIPLIQGLRNPGMRNRHWEVLSNEININVRPKANLTFARCLEMNLQDHIESISKVAEVAGKEYAIEQALDKMEKEWSSILFNVLPYKETDTYILKSPDEASQLLDDHIVMTQSMSFSPYKKPFEQRINSWETKLKLTQEVLEEWLNCQRAWLYLEPIFSSEDITRQLPVESKRYQTMERIWRKIMKNAYENREVINVCSDQRLLDSLRDCNKLLDLVQKGLSEYLETKRTAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIARLLFQEDLEITHMYSAEGEEVKLSFSIYPSSNVEDWLLEVERSMKASVHDIIEMAIKAYPTMLRTEWVLNWPGQVTIAGCQTYWTMEVAEALEAGNISSKLFPQLSKQLSDLVALVRGKLSRMQRMVLSALIVIEVHAKDVVSKLIDENVVSVHDFEWISQLRYYWTKDDLYIRAVNAEFIYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVERFMFEGVEIPLVPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMIAEISLYSFGFNEANVLAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPTMNEELICLRAIRDVNVPKFLQEDLKLFSGIVSDLFPTIKEEETDYGILDQAIRRSCEKNNLKDVEGFLIKCIQLYETTVVRHGLMLVGPTGSGKSNCYRVLAAAMTLLKGKPSISGGVYEAVNYYVLNPKSITMGQLYGEFDLLTHEWTDGIFSSLIRAGAIASDTNKKWYMFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLMPFVECWLKRLPAIIKPYEEQFKSLFTKYLENSINFVRNTVKEVIASTNSNLTMSLLKLLDCFFRPFLP---------------------REGLK---------------KIPSEKLSHIPELIEPWFIFSLVWSVGATGDHTSRISFSQWLRLKMRLEQVKLGFPEDGLVYDYRLDDAGISS----TEDDDEEEDENKQVSWVKWMDYSAPFTMMPDTNYCNIIVPTMDTVQMSYLLGMLLTNHKPVLCIGPTGTGKTLTVSNKLLKYLPLEYISHFLTFSARTSANQTQDLIDSKLDKRRKGVFGPPLGRNFIFFIDDLNMPALETYGAQPPIELLRQWMDHGGWYDRKVIGAFKNLVDINFVCAMGPPGGGRNAITPRLTRHFNYLSFIEMDEVSKKRIFSIILECWMDGLLGEKSYREPVPGAPNIDDLTEPLVDATINVYGIITSQLLPTPAKSHYTFNLRDLSKVFQGMLMAEPSKVEDKVQLLRLWYHENCRVFRDRLVNEEDRSWFDELLEAQM-EEFGVAFNKVCPFQPILYGDFMSPGSDVKSYELITSESKMMQVIEEYMEDYNQINTAKLRLVLFVDAMSHICRISRTLRQALGNALLLGVGGSGRSSLTRLASHMAEYECFQIELSKNYGMSEWREDVKKVLLKAGLQNLPITFLFSDTQIKNESFLEDINNVLNSGDIPNIYSADEQDQIINTMRPYIQEQGLQPTKANLMAAYTGRVRSNIHMVLCMSPIGEVFRARLRQFPSLVNCCTIDWFNEWPAEALKSVATTFLSEIPELECSEEVIQGLIQVCVFIHQSVASKCVEYLAELARHNYVTPKSYLELLNIFSILIGQKKMELKTAKNRMKSGLDKLLRTSEDVAKMQEELEIMRPLLEEAAKDTMLTMEQIKVDTAIAEETRKSVQAEEIKANEKANKAQAIADDAQKDLDEALPALDAALASLRNLNKNDVTEVRAMQRPPPGVKLVIEAVCIMKGIKPKKVPGEKPGSKVDDYWEPGKGLLQDPGRFLESLFKFDKDNIGEAVIKAIQPYIDNEEFQPAAIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQALREAQDDLEVTQRILEEAKHHLHEVEDGIATMQAKYRECVAKKEELEMKCEQCEQRLGRADKLINGLADEKVRWQETVENLENMLDNIFGDVLVAAGFVAYLGPFTGQYRTTLYEYWVNQLTVHHVPHTSKPT--LITTLGNPVKIRSWQIAGLPNDTLSVENGVINQFSQRWTHFIDPQGQANKWIKNMERESGLDVFKLSDRDFLRSMENAIRFGKPCLLENVGEELDPALEPVLLKQTYKQQGNIVLKLGDTVIPYHEDFRMYITTKLPNPHYSPEISTKLTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLIVSNAKMRQELKDIEDQILYRLSSSEGNPVDDMELIKVLEASKMKAAEIQAKVRIAEQTEKDIDLTRMEYIPVAVRTQILFFCVSDLANVDPMYQYSLEWFLNIFLSGIANSERADNLKKRIVNINRYLTFSLYSNVCRSLFEKHKLMFAFLLCVRIMMNEGKINQAEWRYLLSGGSIQTM-FENPAPQWLSDRAWRDILALSNLPTFATFSNDFVM-YLSEFQAIFDSAEPHRELLPGIWNAYLDEFQKLLILRCLRGDKVTNAMQDFVATHLEPRFIEPQTANLSAVFKESNSTTPLIFVLSPGTDPAADLYKFAEEMKFSKKFSAISLGQGQGPRAEAMMRNSIERGKWVFFQNCHLAPSWMPALERLIEHINPDKVHRDFRLWLTSLPSNKFPVSILQNGSKMTIEPPRGVKANLLKSYNSLSDDFLHSCQKVVEFKSLLLSLCLFHGNALERRKFGPLGFNIPYEFTDGDLRICISQLKMFLDEYEDIPYKVLKYTAGEINYGGRVTDDWDRRCVMNILEDFYNPAVLSSEHSYSNSGIYHQIPPTYDLNGYLSYIKSLPLNDMPEIFGLHDNANITFAQNETFALFNAILQLQPKSSSMGGQSREELVEDVAENILLQVPGPIELQEVTKKFPVLYEESMNTVLVQEVIRYNKLLEVITQTLSDMLKAIKGLVVMSLELELMSISLYNNTVPELWKSKAYPSLKPLASWIMDLLLRLDFMHSWINDGIPPVFWISGFFFPQAFLTGTLQNFARKFVISIDTITFDFKVLPEASSEIKERPQTGCYIHGLFLEGARWDSMNFQLAESRPKELYTEMAVIWLLPEANRKVQNQDFYLCPIYKTLTRAGTLSTTGHSTNYVIAVEIPSNQPQRHWIKRGVA 4243          
BLAST of Dynein heavy chain axonemal vs. UniProt
Match: sp|Q9P2D7|DYH1_HUMAN (Dynein heavy chain 1, axonemal OS=Homo sapiens OX=9606 GN=DNAH1 PE=1 SV=5)

HSP 1 Score: 5351.95 bits (13882), Expect = 0.000e+0
Identity = 2623/4222 (62.13%), Postives = 3283/4222 (77.76%), Query Frame = 2
Query:  119 KYPEVKQRGYYSEILSDGAIEQLENVTHGPPEVQNLLSQTIHYENTPKVGTFEIPDQLNSNIDVH--GESTKIDIIIDFPEKSFEPKLQLMYFVAPGMIPRRVRLEREKRAYXXXXXXXXXXXXGNITSDYLIPKY----HPPNGKK-FDGSWAPYLFLETFDNEEYEIRNPDEWLAMGLEDGV--RKPVPGRALLPVTDDKHDVDIRDPSIDWTWQSVGVLDYDTDTKLWFVQKTDKSGRVIDDIGRPVIDGGLLPTGHFLEMSNQYWIPRIQLMFLAENPIKFSNRVIEAYQSRELHEALLRYHLYLDCMPMDGLGELDQSSLKRMIRLSKDETPILKKQKGLEDAVQSLEKEVMVDYWRSMNTIILHKLVGENPQKFNYITLPKPELPKVPMKGTIPMPKYDWDTKFEEFAFYSLLTKPEVVQAMCKSQYECLEARNKQLFHVPLAKHMRLEEFEQTQSQATQQVSLFLKDTWIDNLQKFIRTSLRDSKKGWFNIYETDFYVYTKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKG-LYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAE------------LHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            KYP +KQRG+YS+ILS G ++QL  V  GP   QNLL Q    + TP+VG+FE+P+     ++    G +T++    DFP +++EPK+Q+ + V PG  PR++ +ER K+ Y  L +E LL S+G I S+ L+P++    HP   ++  D  +  YL L+ FDNE+++ R P EW+ MGLE G   RKPVPG+ALLP  D     D +   + + W  VGVLDYD + KL+ V KTD+ G V D++GRP+++ G+   G       QYW+PRIQL+F AE+P  F+ RV++A   R+  EALL Y+LY+DCMP DG   + + SL + I+     TP ++K   + + + SL +EV +DY RSMN I    +V   P+ F+Y+TLPK E  +VP +G + +PKY +  + E+F F SLLT+PEV+ A+ K + EC +     LFH  L+K+  LEEFEQ QSQ   QV +FLKD+WI +L+  +R+SLRD  KGW+N+YET++ VY  SKL+K MELVKY +QD++R+L  DSL +F   I+D C + +       W +DL+ S   P+KNP+F++DLVLD++G HYSTPL+QF    +NLFDK I A   VPQLE+ +M+DI  + +PLLESVG+ EP V++LR  +   + KA+IP+++YA EY K+L L N DI      FL+ Y+ Q   A E++  V  HL EKEIL+  +P  IIIGPFYINT+NV+Q L+KKRKA+A ++LD+LA+ L K  D  CE F++I+RK+YE+PN+IEELAELREW+  IP+ L   +E I K + DY++++EF YNLS+DDFN KW    WP KI   I  V+Q  +EDEE+FRK+Q+ D   F EKL+ L + VA    + +I++AHE+ANEVRR+ KQL + Q  A+L+NNRER+F+ P+TNY+KLS++VK+F+P+ +LW   SDW++  +S MNDPL A+D+E +EK+V E +KTMHK VK F ++P+ QEVA  I+  IEEFKP+IPLIQGLRNPGMR RHWE LS+++ I++ PK+ LTF++CLEM LQDHIE ISK+AEVAGKEYAIEQAL+KM  EW  + F VL YK T TYILK  DE +QLLDDHIVMTQ+M FSPYKKPFE+RI  WE  L+ TQ+V++EWL CQR WLYLEPIFSSEDIN+QLPVE KRY TM+R+W+KIMK A++N  VI +C D R+L +L++CNK+L+ VQKGLSEYLETKR +FPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIA+L F++DLEIT M+S EGE++    S YP+ NVE+W+ E+E  M+ S+  II K +  Y  +PRT+WVL WPGQV IAGCQTYWT EV++ALE  +L+  L+ +L +QL  L A+VRG ++++ R  LSALIVIEVHA+DVV+ +I EN+ ++NDF+WISQLRYYW   +L IRAVNAEF YGYEYLGN+ RLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKA AIQ VVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQI TIQKAQQQR++RFMFEG+E+ L PSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYA+I EISL+SFGF++A  L+KKI TTFKLSSEQLSSQDHYDFGMRAVK+VISAAGNLKR+N +M+EELICLRAI+DVNVPKFL +DLKLF+GIVSDLFP IKEE  DYG L  +I+ A R   LKDV GF+ KCIQL+ETTVVRHGLMLVGPTGSGK+ CY VL +A++SLK Q S  G  ++ V+ YVLNPKSITMGQLYGEFDL+THEWTDGI S+ IR G   +  +K+WY+FDGPVDA+WIENMNTVLDDNKKLCLSSGEIIKL E MTMMFEV DLAVASPATVSRCGMVYLEPSILGL PF+ECW+R LP  + P+ E  + LF  +LEE++ F+R +++E++ +TN  LT +++KL+D F  PF+P                      + LK               +IP E +++I E +E WF+FSLIWS GA+ D+  R  F  +LR KM  + + L FPEEGLV+DYR +  G         ++E+E  + +++ WV WM +   + + PD  Y +IIVPT+D V++  + + LL +KKPV+C+GPTGTGKTL+ISDKL K +  +YIS F+ FSA+T+ANQTQD IDSKLDKRRKGVFGPP+G+  IFFIDDLNMPALE +G+QPPIEL+RQW D  GWYDRK IG F++LVDINF+ +MGPPGGGRN +T RLMRHFN L F E+ E S K +F TIL  W+   + E            +    E LV+A I VY  I SQ+LPTPAKSHYTFNLRDLSKVFQGMLM +P  +    Q+LRLW+HE+CRVF+DRLVN++DR WF  LL  +    +   +  V   +P+LYGDFMS   + K Y       KM++VIEE +ED+NQINTAK+ LVLFMDA+ H+CRI+R +RQ LGNALLLG+GGSGR SLT+LA+HMAEY+CFQIELSKNYG++EWRDD+K+++L AGL+N PI FLFSDTQIK+ESFLED+NN+LNSGD+PNLY+ D+ ++I   M+P +Q+ GLQ TK NL +AY+ RVR N+H V+ MSPIGE+FRARLRQFP+LVNCCTIDWF++WP EAL+SVA  FLN+IPELE S+E I+GL+ +C  IHQSVS    +Y  EL+R+NYVTP SYLELL IFS +  +KK ELK A++R K+GLDKLL T E V K+QE+LE M P LE+A +++  T E+I+ D+ +A+ET+  V  EE  A +KAK+ + I DDAQ+DLDEALPAL  +L SL+ LNKND+TEVRAM RPP GV+LVIE VCIMK +KPKK+ G+KPG K+DDYW+ GKGLLQDPG FL+SLF +DKDNI D VI+ I+PYI +E F PA I KVS+ACTSICQWVRAM+KYHFVAK V PKR+AL  +  +L  T++IL EA+ +L+ VED I  +Q K   C  +++ELE K + CE RL RA KLI GLS+EK+RWQ++V NL++++NNI G+VL++AG+VAYLG FTG+YR  +   W   L+++ VPHT +P   L+ T G+PVKIR+WQI GLP DTLS+EN VI +FS+RW  FIDPQ QAN+WIKN++K+NGLDV KLSD+DFLRS+ENAIRFGKPCL+ENVGEELDPALEP+LLKQT+KQQG  V+KLGD +IPYH+DFR YITTKLPNPHYTPE+STK+T++NFTLSPSGLEDQLLG VVAEERPDLE+AKNQLI+SNAKMRQELK+IED+ILYRLS +EG+PVDD++LI+ LEASK+K+ EI+AKV IAEQTE+DID TR  YIPVA+RTQILFFCV+DLA +DPMYQYSLEWFLNIF +GI N+ +AD L +RI NIN Y T+SLYSNVCRSLFEKHKL+F+FLL  RI+ +EGKI+ +EWR+LL+GGS+      NPAP+W+SDR W +IL L++LP FS F  +F+ K+L++F+ IFDSLEPHRE LPG W    D+FQ LLVLRCLR DKVTNAMQDFVA  L  RFIEPQTA+L++V+KDS+ TTPLIFVLSPGTDPA+DLYKFA++MKFSKKLSAISLGQGQGPRAE ++++++ERGKWVFFQNCHLAPSWMP+LERL+E I+ DKVHRDFRLWLTS+PS KFPV ILQNGSKMT+EPPRG++ANLLKSY+S  +DFLNS  K  E++ LLLSLCLFHG  +ER KFGPLGFNIPYEFTDGDLRICI+QL MFL EY D+P+KVL+YTAG INYGGRVTDDWDRRC+MN+L  FYNP V++ ++ YS SGIY QI P  D  GY++YI+SLP+ND PEIFGLHDNANITFA NET  LL  +++LQPK S+AG + REEIVE+V++ IL  +PE  N++ +  +YPV+YE+SMNTVL+QEVIRYNRLL +I  +L+DLLKA++GLVVMS  LE M+ SLY+N VP+ W++KAYPSLKPL+SWV+DL QR+ F+Q WI +GIP VFWISGFFFPQAFLTGTLQNFARK +ISIDTISF FKVM +A  E+T+ P  GCYI GLFLEGARWD    QL ES+PKEL+TEM VIWL+P  NR     + Y CP+YKTLTRAGTLSTTGHSTN+V ++E+PT + Q+HWIKRGVA
Sbjct:   88 KYPLMKQRGFYSDILSPGTLDQLGEVCRGPRMSQNLLRQADLDKFTPRVGSFEVPEDFQERMEQQCIGSTTRLLAQTDFPLQAYEPKMQVPFQVLPGQHPRKIEIERRKQQYLSLDIEQLLFSQG-IDSNKLMPRHLDHQHPQTIEQGHDPIFPIYLPLKVFDNEDFDCRTPREWINMGLEPGSLDRKPVPGKALLPTDDFLGHEDPKSQKLKYKWCEVGVLDYDEEKKLYLVHKTDEKGLVRDEMGRPILNAGVTTEGRPPLQVCQYWVPRIQLLFCAEDPCMFAQRVVQANALRKNTEALLLYNLYVDCMPSDGQHVISEQSLSK-IKQWALSTPRMRKGPSVLEHLSSLAREVSLDYERSMNKINFDHVVSSKPETFSYVTLPKKEEEQVPERGLVSVPKYHFWEQKEDFTFVSLLTRPEVITALSKVRAECNKVTAMSLFHSSLSKYSHLEEFEQIQSQTFSQVQMFLKDSWISSLKVAMRSSLRDMSKGWYNLYETNWEVYLMSKLRKLMELVKYMLQDTLRFLVQDSLASFSQFISDTCCSVLNCTDDMVWGDDLINSPYRPRKNPLFIMDLVLDSSGVHYSTPLEQFEASLLNLFDKGILATHAVPQLEKLVMEDIFISGDPLLESVGLHEPLVEELRATIASAVSKAMIPLQAYAKEYRKYLELNNNDIAS----FLKTYQTQGLLAQEVREVVLTHLREKEILDSSLPSSIIIGPFYINTDNVKQSLSKKRKALATSVLDILAKNLHKEVDSICEEFRSISRKIYEKPNSIEELAELREWMKGIPERLVGLEERIVKVMDDYQVMDEFLYNLSSDDFNDKWIASNWPSKILGQIELVQQQHVEDEEKFRKIQIMDQNNFQEKLEGLQLVVAGFSIHVEISRAHEIANEVRRVKKQLKDCQQLAMLYNNRERIFSLPITNYDKLSRMVKEFQPYLDLWTTASDWLRWSESWMNDPLSAIDAEQLEKNVVEAFKTMHKCVKQFKDMPACQEVALDIRARIEEFKPYIPLIQGLRNPGMRIRHWETLSNQININVRPKANLTFARCLEMNLQDHIESISKVAEVAGKEYAIEQALDKMEKEWSTILFNVLPYKATDTYILKSPDEASQLLDDHIVMTQNMSFSPYKKPFEQRINSWENKLKLTQEVLEEWLNCQRSWLYLEPIFSSEDINQQLPVESKRYQTMERIWKKIMKNAYENREVINVCSDLRMLDSLRDCNKILDLVQKGLSEYLETKRSAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIARLLFQEDLEITHMYSAEGEEVQLCFSIYPSSNVEDWLREVERSMKASVHDIIEKAIRAYPTMPRTQWVLNWPGQVTIAGCQTYWTMEVAEALEAGNLRSQLFPQLCQQLSDLVALVRGKLSRMQRAVLSALIVIEVHAKDVVSKLIQENVVSVNDFQWISQLRYYWTNNDLYIRAVNAEFIYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVERFMFEGVEIPLVPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMITEISLYSFGFNEASVLAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPSMNEELICLRAIRDVNVPKFLQEDLKLFSGIVSDLFPTIKEEDTDYGILDEAIREACRNSNLKDVEGFLTKCIQLYETTVVRHGLMLVGPTGSGKSTCYRVLAAAMTSLKGQPSISGGMYEAVNYYVLNPKSITMGQLYGEFDLLTHEWTDGIFSSFIRAGAITSDTNKKWYMFDGPVDAIWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLMPFIECWLRKLPPLLKPYEEHFKALFVSFLEESISFVRSSVKEVIASTNCNLTMSLLKLLDCFFKPFLP---------------------REGLK---------------KIPSEKLSRIVELIEPWFIFSLIWSVGATGDSSGRTSFSHWLRLKMENEQLTLLFPEEGLVFDYRLEDAGI----SGTNDSEDEEEEYKQVAWVKWMDSSAPFTMVPDTNYCNIIVPTMDTVQMSHLLDMLLTNKKPVLCIGPTGTGKTLTISDKLLKNLALDYISHFLTFSARTSANQTQDFIDSKLDKRRKGVFGPPLGRNFIFFIDDLNMPALETYGAQPPIELLRQWMDHGGWYDRKIIGAFKNLVDINFVCAMGPPGGGRNTVTPRLMRHFNYLSFAEMDEVSKKRIFSTILGNWLDGLLGEKSYRERVPGAPHIAHFTEPLVEATIMVYATITSQLLPTPAKSHYTFNLRDLSKVFQGMLMADPAKVEDQVQLLRLWYHENCRVFRDRLVNEEDRSWFDQLL-KRCMEQWEVTFNKVCPFQPILYGDFMSPGSDVKSYELITSESKMMQVIEEYIEDYNQINTAKLKLVLFMDAMSHICRISRTLRQALGNALLLGVGGSGRSSLTRLASHMAEYECFQIELSKNYGMSEWRDDVKKVLLKAGLQNLPITFLFSDTQIKNESFLEDINNVLNSGDIPNLYTADEQDQIVSTMRPYIQEQGLQPTKANLMAAYTGRVRSNIHMVLCMSPIGEVFRARLRQFPSLVNCCTIDWFNEWPAEALKSVATVFLNEIPELESSQEEIQGLIQVCVYIHQSVSKKCIEYLAELTRHNYVTPKSYLELLHIFSILIGQKKLELKTAKNRMKSGLDKLLRTSEDVAKMQEDLESMHPLLEEAAKDTMLTMEQIKVDTAIAEETRNSVQTEEIKANEKAKKAQAIADDAQKDLDEALPALDAALASLRNLNKNDVTEVRAMQRPPPGVKLVIEAVCIMKGIKPKKVPGEKPGTKVDDYWEPGKGLLQDPGHFLESLFKFDKDNIGDVVIKAIQPYIDNEEFQPATIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQALLEAQDDLGVTQRILDEAKQRLREVEDGIATMQAKYRECITKKEELELKCEQCEQRLGRAGKLINGLSDEKVRWQETVENLQYMLNNISGDVLVAAGFVAYLGPFTGQYRTVLYDSWVKQLRSHNVPHTSEPT--LIGTLGNPVKIRSWQIAGLPNDTLSVENGVINQFSQRWTHFIDPQSQANKWIKNMEKDNGLDVFKLSDRDFLRSMENAIRFGKPCLLENVGEELDPALEPVLLKQTYKQQGNTVLKLGDTVIPYHEDFRMYITTKLPNPHYTPEISTKLTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLIISNAKMRQELKDIEDQILYRLSSSEGNPVDDMELIKVLEASKMKAAEIQAKVRIAEQTEKDIDLTRMEYIPVAIRTQILFFCVSDLANVDPMYQYSLEWFLNIFLSGIANSERADNLKKRISNINRYLTYSLYSNVCRSLFEKHKLMFAFLLCVRIMMNEGKINQSEWRYLLSGGSISIMT-ENPAPDWLSDRAWRDILALSNLPTFSSFSSDFV-KHLSEFRVIFDSLEPHREPLPGIWDQYLDQFQKLLVLRCLRGDKVTNAMQDFVATNLEPRFIEPQTANLSVVFKDSNSTTPLIFVLSPGTDPAADLYKFAEEMKFSKKLSAISLGQGQGPRAEAMMRSSIERGKWVFFQNCHLAPSWMPALERLIEHINPDKVHRDFRLWLTSLPSNKFPVSILQNGSKMTIEPPRGVRANLLKSYSSLGEDFLNSCHKVMEFKSLLLSLCLFHGNALERHKFGPLGFNIPYEFTDGDLRICISQLKMFLDEYDDIPYKVLKYTAGEINYGGRVTDDWDRRCIMNILEDFYNPDVLSPEHSYSASGIYHQIPPTYDLHGYLSYIKSLPLNDMPEIFGLHDNANITFAQNETFALLGTIIQLQPKSSSAGSQGREEIVEDVTQNILLKVPEPINLQWVMAKYPVLYEESMNTVLVQEVIRYNRLLQVITQTLQDLLKALKGLVVMSSQLELMAASLYNNTVPELWSAKAYPSLKPLSSWVMDLLQRLDFLQAWIQDGIPAVFWISGFFFPQAFLTGTLQNFARKFVISIDTISFDFKVMFEAPSELTQRPQVGCYIHGLFLEGARWDPEAFQLAESQPKELYTEMAVIWLLPTPNRKAQDQDFYLCPIYKTLTRAGTLSTTGHSTNYVIAVEIPTHQPQRHWIKRGVA 4258          
BLAST of Dynein heavy chain axonemal vs. UniProt
Match: sp|Q63164|DYH1_RAT (Dynein heavy chain 1, axonemal OS=Rattus norvegicus OX=10116 GN=Dnah1 PE=2 SV=2)

HSP 1 Score: 5096.18 bits (13218), Expect = 0.000e+0
Identity = 2518/4122 (61.09%), Postives = 3131/4122 (75.96%), Query Frame = 2
Query:  695 KHDVDIRDPS---IDWTWQSVGVLDYDTDTKLWFVQKTDKSGRVIDDIGRPVIDGGLLPTGHFLEMSNQYWIPRIQLMFLAENPIKFSNRVIEAYQSRELHEALLRYHLYLDCMPMDGLGELDQSSLKRMIRLSKDETPILKKQKGLEDAVQSLEKEVMVDYWRSMNTIILHKLVGENPQKFNYITLPKPELPKVPMKGTIPMPKYDWDTKFEEFAFYSLLTKPEVVQAMCKSQYECLEARNKQLFHVPLAKHMRLEEFEQTQSQATQQVSLFLKDTWIDNLQKFIRTSLRDSKKGWFNIYETDFYVYTKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLD----------------------------------------EQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKG-LYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFM--FEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSL-------------------------------------XXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAE-------------LHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADK------------------LIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            +  +D  DP    +D+ W  VGVLDYD + KL+ VQKTDK G V D++G P+++GG+ P G    +  QYW+PRIQL+F AE+P  F+ RV++A   R+  EALL Y+LY+DCMP +G   +++ SL + I+     TP ++K   + + + SL +EV +DY RSMN I   ++V   P+ F+++TLP+ E  KVP +G + +P+Y +  + E+F F SLLT+ EV+ A+ K + EC +  +  LFH  L+K+ RLEEFEQ QSQ   QV +FLKD+WI  L+  +R+SLRD  KGW+N+YET++ VY  SKL+K MEL+KY +QD++R+L  DSL +F   I DAC + ++     +W  DL+ S   P+KNP+F+VDLVLDN G HYSTPL+QF ++ +NLFDK I A   VPQLE+ +M+DI  + +PLLESVG+ EP V++LR N+   + KA+IP+++YA EY K                   Y+ Q  +A E++  V  HL EKEIL+  +P  IIIGPFYIN +NV+Q L+KKRKA+A ++LD+LA+ L    D  CE F++I+RK+YE+PN+IEELAELR+W+  IP+ L                                           QE I K ++DYE+++EF+YNL+ DDFN KW    WP KI   I  V Q  +EDEE+FRK+Q+ D   F EKL+ L + VA   ++ +I +AHE+ANEVRR+ KQL + Q  A+L+NNRER+F  P+TNY+KLS++VK+F+P+ +LW   SDW++  +S MNDPL A+D+E +EK+V E +KTMHK VK F ++P+ Q+VA  I+  I+EFKP+IPLIQGLRNPGMR RHWE+LS+E+ I++ PK+ LTF++CLEM LQD+IE ISK+AEVAGKEYAIEQAL+KM  EW ++ F VL YK T TYILK  DE +QLLDDHIVMTQSM FSPYKKPFE+RI  WET L+ TQ+V++EWL CQR WLYLEPIFSSEDI RQLPVE KRY TM+R+WRKIMK A++N  VI +C D RLL +L++CNKLL+ VQKGLSEYLETKR +FPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIA+L F++DLEIT M+S EGE++    S YP+ NVE+W+LE+E  M+ S+  II   +  Y  + RTEWVL WPGQV IAGCQTYWT EV+ ALE   +   L+ +L +QL  L A+VRG ++++ RM LSALIVIEVHA+DVV+ +I EN+ +++DFEWISQLRYYW   +L IRAVNAEF YGYEYLGN+ RLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKA AIQ VVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQI TIQKAQQQR   ++    G  + L   C +++                +ALFRPVAMMVPDYA+IAEISL+SFGF++A  L+KKI TTFKLSSEQLSSQDHYDFGMRAVK+VISAAGNLKR+N TM+EELICLRAI+DVNVPKFL +DLKLF+GIVSDLFP  KEE  DYG L  +I+ A  K  LKDV GF+ KCIQL+ETTVVRHGLMLVGPTGSGK+ CY +L +A++SLK + S  G  ++ V+ YVLNPKSITMGQLYGEFDL+THEWTDGI  +LIR G  A+  +K+WY+FDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKL E MTMMFEV DLAVASPATVSRCGMVYLEPSILGL PFVECW++ LP  I P+ E+ + LF  +LE ++ F+R  ++E+V +TN  LT +++KL+D F  PF+P                      + LK               +IP E ++ I E +E WF+FSL+WS GA+ D  SR  F  +L+ KM  + I L FPEEGLVYDYR D  G  S                                      +   E+      +   + WV WM     + + PD  Y +IIVPT+D +++  +   L+ + KPV+C+GPTGTGKTL++S+KL K +P EYIS F+ FSA+T+ANQTQDLIDSKLDKRRKGVFGPP+G+  IFFIDDLNMPALE +G+QPPIEL+RQW D  GWYDRK IG F++LVDINF+ +MGPPGGGRN IT RL RHFN L F E+ E S K +F  IL  W+   + E             +H + E LV A I +Y  I SQ+LPTPAKSHYTFNLRDLSKVFQG+LM EP  +    Q+LRLW+HE+CRVF+DRLVN++DR WF  LL  K+  D    +  V   +P+LYGDFMS   + K Y      +KM++VIEE +ED+NQINTAK+ LVLF+DA+ H+CRI+R +RQ LGNALLLG+GGSGR SLT+LA+HMAEY+CFQ+ELSKNYG++EWR+D+K+I+L AG++N PI FLFSDTQIK+ESFLED+NNILNSGD+PNLYS D+ ++I   M+P +Q+ GLQ TK NL +AY+ RVR N+H V+ MSPIGE+FRARLRQFP+LVNCCTIDWF++WP EAL+SVA +FL++IPELE S EVI GL+++C  IHQSV+    +Y  EL+R+NYVTP SYLELL IFS +  +KK ELK A+ R K+GLDKLL T E V K+QEELEIM+P LE+A +++  T ++I+ D+ +A+ET+  V  EE  A +KA + + I DDAQ+DLDEALPAL  +L SL+ LNKND+TEVRAM RPP GV+LVIE VCIMK +KPKK+ G+KPG K+DDYW+ GKGLLQDPG+FL+SLF +DKDNI ++VI+ I+PYI +E F PAAI KVS+ACTSICQWVRAM+KYHFVAK V PKR+AL  +  +LE T++IL+EA+  L+ VED I  LQ K   C  +++ELE K + CE RL RADK                  LI GL++EK+RWQD+V NLE +++NI G+VL++AG+VAYLG FTG+YR ++   W   L  YGVPHT KP   L+ T G+PVKIR+WQI GLP DTLS+EN VI +FS+RW  FIDPQGQAN+WIKN++KE+GLDV KLSD+DFLRS+ENAIRFGKPCL+ENVGEELDPALEP+LLKQT+KQQG  V+KLGD +IPYH+DFR YITTKLPNPHY+PEVSTK+T++NFTLSPSGLEDQLLG VVAEERPDLE+AKNQLI+SNAKMRQELK+IED+ILYRLS +EG+PVDD++LI+ LEASK+K+ EI+AKV IAEQTE+DID TR  YIPVAVRTQILFFCV+DLA +DPMYQYSLEWFLNIF +GI N+ +AD L +RI NIN Y TFSLYSNVCRSLFEKHKL+F+FLL  RI+ +EGKI+  EWR+LL+GGS++     NPAP W+SDR W +IL L++LPAFS F  +F+ ++L  F+ IFDS EPHRE LPG W    D FQ LL+LRCLR DKVTNAMQDFVA+ L  RFIEPQTA+L+ V+K+S+ TTPLIFVLSPGTDPA+DLYKFA++MKFSKKLSAISLGQGQGPRAE +++N++ERGKWVFFQNCHLAPSWMP+LERL+E I+ DKVHRDFRLWLTS+PS KFPV ILQNGSKMT+EPPRG+KANLLKSY S SDDFL+S  K  E++ LLLSLCLFHG  +ER+KFGPLGFNIPYEFTDGDLRICI+QL MFL EY D+P+KVL+YTAG INYGGRVTDDWDRRCVMN+L  FYNP V++ ++ YS+SGIY QI P  D  GY++YI+SLP+ND PEIFGLHDNANITFA NET  L   +L+LQPK S+ GG+SREE+VE+V+++IL  +P+  ++E++  +YPV+YE+SMNTVL+QEVIRYN+LL +I  +L D+LKAI+GLVVMS  LE MS SLY+N VP+ W SKAYPSLKPLASW++DL QR+ F+ +WI NGIP VFWISGFFFPQAFLTGTLQNFARK +ISIDTI+F FKV+  A  EI E PS GCYI GLFLEGARWD    QL ESRPKEL+TEM VIWL+P ANR +   + Y CP+YKTLTRAGTLSTTGHSTN+V ++E+P+++ Q+HWIKRGVA
Sbjct:  465 RDHLDFEDPKSQELDYRWCEVGVLDYDEEKKLYLVQKTDKRGLVRDEMGMPIVNGGVTPEGRPPLLDTQYWVPRIQLLFCAEDPRVFTQRVVQANALRKNTEALLLYNLYVDCMPTEGQRVINEQSLSK-IKQWALSTPRMRKGPSVLEHLSSLAREVNLDYERSMNKINFDQIVSSKPETFSFVTLPEKEEEKVPNQGLVSVPEYPFREQKEDFTFVSLLTRSEVITALSKVRAECNKVTSMSLFHSNLSKYSRLEEFEQIQSQTFSQVQMFLKDSWISTLKVAMRSSLRDMSKGWYNLYETNWEVYLMSKLRKLMELIKYMLQDTLRFLVQDSLGSFAQFIGDACCSVLECIDDMDWGEDLINSPYKPRKNPLFIVDLVLDNTGVHYSTPLEQFEVILLNLFDKGILATHAVPQLEKLVMEDIFISGDPLLESVGLHEPLVEELRANITNAMHKAMIPLQAYAKEYRK------------------TYQTQCPSAEEVREVVITHLKEKEILDNSLPSSIIIGPFYINVDNVKQSLSKKRKALATSMLDILAKNLHNEVDSICEEFRSISRKIYEKPNSIEELAELRDWMKGIPEKLVILEVRQALALAARSLVEPEVGPALEIPFNNPLPSMTRHFLLMQERIVKVMSDYEVMDEFFYNLTTDDFNDKWAANNWPTKILGQIDMVRQQHVEDEEKFRKIQLMDQNNFQEKLEGLQLVVAGFSTHVEIARAHEIANEVRRVKKQLKDCQQLAMLYNNRERIFGLPITNYDKLSRMVKEFQPYLDLWTTASDWLRWSESWMNDPLSAIDAEQLEKNVIESFKTMHKCVKQFKDIPACQDVALDIRARIDEFKPYIPLIQGLRNPGMRNRHWEVLSNEININVRPKANLTFARCLEMNLQDYIESISKVAEVAGKEYAIEQALDKMEKEWASILFNVLPYKETDTYILKSPDEASQLLDDHIVMTQSMSFSPYKKPFEQRINSWETKLKLTQEVLEEWLNCQRSWLYLEPIFSSEDITRQLPVESKRYQTMERIWRKIMKNAYENREVINVCSDQRLLDSLRDCNKLLDLVQKGLSEYLETKRTAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIARLLFQEDLEITHMYSAEGEEVKLSFSIYPSSNVEDWLLEVERSMKASVHDIIEMAIKAYPTMLRTEWVLSWPGQVTIAGCQTYWTLEVAQALEASSISSSLFPQLSKQLSDLVALVRGKLSRMQRMVLSALIVIEVHAKDVVSKLIDENVVSVHDFEWISQLRYYWTNNDLYIRAVNAEFIYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRSREYIKSLGGAVMCLPFLCVLYV----------------QALFRPVAMMVPDYAMIAEISLYSFGFNEANVLAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPTMNEELICLRAIRDVNVPKFLQEDLKLFSGIVSDLFPTTKEEETDYGILDQAIRKACEKNNLKDVEGFLIKCIQLYETTVVRHGLMLVGPTGSGKSNCYRILAAAMTSLKGKPSISGGVYEAVNYYVLNPKSITMGQLYGEFDLLTHEWTDGIFPSLIRAGAIASDTNKKWYMFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLMPFVECWLKHLPSIIKPYEEQFKTLFVKFLESSIAFVRTTVKEVVASTNSNLTMSLLKLLDCFFKPFLP---------------------REGLK---------------KIPSEKLSHIPELIEPWFIFSLVWSVGATGDHSSRLNFSQWLKIKMVFEQIKLAFPEEGLVYDYRLDDAGISSTEDDDEDDEESKQVATALPAQEGGMVKPPGLWDLPPRDSGHLEKATLTASRSEAVAWVKWMDYSVPFTMMPDTNYCNIIVPTMDTMQMSYLLGMLITNHKPVLCIGPTGTGKTLTVSNKLLKNLPLEYISHFLTFSARTSANQTQDLIDSKLDKRRKGVFGPPLGRNFIFFIDDLNMPALETYGAQPPIELLRQWMDHGGWYDRKIIGAFKNLVDINFVCAMGPPGGGRNAITPRLTRHFNYLSFIEMDEVSKKRIFSIILGCWMDGLLGEKSYREPVPGAPNIVH-MTEPLVNATISIYAIITSQLLPTPAKSHYTFNLRDLSKVFQGILMAEPAKVEDKVQLLRLWYHENCRVFRDRLVNEEDRGWFDGLLEMKM-EDLGVAFNKVCPFQPILYGDFMSPGSDVKSYELITSENKMMQVIEEYMEDYNQINTAKLKLVLFVDAMSHICRISRTLRQALGNALLLGVGGSGRSSLTRLASHMAEYECFQVELSKNYGMSEWREDVKKILLKAGMQNLPITFLFSDTQIKNESFLEDINNILNSGDIPNLYSADEQDQIVNTMRPYIQEQGLQPTKANLMAAYTGRVRNNIHMVLCMSPIGEVFRARLRQFPSLVNCCTIDWFNEWPAEALQSVATRFLHEIPELECSSEVIEGLIHVCVYIHQSVAKKCVEYLAELARHNYVTPKSYLELLNIFSILIGQKKMELKTAKHRMKSGLDKLLRTSEDVAKMQEELEIMRPLLEEAAKDTLLTMDQIKVDTAIAEETRKSVQAEEIKANEKASKAQAIADDAQKDLDEALPALDAALASLRNLNKNDVTEVRAMQRPPPGVKLVIEAVCIMKGIKPKKVPGEKPGSKVDDYWEPGKGLLQDPGRFLESLFKFDKDNIGEAVIKAIQPYIDNEEFQPAAIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQALREAQDDLEVTQRILEEAKHHLREVEDGISTLQAKYRECVTKKEELEMKCEQCEQRLGRADKSQSPGQPPGAHPTRLLLQLINGLADEKVRWQDTVENLENMLDNIFGDVLVAAGFVAYLGPFTGQYRAALYEYWVNQLTVYGVPHTSKPT--LISTLGNPVKIRSWQIAGLPNDTLSVENGVINQFSQRWTHFIDPQGQANKWIKNMEKESGLDVFKLSDRDFLRSMENAIRFGKPCLLENVGEELDPALEPVLLKQTYKQQGNTVLKLGDTVIPYHEDFRMYITTKLPNPHYSPEVSTKLTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLIISNAKMRQELKDIEDQILYRLSSSEGNPVDDVELIKVLEASKMKAAEIQAKVRIAEQTEKDIDLTRMEYIPVAVRTQILFFCVSDLANVDPMYQYSLEWFLNIFLSGIANSERADNLKKRIVNINRYLTFSLYSNVCRSLFEKHKLMFAFLLCVRIMMNEGKINQGEWRYLLSGGSIQTMS-ENPAPHWLSDRAWRDILALSNLPAFSTFSTDFV-QHLPKFQAIFDSAEPHREPLPGIWNTYLDEFQKLLILRCLRGDKVTNAMQDFVANHLEPRFIEPQTANLSAVFKESNSTTPLIFVLSPGTDPAADLYKFAEEMKFSKKLSAISLGQGQGPRAEAMMRNSIERGKWVFFQNCHLAPSWMPALERLIEHINPDKVHRDFRLWLTSLPSNKFPVSILQNGSKMTIEPPRGVKANLLKSYNSLSDDFLHSCQKVVEFKSLLLSLCLFHGNALERRKFGPLGFNIPYEFTDGDLRICISQLKMFLDEYEDIPYKVLKYTAGEINYGGRVTDDWDRRCVMNILEDFYNPAVLSPEHRYSKSGIYHQIPPTYDLNGYLSYIKSLPLNDMPEIFGLHDNANITFAQNETFALFGAILQLQPKSSSMGGQSREELVEDVAEDILVQVPKPVDLEEVVNKYPVLYEESMNTVLVQEVIRYNKLLMVITQTLSDMLKAIKGLVVMSLELELMSTSLYNNAVPELWKSKAYPSLKPLASWIMDLLQRLNFLHSWIKNGIPSVFWISGFFFPQAFLTGTLQNFARKFVISIDTITFDFKVLSYASSEIAERPSTGCYIYGLFLEGARWDPFDFQLAESRPKELYTEMAVIWLLPVANRKVQNQDFYLCPIYKTLTRAGTLSTTGHSTNYVIAVEIPSNQPQRHWIKRGVA 4509          

HSP 2 Score: 133.265 bits (334), Expect = 5.091e-29
Identity = 90/209 (43.06%), Postives = 125/209 (59.81%), Query Frame = 2
Query:  119 KYPEVKQRGYYSEILSDGAIEQLENVTHGPPEVQNLLSQTIHYENTPK--------VGTFEIPDQLNSNIDVH--GESTKIDIIIDFPEKSFEPKLQLMYFVAPGMIPRRVRLEREKRAYXXXXXXXXXXXXGNITSDYLIPKYHP----PNG--KKFDGSWAPYLFLETFDNEEYEIRNPDEWLAMGLEDGV--RKPVPGRALLPVTD 691
            KYP +KQRG+YS+ILS G ++QL +V  GP   QNL+ Q    + TPK          +F IP+     ++    G +T++    DFP +S+EPK+Q+ + V PG  PR++ +ER K+ Y  L +E LLA+EG I S+ L+P+ HP    P    +  D  +  YL L+ FDNEE++ R P EWL MGLE     RKPVPG+ALLP  D
Sbjct:  161 KYPIMKQRGFYSDILSPGTLDQLGDVCCGPYLSQNLIRQADLDKFTPKGQCHEHWAAESFVIPEDFQERVEQQSIGTTTRLLTQTDFPLQSYEPKVQVPFQVLPGRCPRKIEIERRKQQYLRLDIEQLLANEG-IDSNKLMPR-HPDLQQPQTIEQGRDPLFPIYLPLKVFDNEEFDCRTPTEWLNMGLEPDAQYRKPVPGKALLPTDD 367          
BLAST of Dynein heavy chain axonemal vs. UniProt
Match: sp|Q8WXX0|DYH7_HUMAN (Dynein heavy chain 7, axonemal OS=Homo sapiens OX=9606 GN=DNAH7 PE=1 SV=2)

HSP 1 Score: 3103.92 bits (8046), Expect = 0.000e+0
Identity = 1692/3774 (44.83%), Postives = 2372/3774 (62.85%), Query Frame = 2
Query: 1610 TKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPL-LESVGMEEPQVKKLRENLRET-LKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWI--LTIPDMLDEQQEVIDK--CLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEK---IVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKGL--YVKLL-EQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAI-YPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKM---------------------STQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYI-IKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPE-YISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWI---MRAVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKN----LLVGKLNSDFNQKYE----------DVVKIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTN--------LFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKI-QGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEP-YIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPE---WISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKF-SKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSY--TSFSD-DFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQ-VMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            + +KL+ F       M   ++ LTL S+ +F ++I                P D    S+   ++P F++ L+LDN    +   L  +  + +N++D  I+A+  VP++E  +         P  L+ + + E  V   +E ++E  +K+++ P E   L Y+K+  L    IT      + N+ A++H+  +I  E+ K+    E ++    + I +G F ++ E + + L K+   +   +L  + R+ ++   + C+ F+ I  K    P    EL E++ +I  + + DM++ +Q ++D   CL    LIE  Y N S  D     ++  W  ++     +  + + E  E++++        F E+L++         S+ D+        + + ++ +L  A      FN  E  F    + Y +  K+     P+  L+    ++   + +    P   V+ + VE  +  +++ ++K  K F++ P    +  +++  +E+FK  IPLIQ + NPG+R RHWE +S  +G  + P    T S  L+M L+ +I+    I+E A KEY++E+A+ KM  EW+A++F + SY+ TGT+IL   DEI  LLDDHI+ TQ+M  SP+ KP+E+++ +WE  L   Q+++DEWL+ Q  WLYLEPIFSS DI  Q+P EG+R+  +D+ WR IM++   +  V+T+    R+L  LK+ N+LLE + KGL+EYLE KR  FPRF+FLS+DELLEILS+TKDPT VQPHL+KCFE IAK++F + L+IT M S EGE    I    +    G VE+W++E+E +M  S+  + G     Y +  R  WV  WPGQ V+   Q +WT+EV  A+    +K L  Y+K    Q+D +  +VRG ++   R+TL AL+V++VHARDV+++++ +NI + +DFEW+SQLRYYW E +L+ + +NA   YGYEYLGN+ RLVITPLTDRCY TL GALHL  GGAP GPAGTGKTETTKDL KA A QCVVFNCSD LD++A+GKFFKGL S GAWACFDEFNRID+EVLSVVAQQI TIQ+      D  MFEG EL L P+CAVFITMNPGYAGR+ELPDNLKALFR VAMMVPDYA+IAEI L+S GF  AR LS KIV T++L SEQLSSQ HYD+GMRAVKSV++AAGNLK +    +EE++ LR+I DVN+PKFL  DL LF GI SDLFP +K    DY DLL +I+       L+    F +K +Q++E  +VRHG M+VG    GKT  Y VL  AL+ + ++   + +  Q     VLNPKS+TMGQLYG+FD ++HEW+DG+L+   R   ++  PD++W IFDGPVDAVWIENMNTVLDDNKKLCL SGEII++  +M ++FE  DL VASPATVSRCGM+Y+EP +LG  P +  W+  LP ++    +E +  LFD  +  +V+F+R + +E+ PT++  L  +++ L+D F+      D + E K  K++ +R+                                     +E  FLFSLIWS GASC  D R KF+  LR  M                     S++ + +PFPE+G +YDY+F   G                     KW  W+  + E   I  D+ +++IIVPT+D +R  ++ E L   +KP + VGPTGTGK++ I++ L   +  E Y    I FSA+TTA QTQ+++ SKLDKRRKGVFGPP+GK ++ F+DD+NMPA EV+G+QPPIEL+RQW D   WYD K     + LVDI  + +MGPPGGGRNP+T R MRHFN++  NE  + SM T+F  IL + +    +   E   L   +V   + +Y      +LPTPAKSHY FNLRD S+V QG+ +  PE+  + + + RLW HE  RV+ DRL+++ DR W  N    +L   +  DF++ ++          +   +  L++ DF     E+  Y E  + D +  ++E +LE++N I+   MNLVLF  A+ H+ RI+RI++QP  +ALL+G+GGSGRQS+T+LAAHMA+Y  FQ+E+SK Y   EW +DLK I+          VFLF+DTQIK+ESFLED++N+LN+G++PNL++ D+ + I   M+     L  Q  KT         LF+ +    R  LH V+ MSPIG+ FR RLR+FPALVNCCTIDWF  WP++AL++VA +FL    E+E+SEE+  G + MCK  H S  + S+ +  EL RYNYVTPTSYLEL+  F  +  +K+ E+ + + R + GL+KL      V  +Q ELE + PQL+ A +E       IE++S    +T+ +V  +E +A ++A   + I+D+   DL  ALP L+ +L +L  L   DIT V++M  PP GV+LV+E +CI+K +K  KI      G KI+D+W   K LL D  +FL SL  YDKDNI  + +  I   YI +  F P  I   S A   +C+WV AM  Y  VAK VAPK+  L  +  EL+     L++ +A LK V+D++  LQ+ LE   +++ +LEN+ DLC  +L RA++LIGGL  EK RW  + + L  L  N+ G++LIS+G VAYLG FT  YR +   EW+   K   +P +D    +L+ T G+ V IR W I GLP D+ SI+N +I+  +RRWPL IDPQ QAN+WIKN++K N L VIKLS+ D++R+LEN I+FG P L+ENVGEELDP LEP+LLKQTFKQ G+  I+LGD+ I Y  DFRFYITTKL NPHY PE S KVT++NF ++P G++DQLLG+VVA+ERPDLE+ K  LI+  A+ +++LKEIEDKIL  LS +EG+ ++D   I+ L +SK  +NEI  K  +AE+TE+ ID TR  Y P+A+ + ILFF +ADLA I+PMYQYSL WF+N+F   I N+ K++ L +R+  + ++FT+SLY NVCRSLFEK KLLFSF L   +L HE  I+ AEWRFLL GG      L NP      W+  + W+EI  L  LPAF     EF+ +  + +K+++DSLEPH E  P EW D  + FQ +L++RCLR DKV   +Q+F+ + LG  FIEP   DL   + DS+   PLIFVLSPG DP + L KFADD  +   KLS++SLGQGQGP A ++++ A++ G WV  QNCHLA SWMP+LE++ E++  +  H DFR+WLTS PSP FPV +LQNG KMT E P+G++AN+++SY     SD +F  S  K  E++ LL  LC FH ++ ER+KFGPLG+NIPYEF + DLRI + QL MFL +Y ++P++ L+Y  G  NYGGRVTDDWDRR + ++L+ F+NP+ V   DY +  SGIY  + P  DH  Y+ Y ++LP+   PEIFG++ NA+IT   +ET  L D++L  Q + + AG KS +E+V EV+ +IL  +P  F+IE   +RYP  Y QSMNTVL+QE+ R+N+LL  I+ S  ++ KAI+GL VMS  LE + +S+ + K+P+ W  K+YPSLKPL S+V D   R+ F+Q W + G PPVFW+SGFFF QAFLTG  QN+ARK  I ID + F ++VM     E    P DG +I GLFL+GA W+    +L ES PK L+  +PV+WL PC    IP    Y  P+YKT  R G LSTTGHSTNFV ++ +P+D+ ++HWI RGVA
Sbjct:  353 SSAKLESFFNCAAALMTLQLQDLTLVSMQDFTDLIAQ--------------PPD----SVRAFEHPGFIMRLILDNDTIKFEPELSDYIDIFLNVYDVMIKAVSFVPRVETKLYSKWESKSKPTTLKPIILNE-IVDAHKEKIKEVIMKESVAPTEHLRL-YDKYDFL----ITRKAERDVDNFLAENHSYEKIIDEICKYQKLIEEIQYTSIKTIRLGMFEMHCEELIRALVKRADIICGKLLAKMFRDHQEVNTRLCDEFERIAEKALSTPPNTAELMEMKAYIQKVEVTDMIELEQRLVDSKNCLA--FLIE--YVNFSPADMRLNNSVFQWYGRMGEIFEEHRKIIKEKIEQYQEGLKLRCERFVEELESYAKQSEEFYSFGDLQDVQRYLKKAQILNGKLDLAADKIEQFNAEEEAFGWLPSVYPQRKKIQDGLNPYLRLYETAVEFSSNYRAWTEGPYHKVNPDQVEADIGNYWRGLYKLEKTFHDSPYALAMTKKVRSKVEDFKQHIPLIQVICNPGLRPRHWEAMSAIVGYPLQPSDDSTVSSFLDMNLEPYIDRFEGISEAASKEYSLEKAMEKMITEWDAVEFVIHSYRETGTFILASVDEIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFTAVDKTWRDIMRSVMQDKHVLTVVTIDRMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELIEIISTAKARGQVEKWLVELERVMINSIHKVTGDATFAYTKYERINWVRDWPGQTVLCVSQIFWTKEVQTAIPM-GIKALEQYLKTCNRQIDDIVTLVRGKLSMQNRVTLGALVVLDVHARDVLSSLVKKNISDDSDFEWLSQLRYYWQENHLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGADILMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNDLLAAIKDNCASMNLQMTAFFSEKILQVYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQIT---VLNPKSVTMGQLYGQFDSVSHEWSDGVLAVSFRAFASSVTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMLSWVNLLPASVSVIQKEFIMGLFDRMVPVSVEFIRKHTKELSPTSDTNLVRSLMNLIDCFM-----DDFADEVKL-KERNDRETYS---------------------------------LLEGIFLFSLIWSVGASCTDDDRLKFNKILRELMESPISDRTRNTFKLQSGTEQTSSKALTVPFPEKGTIYDYQFVTEGI-------------------GKWEPWIKKLKEAPPIPKDVMFNEIIVPTLDTIRYSALMELLTTHQKPSIFVGPTGTGKSVYITNFLLNQLNKEIYKPLLINFSAQTTAAQTQNIVMSKLDKRRKGVFGPPLGKRMVVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSMIK-LVDIQIMCAMGPPGGGRNPVTPRYMRHFNIITINEFSDKSMYTIFSRILTWHLEICYKFPDEFLDLTTQIVNGTMTLYKEAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETTETTEVIKRLWVHEVLRVYYDRLLDNTDRSWLINYIQEILRNYMYEDFHELFQRLDFDNDGMVEADDLRSLMFCDFHDPKREDTNYREIADVDNLRMIVEIHLEEYNNISKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSVFQVEISKGYDTTEWHEDLKVILRKCAEGEMQGVFLFTDTQIKEESFLEDVSNLLNAGEIPNLFALDEKQEICDKMR----QLDRQRDKTKQTDGSPIALFNMFIDHCRSQLHVVLAMSPIGDAFRNRLRKFPALVNCCTIDWFQSWPEDALQAVASRFLE---EIEMSEEIRDGCIDMCKSFHTSTIDLSKSFFVELQRYNYVTPTSYLELISTFKLLLEKKRSEVMKMKKRYEVGLEKLDSASSQVATMQMELEALHPQLKVASKEVDEMMIMIEKESVEVAKTEKIVKADETIANEQAMASKAIKDECDADLAGALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGD-MRFLQSLHEYDKDNIPPAYMNIIRKNYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGELKIAMDGLRKKQAALKEVQDKLARLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSHTALELGQLYINLTGDILISSGVVAYLGAFTSTYRQNQTKEWTTLCKGRDIPCSDD--CSLMGTLGEAVTIRTWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQSQANKWIKNMEKANSLYVIKLSEPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVAQERPDLEEEKQALILQGAENKRQLKEIEDKILEVLSSSEGNILEDETAIKILSSSKALANEISQKQEVAEETEKKIDTTRMGYRPIAIHSSILFFSLADLANIEPMYQYSLTWFINLFILSIENSEKSEILAKRLQILKDHFTYSLYVNVCRSLFEKDKLLFSFCLTINLLLHERAINKAEWRFLLTGGI----GLDNPYANLCTWLPQKSWDEICRLDDLPAFKTIRREFM-RLKDGWKKVYDSLEPHHEVFPEEWEDKANEFQRMLIIRCLRPDKVIPMLQEFIINRLGRAFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMAALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKEGTWVVLQNCHLATSWMPTLEKVCEELSPESTHPDFRMWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLNQYEELPYEALRYMTGECNYGGRVTDDWDRRTLRSILNKFFNPELVENSDYKFDSSGIYF-VPPSGDHKSYIEYTKTLPLTPAPEIFGMNANADITKDQSETQLLFDNILLTQSRSAGAGAKSSDEVVNEVASDILGKLPNNFDIEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLKTIRDSCVNIQKAIKGLAVMSTDLEEVVSSILNVKIPEMWMGKSYPSLKPLGSYVNDFLARLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNYARKYTIPIDLLGFDYEVMEDK--EYKHPPEDGVFIHGLFLDGASWNRKIKKLAESHPKILYDTVPVMWLKPCKRADIPKRPSYVAPLYKTSERRGVLSTTGHSTNFVIAMTLPSDQPKEHWIGRGVA 4017          
BLAST of Dynein heavy chain axonemal vs. UniProt
Match: sp|Q63170|DYH7_RAT (Dynein heavy chain 7, axonemal OS=Rattus norvegicus OX=10116 GN=Dnah7 PE=2 SV=2)

HSP 1 Score: 3100.07 bits (8036), Expect = 0.000e+0
Identity = 1729/3991 (43.32%), Postives = 2442/3991 (61.19%), Query Frame = 2
Query:  995 LLRYHLYLD-CMPMDGLGELDQSSLKRMIRLSKDETPILKKQKGLEDAVQSLEKEVMVDYWRSMNTIILHKLVGENPQKFNYITLPKPELPKVPMKGTIPMPKYDWDTKFEEFAFYSLLTKPEVVQAMCKSQYECLEARNKQLFHVPLAKHMRLEEFEQTQS-QATQQVSLFLKDTWIDNLQKFIRTSLRDSKKGWFNIYETDFYVYTK----------SKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPL-LESVGMEEPQVKKLRENLRET-LKKALIPMESYALEYNKFLNLQNQDITEYVNEFL---RNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTI--PDMLDEQQEVIDK--CLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDE-ERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFE---KSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALET--RDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAI-YPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKM---------------------STQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIV-FSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVA----ELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVK--------------IEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTN--------LFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKI-QGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKI-EPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKF-SKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSY--TSFSD-DFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQ-VMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            +LRY+ Y+   +  D +  ++ S L+ +++L      + +  K L +++  L  E+  DY  S+   I+  ++ +  +K +   +   ELP  P +  + +    W   F     Y      + + AM  +    L+     L+H    K +RL + E+  + Q   ++S F ++  I +++    T L    K WF   +  +Y   K          +KL+ F       M   ++ L L S+ +F ++I                       S+   ++P F++ LVLD     +      +  + VN+++  I+A+  VP++E  +         P  L+ + ++E  +   +E +RE  L++++ P E   + Y+K+  L  +   + + EFL   +NYE        +  E+ K+    E ++    + + +G F ++ E + + L K+   +   ++  + R+ ++     CE F+ I  K    P    EL E++  I  +   DMLD  Q ++D   CL    LIE    N S  D     ++  W  ++   I    + +++D+ E++++        F E+L++         ++ D+        + + ++ +L  A      FN  E  F    + Y +  K+     P+  L+    ++   H +    P   V+ + VE  V  +++ ++K  K F++ P+   +  +++  +E+FK +IPL+Q + NPG+R RHWE +S  +G  + P    T    ++M L+  ++    I+E A KEY++E++++KM  EWEA++F +  Y+ +GT+IL   D+I  LLDDHI+ TQ+M  SP+ KP+E+++ +WE  L   Q+++DEWL+ Q  WLYLEPIFSS DI  Q+P EG+R+  +D+ WR +MK    N  V+ +    R+L  +K+ N+LLE + KGL+EYLE KR  FPRF+FLS+DELLEILS+TKDPT VQPHL+KCFE IA+++F + L+IT M S EGE +       +T   G VE+W++E+E +M +S+  +IG  +  Y +  R  WV  WPGQ V+   QT+WT EV  A+    + L+    K   Q+D +  +VRG ++K  R+TL AL+V++VHARDV+ N++ + I +  DFEW+SQLRYYW E NL+ + +NA   YGYEYLGN+ R+V+ P  D C+LTL GALHL  GGAP GPAGTGKTETTKDL KA A QCVVFNCSD LD++A+GKFFKGL S GAWACFDEFNRID+EVLSVVAQQI TIQ       +  +FEG EL L P+CAVFITMNPGYAGR+ELPDNLKALFR VAMMVPDYA+IAEI L+S GF  AR LS KIV T++L SEQLSSQ HYD+GMRAVKSV++AAGNLK +    +EE++ LR+I DVN+PKFL  DL LF GI SDLFP +K    DY DLL +I+       L+    F +K +Q++E  +VRHG M+VG    GKT  Y VL  AL  + ++   + +  Q     VLNPKS+TMGQLYG+FDL++HEW+DGIL+   R    ++ PD++W IFDGPVDAVWIENMNTVLDDNKKLCL SGEII++  +M ++FE  DL VASPATVSRCGM+Y+EP +LG  P +  WI +LP ++    +E ++ LFD  +  +V+F+R + +E+ PT++  L  +++ L+D F+  F   +         K+ ER  ++N   L                              E  FLFSLIWS GASC  D R K++  LR  M                     S++ + +PFPE+G +YDY+F   G                  R  +W+  +A+ P   I  D+++++IIVPT+D VR  ++   L   +KP + VGPTGTGK++ I + L   +  +     IV FSA+TTA QTQ++I SKLDKRRKGVFGPP+GK +I F+DD+NMPA EV+G+QPPIEL+RQW D   WYD K     + LVDI  + +MGPPGGGRNPIT R MRHFN++  NE  + SM T+F  IL  W +R       +   L   +V   + +Y      +LPTPAKSHY FNLRD S+V QG+ +  PE+  + + + RLW HE  RV+ DRL+++ DR W  N +   L +   + + D+ K              +  L++ DF     E+  Y E    D +  ++E +L+++N ++   MNLVLF  A+ H+ RI+RI++QP  +ALL+G+GGSGRQS+T+LAAHMA+Y  FQ+E+SK YG  EW +DLK I+      +   VFLF+DTQIK ESFLED+NN+LN+G+VPNL++ D+ + I   M+     L  Q  KT         LF+ +  R R  LH V+ MSPIG+ FR RLR+FPALVNCCTIDWF  WP++ALE+VA +FL DI   E+SEE+  G + MCK  H S  N S  +  EL RYNYVTPTSYLEL+  F  +  +K+ E+ + + R + GLDKL      V  +Q ELE + PQL+ A  +       IE++S    +T+ +V  +E VA  +A   + I+D+   DL EALP L+ +L +L  L   DIT V++M  PP GV+LV+E +CI+K +K  KI      G KI+D+W   K LL D  +FL SL  YDKDNI  + +  I + YI +  F P  I   S A   +C+WV AM  Y  VAK VAPK+  L  +  EL    + L++ +A L+ V+D++  LQ+ LE   +++ +LEN+ DLC  +L RA++LIGGL  EK RW +S + L  L  N+ G++LIS+G VAYLG FT  YR     EWS + K   +P +D    +L+ T G+ V IR W I GLP D  SI+N +I+  +RRWPL IDPQGQAN+WIKN++K N L +IKLSD D++R+LEN I+FG P L+ENVGEELDP LEP+LLKQTFKQ G+  I+LGD+ I Y  DFRFYITTKL NPHY PE S KVT++NF ++P G++DQLLG+VVA ERPDLE+ K  LI+  A+ +++LKEIEDKIL  LS +EG+ ++D   I+ L +SK  +NEI  K  +AE+TE+ ID TR  Y P+AV + ILFF +ADLA I+PMYQYSL WF+N+F   I N+ K+D L++R+  + ++FT+SLY N+CRSLFEK K+LFSF L   +L HE  I+ AEWRFLL GG        NP   W+  + W+EI  L  L AF     EF+ +    +K+++DS+EPH E  P EW +  + FQ +L++RCLR DKV   +Q+F+   LG  FIEP   DL   + DS+   PLIFVLSPG DP + L KFADD  +   KLS++SLGQGQGP A ++++ A++ G WV  QNCHLA SWMP+LE++ E++  +  H DFR+WLTS PSP FPV +LQNG KMT E P+G++AN+++SY     SD +F  S  K  E++ LL  LC FH ++ ER+KFGPLG+NIPYEF + DLRI + QL MFL +Y ++P+  L+Y  G  NYGGRVTDDWDRR + ++L+ F+  + V    Y +  SGIY  + P  DH  Y+ Y ++LP+   PEIFG++ NA+IT   +ET  L D++L  Q + S +G KS +E+V EV+ +IL  +P  F+IE   +RYP  Y QSMNTVL+QE+ R+N+LL  I+ S  ++ KAI+GLVVMS  LE + +S+ + K+P  W  K+YPSLKPL S+V D   R+ F+Q W + G PPVFW+SGFFF QAFLTG  QN+ARK  I ID + F ++VM     E    P DG YI GLFL+GA W+    +L ES PK L+  +PV+WL PC    IP    Y  P+YKT  R GTLSTTGHSTNFV ++ +P+D+ ++HWI RGVA
Sbjct:  194 ILRYYYYIHHGIDTDNVAPMEDSWLEHVLQL------VPQHLKVLTNSITVLSDEMREDYLLSVKKSIVDFVLKDPREKEDDTKIT--ELP--PHRAEMEVLPKPWRRSFLSACSYIR----DHLNAMNPTMLAVLD-----LWHSTF-KKLRLVDIEEFHNRQDALELSGF-QNIVIKHMESAKETLL----KTWFPEVQNIYYQGNKKKQLPTGDSSAKLESFFNCAATLMTLQLQDLILVSMQDFTDLIAQP------------------PESIRAFEHPGFIMRLVLDKKAVKFEPEFTDYIDILVNVYEIMIKAVSFVPRVETKLYSKWESKSKPTTLKPIILDE-IIDAHKEKIREVVLRESVAPTEHLKM-YDKYQFLITRQAEQDIEEFLTQSQNYE-------RLIEEIRKYQKLGEEIQYTSRKTVRLGMFEMHCEELIRSLVKRADIICGKLIAKMFRDHQEVNTMLCEEFEKIAEKALSTPPNTAELMEMKAHIQKVETTDMLDLGQRLVDSKNCLA--FLIE--CVNFSPADIRLNNSVFQWYGRMG-EIFDEHRKIIKDKTEQYQEGLKLRCERFVEELESYAKQAEEFYTFGDLQDVQRYLKKAQVLNSKLDAAADKIEQFNAEEEAFGWIPSVYPQRKKIQDGLNPYLRLYETAVEFSTKHRAWTEGPYHKVNPDQVEADVGNYWRGLYKLEKAFHDSPNALAMTKKVRARVEDFKQYIPLVQVICNPGLRPRHWEAMSAIVGYPLQPSDDSTVFSFIDMNLEPFLDRFEGISEAASKEYSLEKSMDKMMTEWEAMEFVIHPYRESGTFILSAVDDIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFTAVDKTWRDVMKMVVQNKHVLAVVTIERMLERMKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIARVEFTETLDITHMKSSEGEVVELVDTISTTKARGQVEKWLVELERIMIKSIHKVIGDAITAYTKNARINWVRDWPGQTVLCVSQTFWTVEVQVAIPMGHKALEDYLGKCNHQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDVLANLVKKRISDDTDFEWLSQLRYYWHENNLETKMINAGLRYGYEYLGNSPRMVLAPFCDYCFLTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQIGINSGTELLVFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSIKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNDLLAAIRENCHSMNLQMTNFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALGDICEKGLMEENKVQIT---VLNPKSVTMGQLYGQFDLVSHEWSDGILAVSFRAFAASSTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPQMLGWRPLMVSWINTLPQSVSIIQKEFIEGLFDRMVPLSVEFIRRHTKELSPTSDTNLVRSLMNLIDCFMDDFADEN---------KQKERNDRENFSLL------------------------------EGIFLFSLIWSVGASCTADDRIKYNKILRELMEGPISDLTRNKFKLLSGTEQTSSKALTVPFPEKGTIYDYQFIPEG----------------LGRWDQWIKKLADTPP--IPKDVQFNEIIVPTLDTVRYSALMSLLTTHQKPSIFVGPTGTGKSVYIINFLLNQLNKDIYKPLIVNFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKRMIVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSMIK-LVDIQIMCAMGPPGGGRNPITPRYMRHFNIITINEFSDKSMFTIFSRILT-WHLRTCYKFPDDFLDLTTQIVNGTMTLYKDAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETAENKEAIKRLWVHEVLRVYYDRLLDNADRSWLVNYIQEILRNYMQEDFHDLFKNLDFDNDGIVEEDDLRSLMFCDFHDPKREDFGYREIPNVDALRVIVEGHLDEYNNMSKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQVEISKGYGSHEWHEDLKVILRKCAEGDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNLFALDEKQEICEKMR----QLDRQRDKTKQTDGSPIALFNMFIDRCRNQLHVVLAMSPIGDAFRIRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDI---EMSEEIREGCIDMCKSFHTSTINLSTTFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQVATMQGELEALHPQLKVASRQVDDMMIMIEKESIEVAKTEKIVKADETVANDQAMAAKAIKDECDADLAEALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDI-RFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGELRIAMEGLRKKQAALREVQDKLAKLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSNSALELGHLYVNLTGDILISSGVVAYLGAFTSNYRQHQTKEWSHSCKERDIPCSDD--YSLMGTLGEAVTIRAWNIAGLPSDLFSIDNGIIIMNARRWPLMIDPQGQANKWIKNMEKTNSLQLIKLSDPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALILQGAENKRQLKEIEDKILEVLSSSEGNILEDETAIKILSSSKALANEISQKQEVAEETEKKIDNTRMGYRPIAVHSSILFFSIADLANIEPMYQYSLTWFINLFILSIENSEKSDILSQRLHILRDHFTYSLYVNICRSLFEKDKMLFSFCLTVNLLIHENAINKAEWRFLLTGGIGLDNPYTNPC-TWLPQKSWDEICRLDELHAFKTIRREFM-RLKEGWKKVYDSMEPHHEIFPEEWENKANDFQRMLIIRCLRPDKVIPMLQEFIIKKLGRSFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMNALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKDGTWVVLQNCHLATSWMPTLEKVCEELSPESTHPDFRIWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCRKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLNQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNKFFCTELVENPQYKFDSSGIYF-VPPSGDHKSYIEYTKTLPLIPDPEIFGMNANADITKDQSETQLLFDNILLTQSRSSGSGAKSSDEVVNEVAGDILGKLPNNFDIESAMRRYPTTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAIKGLVVMSTELEEVVSSILNVKIPGMWMGKSYPSLKPLGSYVNDFLARLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNYARKFTIPIDLLGFDYEVMDDK--EYKNAPEDGVYIHGLFLDGASWNRKTKKLAESHPKVLYDTVPVMWLKPCKKSDIPKRPSYVAPLYKTSERRGTLSTTGHSTNFVIAMILPSDQPKEHWIGRGVA 4050          
BLAST of Dynein heavy chain axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|19150540 (tr|A0A4E0R5U1|A0A4E0R5U1_FASHE Dynein heavy chain axonemal OS=Fasciola hepatica OX=6192 GN=D915_005467 PE=4 SV=1)

HSP 1 Score: 6069.58 bits (15745), Expect = 0.000e+0
Identity = 2947/4215 (69.92%), Postives = 3496/4215 (82.94%), Query Frame = 2
Query:  122 YPEVKQRGYYSEILSDGAIEQLENVTHGPPEVQNLLSQTIHYENTPKVGTFEIPDQLNSNIDVHGESTKIDIIIDFPEKSFEPKLQLMYFVAPGMIPRRVRLEREKRAYXXXXXXXXXXXXGNITSDYLIPKYHPPNGKKFDGSWAPYLFLETFDNEEYEIRNPDEWLAMGLEDGVRKPVPGRALLPVTDDKHDVDIRDPSIDWTWQSVGVLDYDTDTKLWFVQKTDKSGRVIDDIGRPVIDGGLLPTGHFLEMSNQYWIPRIQLMFLAENPIKFSNRVIEAYQSRELHEALLRYHLYLDCMPMDGLGELDQSSLKRMIRLSKDETPILKKQKGLEDAVQSLEKEVMVDYWRSMNTIILHKLVGENPQKFNYITLPKPELPKVPMKGTIPMPKYDWDTKFEEFAFYSLLTKPEVVQAMCKSQYECLEARNKQLFHVPLAKHMRLEEFEQTQSQATQQVSLFLKDTWIDNLQKFIRTSLRDSKKGWFNIYETDFYVYTKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIE--ENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIK---EEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAE-----LHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLT-SVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLYGDFMSVAIENK-KYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKF-SKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIA-KNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMS--TAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            YPE++++G+YSE+ +   I   ++    P  V+ + S     ++TP V   E+P  +  +I  HG +T+ +  +DFP +SF+PK+Q+ ++  P   PR++ +ER+KR +  LSL  +L +E +I ++ ++PK    N K   G W  YL LE FD+E ++ R P++WL +GL++GVRKP+P   LLP +DD+H +DIRDPSI W WQ  GVLDYD  +KLW VQK DK+GR++D  G+PV++GGLL  G F+E+++QYWIPRIQLMFLAE+P  F+ RV  AY+ R+ HEA LRY+LYLDCMP +G+GEL  + +K ++ L+KD+T  +K  +GLE+  Q L+KEVM DYWRSMN +IL ++V     +F++I   + +  K+P KGT+ +PKYD+DT F +F   S+LTKPE + A+CK+QYEC E R+K +FHVP++KHMRLEEFEQTQS  T QV+LFLKD W+DNL+K IRT LRDS KGWFNIYETDFYVY++SKLKK MELVK+CMQD+MRYL +DSLTN VNM+ DAC  C+ L   +EW NDLLTSSLPPKKNPIFLVDLVLD  G HYSTPL  F    V+LFDKAI ++Q+VPQLE+F+M+ IS A+NPLLE+VG+ EP V+ LR+NL+E +  A+IPMESYA  Y++F+ L   DI    N +L+ YE Q+ +ALEIKL+VEK L EKE +E  IP  I+IGPFYINTE VRQ L+KK KA+ NA+LDLLAR+LRK ADQ+ + F+ I  +LYE+PN+IEEL E+REWI TIPD L E QE IDK ++DYELI+ F+Y LS DDFNAKWT +GWPHKIR  I QVE++L EDEERFRKLQV++ AAF++K+D LTM VASM S+ +I+KA EVANEVRRI+KQL +AQ+ A  FNNRERLF  P TNY+K+ +L+KDFEPF+NLW++ SDW+K  ++VMNDPL ++D++ VEK V + YKTMHKSV+IF+ELP VQEVA QIK+AIEEFKPFIPLIQGLRNPGMR RHWE LS++LG+SIVPKSTLTF++CLEMRLQDHIE I+K+AEVAGKEY+IE ALNKM  EW+ + FEVL YK+TGT I+KV DE+NQLLDDH+VMTQ+M FSPYKKPFEERI +WE  L T QDV+DEW+ CQRQWLYLEPIFSSEDINRQLPVE KRYATMDR+WRK+MK A D P VI LCPD RLL +L+ECN+LL+QVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKL F+ +LEI AM+S EGE++ F +STYPTGNVEEWMLEIE +MR SLR+IIG+ L  YK+ PRTEWVL WPGQVVIAGCQTYWT EV+ A+ +  L  LY  LL QLDGLR +VRGD+++IGRMTLSALIVIEVHARDVVN MI E++ N+NDFEWISQLRYYW    E LK+ AVNAEF YGYEYLGNT+RLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQI TIQKAQQQRLDRF+FEG EL+LKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDAR L+KKIVTTFKLSSEQLS+QDHYDFGMRAVKSVISAAGNLKRQN  MDEELICLRAI+DVNVPKFL+DDLKLFNGIVSDLFPNI+   E P+DYGDL ++++T+  K GL DV GF+ KCIQL+ETTVVRHGLMLVGPTGSGKTKCY+VLQ+AL+SL+D+ +PDGS FQTVHTYVLNPKSITMGQLYGEFDL+THEWTDGILSTLIR+GV+A   DKRWY+FDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKL E MTMMFEVADLAVASPATVSRCGMVYLEPSILGL PF+ CWIR LPDAI+ HR+++Q LFD+YL E++ F+R   +E++PTT+GQL F++IK++D+F  P+ P +  +  KT      +Q     +NLKAPLRP+  + F   + + ++++ +IG+A+E WF+FSLIWS GA+C  + R KFD YLRRKM      LPFPEEG VYDY FD GG L     E+E+++   KERK+ W HWMAN+P   I P+M+YSDIIVPTID +R   + E LL++KKPV+CVGPTGTGKT++I +KLT+ MP EYI EFI+FSAKT+A QTQDLID KLDKRRK VFGPPMG+++IFFIDDLNMPALEV+G+QPPIELIRQW DF GWYD K +GEFR LVD+NFI +MGPPGGGRNP+T RLMRHFN L +NEL E SM T+F  IL  W+ R   E     L    E LV A I VY  IQSQ+LPTPAKSHYTFN+RDLSKVFQGMLM+EP SL  S++Q+LRLW+HESCRVFQDRLVND DR+WF NL+       F    +D VK +PLLYGDF++ A+ +  KY+E  ++ ++++VIEENL+D+NQ+NTAKMNLVLFM AV HVCRI+RIIRQP GNALLLGMGGSGRQSLT+LAAHMAEY+CFQ+EL+KNYGV EWR+DLK+IM+ AG+E+  + FLFSDTQIK ESFLED+NNILN+GDVPN+YS DDL++IY  MK +V D GLQ TKTNLFS Y+KRVR NLHTVITMSPIGEIFRARLRQFPALV+CCTIDWFS WP EALESVAL+ L  + EL   +  I  +  MC ++HQS  + +E YR ELSR+NYVTPTS+LELLG+FSKIY  KK E+  ARDRTK GLDKLL TEE V KLQEELE+MKP+LE+AVEESK T EEI RDS++A+ETQ VV  EE  A KKA+EC++IRDDAQRDLDEA+PAL ESLE+LK LNKNDITEVRAMMRPPEGVRLVIE VCIMKDVKPKK+ GDKPGVK+DDYW+ GK LLQDPGKFLDSL NYDKDNI + VI K++PYI SESF PAAI KVS+ACTSIC WVRAMYKYH VAK VAPKR AL+ S  EL +T+K+LKE+R++LKA EDRI GLQ K + C RRQ+ELE KS LCEARL RADKLIGGL NEKIRW++SV++L  L++N+VGNVL SAG VAYLG F+G+YR+ M  +W   L+ + VPHT  PA NLV T+GDPVK+RNW I GLPKD LSIENA IV+FSRRWPLFIDPQGQAN+WIK L    G+ VIK+SDKDFLRSLEN+IRFGKPCL+ENVGEELDPALEPILLKQT+K QGA+VIKLG+++IPYHDDFRFYITTKLPNPHY PEVSTKVT+VNFTLSP GLEDQLLG+VVAEERPDLE+AKNQLIVSNAKM+QELKEIED+IL RLS  EGSPVDDIDLIQTLEASKLKS+EI+AKV++AEQTE DIDETRS+YIPVAVRTQILFFCVADLA IDPMYQYSLEWF+NIF NGI NA KAD + +R+ NINNYFTFSLY NVCRSLFEKHKL+F+FL+A RILQ+EGKI++ E+R+LLAGG+ K  DLPNPAPEWISDR+W+E+LTL +L  FS  PE  I +  + FK IFDS EPHRE  P  W    D FQ +L+LRCLR DKVTNAMQDFV H LG+RF+EPQ+  L  V+KDSSPT+PLIFVLS GTDPASDLYKFAD+MKF  KKLSAISLGQGQGPRAEEL++ AMERG WVFFQNCHLAPSWMP LERLVEQIDKD+VHRDFRLWLTSMPSP FPV+ILQNGSKMTVEPP+G+KANLL++Y S +D +LN++  KN+ +RHLLL+L  F+G LIERKKFGPLGFNIPYEFT GDL+IC++QL MFL+EYT +P+KVL YTAGHINYGGR+TDDWDRRC M++L  +Y PQ + +++ YS SGIY Q+   +DH  Y+ YIRSLPIND PEIFGLH+NANITFA NET  LL  LL+LQP+ S  +  G+ RE++VEE+++ +LQ  P+ F++  + ++YPVMYEQSMNTVL QEVIRYN LL  ++ +L+DLLKA++GLVVMS +LE M+ SL+DN+VP  WA+KAYPSLKPLASWV DL QR+ FIQ WID+G+P VFWISGFFFPQAFLTGTLQN+ARK +IS+DTISF F+VM ++  E+TE+P+DG YIRGLFLEGARWD  +  L ESRPKEL+  MPV+WLIP ANR  P   IY+CPVYKTLTRAGTLSTTGHSTNFVF+I++PTD+ QKHWI+RGVA
Sbjct:    8 YPEIRKQGFYSEVYTAKPIRFTQDELPPPCVVEGIESCLKDKDHTPMVDV-ELPPYIADHIAFHGPTTEGNYFMDFPPRSFDPKVQVPFYTPPTECPRKLHIERKKRRFQSLSLTTILENEHHIRTEDILPKMLE-NCKSERGEWGAYLPLEYFDDECFDCRTPEDWLTLGLDEGVRKPIPALCLLPESDDQHHLDIRDPSIVWRWQLSGVLDYDFKSKLWLVQKVDKNGRILDPSGKPVVNGGLLKNGVFVELTSQYWIPRIQLMFLAEDPDIFAQRVASAYKDRQRHEAGLRYNLYLDCMPNEGIGELSSTVIKHILFLAKDDTCTVKNFQGLEETSQKLQKEVMFDYWRSMNDLILREMVQMEKTQFDFIHPVEKKQRKIPWKGTLEIPKYDFDTMFGKFCALSMLTKPEAISALCKAQYECSEVRSKSMFHVPISKHMRLEEFEQTQSMMTVQVALFLKDAWLDNLRKHIRTCLRDSGKGWFNIYETDFYVYSQSKLKKLMELVKFCMQDTMRYLIMDSLTNLVNMVRDACANCLDLTASFEWTNDLLTSSLPPKKNPIFLVDLVLDADGPHYSTPLRNFVNTLVSLFDKAINSVQDVPQLERFVMEGISSAENPLLEAVGIHEPPVELLRQNLQEYVSAAIIPMESYARRYDQFMELTMLDI----NAYLKIYETQNQSALEIKLQVEKQLAEKENVEHSIPSSIVIGPFYINTEPVRQNLSKKCKALVNALLDLLARQLRKQADQSSDEFRQIAARLYEKPNSIEELTEMREWITTIPDKLQEHQEGIDKAMSDYELIDAFFYILSADDFNAKWTTIGWPHKIRQMITQVEKSLEEDEERFRKLQVSESAAFSDKIDTLTMMVASMASFTEISKAQEVANEVRRIYKQLLDAQSTAGTFNNRERLFGMPSTNYDKIPRLMKDFEPFKNLWLSASDWLKTQEAVMNDPLTSIDADHVEKLVVDCYKTMHKSVRIFHELPGVQEVANQIKMAIEEFKPFIPLIQGLRNPGMRKRHWEQLSEQLGVSIVPKSTLTFARCLEMRLQDHIETIAKVAEVAGKEYSIESALNKMVAEWQPINFEVLPYKDTGTCIIKVGDEVNQLLDDHVVMTQAMNFSPYKKPFEERIVQWEAKLHTAQDVLDEWISCQRQWLYLEPIFSSEDINRQLPVESKRYATMDRIWRKVMKQAADQPQVIALCPDPRLLNSLRECNRLLDQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLDFQPNLEIIAMYSSEGERVAFVESTYPTGNVEEWMLEIERLMRYSLRVIIGQSLEAYKKTPRTEWVLNWPGQVVIAGCQTYWTSEVTQAIASGALDQLYPHLLRQLDGLRELVRGDLSRIGRMTLSALIVIEVHARDVVNRMIEEHVCNVNDFEWISQLRYYWQADAEELKLHAVNAEFNYGYEYLGNTTRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRLDRFVFEGDELVLKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARLLAKKIVTTFKLSSEQLSTQDHYDFGMRAVKSVISAAGNLKRQNADMDEELICLRAIRDVNVPKFLVDDLKLFNGIVSDLFPNIRYLMEAPVDYGDLTLALKTSCGKLGLLDVEGFLHKCIQLYETTVVRHGLMLVGPTGSGKTKCYKVLQNALTSLRDKPAPDGSFFQTVHTYVLNPKSITMGQLYGEFDLLTHEWTDGILSTLIRKGVSAENEDKRWYVFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLSEAMTMMFEVADLAVASPATVSRCGMVYLEPSILGLNPFIHCWIRKLPDAIFTHRDKLQSLFDLYLLESIAFIRTETKEVIPTTDGQLCFSLIKMLDAFFLPYQPKEAPMTQKT------KQQADKAKNLKAPLRPMLSEGFE--NNVTEDILVRIGQALECWFIFSLIWSVGATCTNEGRVKFDAYLRRKMKELKSILPFPEEGTVYDYCFDDGGLLKPEEHEDEDDDVAEKERKMSWKHWMANIPTLQIPPEMRYSDIIVPTIDTIRCGCLMEMLLVAKKPVLCVGPTGTGKTMTIMNKLTRNMPAEYIPEFIIFSAKTSAKQTQDLIDGKLDKRRKHVFGPPMGRFLIFFIDDLNMPALEVYGAQPPIELIRQWMDFGGWYDLKNVGEFRRLVDVNFIGAMGPPGGGRNPVTARLMRHFNFLAYNELDEKSMYTIFSLILNSWLSRPGPEEPASLLLVHAEALVNASIRVYTTIQSQLLPTPAKSHYTFNMRDLSKVFQGMLMMEPGSLVGSLEQLLRLWYHESCRVFQDRLVNDTDRDWFSNLMDTTSKESFQLPVDDYVKTKPLLYGDFLTAAVSDVWKYIEMPDHAQIIQVIEENLDDYNQVNTAKMNLVLFMYAVEHVCRISRIIRQPQGNALLLGMGGSGRQSLTRLAAHMAEYECFQVELAKNYGVNEWREDLKKIMMNAGIEDNAVTFLFSDTQIKSESFLEDINNILNAGDVPNIYSLDDLDKIYDAMKTVVADAGLQPTKTNLFSCYAKRVRANLHTVITMSPIGEIFRARLRQFPALVSCCTIDWFSPWPPEALESVALRTLQQMVELNADDATIAAMAKMCIDMHQSAVHNTELYRLELSRHNYVTPTSFLELLGVFSKIYGLKKVEVTTARDRTKTGLDKLLSTEEAVSKLQEELEVMKPELERAVEESKVTMEEIARDSKVAEETQTVVAHEEQQALKKARECQLIRDDAQRDLDEAMPALFESLEALKSLNKNDITEVRAMMRPPEGVRLVIEAVCIMKDVKPKKVAGDKPGVKVDDYWEPGKMLLQDPGKFLDSLLNYDKDNIPEPVISKVKPYIESESFMPAAIAKVSKACTSICLWVRAMYKYHHVAKNVAPKRAALQSSELELAETEKLLKESRSRLKACEDRIAGLQTKYDECIRRQRELEEKSQLCEARLVRADKLIGGLGNEKIRWKESVISLNHLLDNLVGNVLCSAGSVAYLGPFSGKYRSDMVSDWVNKLQQHLVPHTTDPAPNLVQTYGDPVKLRNWHIYGLPKDALSIENACIVQFSRRWPLFIDPQGQANKWIKALGANEGMSVIKMSDKDFLRSLENSIRFGKPCLLENVGEELDPALEPILLKQTYKHQGAMVIKLGESVIPYHDDFRFYITTKLPNPHYKPEVSTKVTLVNFTLSPDGLEDQLLGLVVAEERPDLEEAKNQLIVSNAKMKQELKEIEDRILERLSATEGSPVDDIDLIQTLEASKLKSSEIQAKVVVAEQTEHDIDETRSKYIPVAVRTQILFFCVADLANIDPMYQYSLEWFVNIFLNGIVNADKADNVPQRVVNINNYFTFSLYCNVCRSLFEKHKLMFAFLVAIRILQNEGKINMDEYRYLLAGGTSKPHDLPNPAPEWISDRMWSEVLTLNALSCFSGIPES-IAENRDGFKVIFDSPEPHRETFPDPWQVNLDSFQRILLLRCLRSDKVTNAMQDFVTHHLGQRFVEPQSTSLPQVFKDSSPTSPLIFVLSQGTDPASDLYKFADEMKFGGKKLSAISLGQGQGPRAEELMRAAMERGIWVFFQNCHLAPSWMPVLERLVEQIDKDRVHRDFRLWLTSMPSPVFPVYILQNGSKMTVEPPKGLKANLLRTYLSVNDAYLNNVPDKNSVFRHLLLALAFFNGALIERKKFGPLGFNIPYEFTTGDLKICMDQLVMFLSEYTVIPYKVLCYTAGHINYGGRITDDWDRRCAMSILGEYYQPQSLDDEHPYSPSGIYHQLEGSSDHATYLEYIRSLPINDPPEIFGLHENANITFAQNETFALLGYLLQLQPRSSAGSGSGQQREDVVEEIARSLLQSAPQPFDLAGVVQKYPVMYEQSMNTVLTQEVIRYNNLLMAMQLTLQDLLKALKGLVVMSASLEEMAGSLFDNRVPTMWANKAYPSLKPLASWVDDLLQRVAFIQDWIDHGVPSVFWISGFFFPQAFLTGTLQNYARKMLISVDTISFDFQVMKESVTELTELPADGSYIRGLFLEGARWDFHRHLLGESRPKELYVNMPVVWLIPVANRKSPEQGIYECPVYKTLTRAGTLSTTGHSTNFVFAIDLPTDQPQKHWIQRGVA 4207          
BLAST of Dynein heavy chain axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|22935228 (tr|A0A4S2LQT7|A0A4S2LQT7_OPIFE Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005485 PE=4 SV=1)

HSP 1 Score: 6054.17 bits (15705), Expect = 0.000e+0
Identity = 2932/4223 (69.43%), Postives = 3509/4223 (83.09%), Query Frame = 2
Query:   98 MSDREVDKYPEVKQRGYYSEILSDGAIEQLENVTHGPPEVQNLLSQTIHYENTPKVGTFEIPDQLNSNIDVHGESTKIDIIIDFPEKSFEPKLQLMYFVAPGMIPRRVRLEREKRAYXXXXXXXXXXXXGNITSDYLIPKYHPPNGKKFDGSWAPYLFLETFDNEEYEIRNPDEWLAMGLEDGVRKPVPGRALLPVTDDKHDVDIRDPSIDWTWQSVGVLDYDTDTKLWFVQKTDKSGRVIDDIGRPVIDGGLLPTGHFLEMSNQYWIPRIQLMFLAENPIKFSNRVIEAYQSRELHEALLRYHLYLDCMPMDGLGELDQSSLKRMIRLSKDETPILKKQKGLEDAVQSLEKEVMVDYWRSMNTIILHKLVGENPQKFNYITLPKPELPKVPMKGTIPMPKYDWDTKFEEFAFYSLLTKPEVVQAMCKSQYECLEARNKQLFHVPLAKHMRLEEFEQTQSQATQQVSLFLKDTWIDNLQKFIRTSLRDSKKGWFNIYETDFYVYTKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWI--EENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIK---EEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMR-----AVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLT-SVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLYGDFMSVAIENK-KYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKF-SKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIA-KNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAG--GKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            MS+ E   YPE K  GYYSE  +        ++   P   Q++ S     E TP V    +P  +   + VHG +++++ +IDFP  SF+PK+Q+ ++  P   PR++++ER KR Y  LSL+ +L +E +I ++ LI ++     K  +G W  YL LE FD+E Y+ R P++WL MG+EDGVRKPVP   LLP  DD+H +D+RDP I W WQ  GVLDYD  +KLW VQK D++GR++D+ G P+++GGLL  G F E ++QYW+PR+Q+MF+AE+P  F+ R+  AY+ R+ HEA LRYHLYLDCMP +G+ EL    LKR++ L+K++T  +K  +GLE+A Q+LEKEVM D+WR MN +IL + V +N  ++++I   + +  +VP KGT+ +P YD+D  F++FA  S+LTKPE + A+ K+Q+ECLEAR++ +FHVP+AKH RLEEFEQTQS  T QV++FLKDTW+DNL+K+IR+ LRDS KGWFNIYETDFYVYT+SKLKK MELVKYCMQD++RYL +DSLT+  NMI D C +C+ L + YEW NDLLTSSLPPKKNPIFLVDLVLD  G HYSTPL  F  V + LF++AI ++Q+VPQLE+F+M+ IS A+NPLLE+VG+ EP V++LR+ LR+ L  +L+PME+YA +Y KF+ L   DI  Y+NEFLR YE+Q+ +ALEIKL+VE  L EKE++E  IP  IIIGPFY+NTE VRQ L KK KA+ +A+LDLLAR+LRK ADQA E F+ I  +LYE+ NTIEEL E+REWI TIPD L+E+QE IDK ++DYELI+ F+Y LS DDFNAKWT +GWPHKIR  IIQVE+NL +DEERFRKLQ+++ +AF++KLD LTM V+SM SY +I+KA EVANEVRRI+KQL +AQ  A  +NNRERLF  P TNYEK+ +L+KDFEPF+NLW++ ++W+K  ++VMNDPL ++D+E VEK V E YKTMH+S +IF+ELP VQEVA QIK AIEEFKPFIPLIQGLRNPGMR RHWE LS+ LG+SIVPKSTLTF+KCLEMRLQDHIE I+K+AE+AGKEY+IE ALNKM GEW+++ FE+L YK+TGT I+K+ DE+NQLLDDH+VMTQSM FSPYKKPFEERI +WE+ L  TQDV+DEW+ CQRQWLYLEPIFSSEDINRQLPVE KRY TMDR+WRK+MK A D P VITLCPDARLL +L+ECN+LL+QVQKGLSEYLETKRQ+FPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKL FE DLEITAM+S EGE + FEK+TYPTGNVEEWMLEIE+MMR S+R IIG+ L  Y + PRTEWVL+WPGQVVIAGCQTYWT EV+ AL    L+ LY  LL QLDGLR +VRGD+TKIG MTLSALIVIEVHARDVV+ M+ E ++N+NDFEWISQLRYYW+  EE LK+RAVNAEF YGYEYLGNT+RLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQI TIQKAQQQR+ RF+FEG EL+LKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFS+AR L+KKIVTTFKLSSEQLS+QDHYDFGMRAVKSVISAAGNLKRQN  MDEELICLRAI+DVNVPKFL DDLKLF GIVSDLFPNI+   E+P+DYGDL I+++T+  K GL DV GF+ KCIQL+ETTVVRHGLML+GPTGSGKTKCYEVL+ AL+SL+++ SPDGS FQ VHTYVLNPKSITMGQLYGEFDL+THEWTDGILSTLIRQGV AN  +KRWY+FDGPVDAVWIE+MNTVLDDNKKLCLSSGEIIKL + MTMMFEVADLAVASPATVSRCGMVYLEP+ILGL PFV+CWIR LPDAI+ HR+++Q  FD+Y+ +T++F+R   +E++PTT+GQL F+++K+++ F  PF+P + ++ +K  + +AE+      +NLKAPLRP+     +KA+Q+ ++V+ +IG+A+ESWF+FSLIWSFGA+C  + R KFD YLRRKM       PFPEEG VYDYRFD  G L L+  + ++++  I E+K+KWVHWMAN+ E  I  D+++SDII+PTID VR   + E LL++KKPV+CVGPTGTGKT++I +KLT+ MP EYI EFI+FSAKT+A QTQ+LID KLDKRRK V+GPPMG+++IFFIDDLNMPALEVFG+QPPIELIRQW DF GWYD K IGEFR LVD+NFI +MGPPGGGRNP+T RLMRHFN L +NEL   SM+T+FGTILK W+ R       A L P  + L++A I +Y  IQSQ+LPTPAKSHYTFNLRDLSKVFQGMLM+EP SL  S++Q+LRLWFHES RVFQDRLVND DR WF+NL+  K  + F     + V  EPLLYGDF++ A  +  KY+E  ++ ++L+VIEENL+D+NQINTAKM+L+LFM AV H+CRIARIIRQP GNALLLGMGGSGRQSLT+LA+HMAEY+CFQIELSKNYG ++WR+DLK+IM+ AG+E+K + FLFSDTQIK ESFLED+NN+LN+GDVPN+Y+ DDL++IY  MK I  D GLQ TKTNLF+ Y+KRVR NLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFS WP EALESVALK L  +PEL+V +  +  ++ +C + HQSV   ++  + EL+R+NYVTPTS+LELLG+FSKIY  KK ELK AR+RTK GLDKLL+TEE+V KLQEELE+MKP+LE+AVEESK T EEI RDS++A+ETQ VV  EE  A KKAKEC+ IRDDAQRDLDEA+PAL ESLE+LK LNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKK+ GDKPGVK+DDYW+ GK LLQDPGKFLDSL NYDKDNI D++I KI+PYI SESF PAAI KVS+ACTSIC WVRAMYKYH VAK VAPKR AL+ S  EL +T+KILKEAR++LKA E+RI  LQ K + C RRQ+ELE+KS LCEARL RADKLIGGL +EK+RWQDSVV  + L++N+VGNVL +AG VAY G F G+YR  M +EW   L+ +GVPHT  P+  LV TFGDPVK+RNW I GLPKDTLSIENAVIV+FSRRWPLFIDPQGQAN+WIK L    G+ V+K+SDKDFLR+LEN IRFGKPCL+ENVGEELDPALEPILLKQTFK QGA VIKLGDAIIPYHDDFRFYITTKLPNPHY PEVSTKVT+VNFTLSP GLEDQLLGMVVAEERPDLE+AK+QLIVSNAKM++ELKEIED+IL RLS  EGSPVDDIDLIQTLEASKLKS+EI+AKV+ AEQTE DIDETRS+YIPVAVRTQILFFCVADLA IDPMYQYSLEWF+NIF +GI NA +AD + +R+ NINN+FTFSLYSNVCRSLFEKHKL+F+FL+A RILQ+EG I+  E+R+LLAGG+ K +++PNPAPEWISDR+W ++LTL +LP F+  PE  I    + FK IFDS EPHR + P  W D  D FQ +L+LRCLR DKVTNAMQDFV H LG+RF+EPQT +L  V+K+SSP  PLIF+LS GTDPASDLYKFAD+M+F  KKLSAISLGQGQGPRAEEL++ AM+RG WVFFQNCHLAPSWMP LERLVEQIDKD+VHRDFRLWLTSMPSP FPV+ILQNGSKMTVEPP+G+KA+L+++YT  +D++L  +  KN+ +R LL SL  F+GVL+ERKKFGPLGFNIPYEFT GDL+IC++QL MFL EY +VP+KVL YTAGHINYGGR+TDDWDRRC M++L  +YN +V+ +DY YS SGIY Q+   +DH  Y+ YI+SLPIND PEIFGLHDNANITFA NET  LL  LL+LQP+ ST    G+  E++VEE+S+ +L   P+ F++E++ +RYPVMYEQSMNTVL QEVIRYN LL++I  +L DL+KA++GLVVMS  LE M+ SL++N+VP  WA+KAYPSLKPLA+WV DL  R+ FIQ WIDNG+PPVFWISGF+FPQAFLTGTLQN+ARKK+IS+DTISF F+VM +A  E+TE+P+DG YIRGLFLEGARWD+   +L ESRPKEL+  MPVIWLIP A+R  P    Y+CPVYKTLTRAGTLSTTGHSTNFVF+I++PTDK  KHW++RGVA
Sbjct:    1 MSEME-GNYPESKPAGYYSERFTGDTYASNSDLCKPPYVEQSVDSLLRREEYTPNVDV-GLPAYIADYVAVHGPTSEVNFLIDFPRHSFDPKVQVPFYTPPTECPRKLQIERRKRRYQSLSLQKILENEYHIRTEDLIARFLD-GTKDANGEWTTYLPLEYFDDETYDCRTPEDWLEMGIEDGVRKPVPALCLLPERDDQHHLDVRDPEIVWKWQLSGVLDYDKKSKLWLVQKVDENGRLLDEYGNPIVNGGLLLNGTFSEPNSQYWVPRLQVMFIAEDPDVFAQRIAAAYRDRKAHEAGLRYHLYLDCMPTEGIAELSNPVLKRIVYLAKNDTCTVKNYRGLEEATQALEKEVMFDFWRGMNDLILREQVEKNKAQYSFIRPVEVKKREVPWKGTLDIPSYDFDAMFDKFASRSMLTKPEAIAALRKAQFECLEARSRLMFHVPMAKHTRLEEFEQTQSMTTNQVAVFLKDTWLDNLRKYIRSCLRDSGKGWFNIYETDFYVYTQSKLKKLMELVKYCMQDTLRYLVMDSLTSLTNMIRDGCVSCLSLPENYEWTNDLLTSSLPPKKNPIFLVDLVLDADGPHYSTPLQNFINVLITLFNRAINSVQDVPQLERFVMEGISCAENPLLEAVGIREPPVEQLRQRLRDYLTASLVPMEAYARKYEKFMELTMLDINTYLNEFLRIYESQNQSALEIKLQVENQLKEKEMVETTIPSSIIIGPFYVNTEPVRQTLIKKCKALTSALLDLLARQLRKQADQASEEFRMIAARLYEKTNTIEELTEMREWIATIPDRLEERQEGIDKAMSDYELIDAFFYILSADDFNAKWTTIGWPHKIRQMIIQVEKNLEDDEERFRKLQISESSAFSDKLDTLTMMVSSMASYTEISKAQEVANEVRRIYKQLLDAQTLAGTYNNRERLFGLPNTNYEKIPRLLKDFEPFKNLWLSAAEWLKTQEAVMNDPLSSIDAEQVEKQVQECYKTMHRSTRIFHELPGVQEVANQIKQAIEEFKPFIPLIQGLRNPGMRKRHWEELSELLGVSIVPKSTLTFAKCLEMRLQDHIETIAKVAEIAGKEYSIESALNKMVGEWQSVVFEILPYKDTGTCIIKIGDEVNQLLDDHVVMTQSMNFSPYKKPFEERIAQWESKLHITQDVLDEWITCQRQWLYLEPIFSSEDINRQLPVESKRYQTMDRIWRKVMKQAADQPQVITLCPDARLLNSLRECNRLLDQVQKGLSEYLETKRQAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLNFEPDLEITAMYSSEGECVQFEKTTYPTGNVEEWMLEIESMMRTSVRTIIGRALEAYTRTPRTEWVLQWPGQVVIAGCQTYWTSEVTSALAGGSLEQLYPNLLRQLDGLRELVRGDLTKIGLMTLSALIVIEVHARDVVSRMMEEGVRNVNDFEWISQLRYYWLREEEELKLRAVNAEFNYGYEYLGNTTRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVTRFIFEGDELVLKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSNARLLAKKIVTTFKLSSEQLSTQDHYDFGMRAVKSVISAAGNLKRQNPEMDEELICLRAIRDVNVPKFLSDDLKLFTGIVSDLFPNIRYLMEQPVDYGDLTIALKTSCGKLGLLDVEGFLHKCIQLYETTVVRHGLMLIGPTGSGKTKCYEVLKDALTSLRNKPSPDGSFFQIVHTYVLNPKSITMGQLYGEFDLLTHEWTDGILSTLIRQGVNANNEEKRWYLFDGPVDAVWIESMNTVLDDNKKLCLSSGEIIKLTDAMTMMFEVADLAVASPATVSRCGMVYLEPTILGLDPFVQCWIRRLPDAIFAHRDKLQTFFDLYMNDTLEFIRRETKEVIPTTDGQLCFSLLKMLECFFTPFLPKE-TVTSKMKRIQAEK-----TKNLKAPLRPIVD---DKANQVTEDVLVRIGQALESWFIFSLIWSFGATCTNEGRIKFDEYLRRKMRELKSITPFPEEGTVYDYRFDDAGLLRLDARDFDDDDVPISEKKMKWVHWMANMSEVNIPSDIRFSDIIIPTIDTVRCGHLIEMLLVAKKPVLCVGPTGTGKTMTIMNKLTRNMPKEYIPEFIIFSAKTSARQTQELIDGKLDKRRKQVYGPPMGRFMIFFIDDLNMPALEVFGAQPPIELIRQWMDFSGWYDLKTIGEFRKLVDVNFIGAMGPPGGGRNPVTPRLMRHFNFLAYNELDVQSMQTIFGTILKSWLNRLGPDKPPALLLPHADALIQATISMYTTIQSQLLPTPAKSHYTFNLRDLSKVFQGMLMMEPTSLIGSLEQLLRLWFHESTRVFQDRLVNDTDRGWFRNLINDKSKAAFELPVSEYVTNEPLLYGDFLTAAASDVWKYIEMTDHAQVLQVIEENLDDYNQINTAKMHLILFMYAVEHICRIARIIRQPQGNALLLGMGGSGRQSLTRLASHMAEYECFQIELSKNYGFSDWREDLKKIMMTAGIEDKSVTFLFSDTQIKSESFLEDINNLLNAGDVPNIYTLDDLDKIYDAMKTIAADQGLQPTKTNLFNCYTKRVRANLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSPWPSEALESVALKTLKQMPELDVDDSTMEAMVKVCIDQHQSVVRNTDLLKNELNRHNYVTPTSFLELLGVFSKIYGLKKDELKTARNRTKIGLDKLLFTEEVVSKLQEELEVMKPELERAVEESKVTMEEIARDSKIAEETQSVVAHEERQAMKKAKECQTIRDDAQRDLDEAMPALFESLEALKSLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKVAGDKPGVKVDDYWEPGKLLLQDPGKFLDSLLNYDKDNIPDAIIAKIKPYIESESFMPAAIAKVSKACTSICLWVRAMYKYHHVAKNVAPKRAALQASELELAETEKILKEARSRLKACEERIASLQIKYDECIRRQRELEDKSQLCEARLVRADKLIGGLGSEKLRWQDSVVKFDQLLDNLVGNVLCAAGSVAYFGPFPGKYRIDMSNEWVTKLREHGVPHTTDPSPTLVQTFGDPVKLRNWHIFGLPKDTLSIENAVIVQFSRRWPLFIDPQGQANKWIKALGSAEGMIVLKMSDKDFLRNLENTIRFGKPCLLENVGEELDPALEPILLKQTFKHQGATVIKLGDAIIPYHDDFRFYITTKLPNPHYKPEVSTKVTLVNFTLSPDGLEDQLLGMVVAEERPDLEEAKSQLIVSNAKMKEELKEIEDRILERLSATEGSPVDDIDLIQTLEASKLKSSEIQAKVVAAEQTEHDIDETRSKYIPVAVRTQILFFCVADLANIDPMYQYSLEWFVNIFLHGIRNADRADNVPQRVQNINNFFTFSLYSNVCRSLFEKHKLMFAFLIAIRILQNEGFINPEEYRYLLAGGTTKPREVPNPAPEWISDRMWGDVLTLTALPKFATLPES-ITAEKDGFKAIFDSPEPHRARFPDPWQDELDSFQRILLLRCLRADKVTNAMQDFVTHHLGQRFVEPQTTNLPEVFKESSPAAPLIFILSQGTDPASDLYKFADEMRFGGKKLSAISLGQGQGPRAEELMRAAMDRGIWVFFQNCHLAPSWMPVLERLVEQIDKDRVHRDFRLWLTSMPSPNFPVYILQNGSKMTVEPPKGMKAHLMRTYTGLNDNYLGQVPDKNSVFRQLLFSLAFFNGVLVERKKFGPLGFNIPYEFTTGDLKICMDQLIMFLMEYMEVPYKVLCYTAGHINYGGRITDDWDRRCAMSILDEYYNSRVLRDDYSYSPSGIYHQLPGTSDHAIYLEYIKSLPINDLPEIFGLHDNANITFAQNETFELLGHLLQLQPRASTGSSTGQQVEDVVEEISRSLLAKTPKPFDLEEVIQRYPVMYEQSMNTVLTQEVIRYNNLLSVIHQTLNDLIKAVKGLVVMSAGLEEMAGSLFNNRVPTIWANKAYPSLKPLAAWVEDLILRVRFIQDWIDNGVPPVFWISGFYFPQAFLTGTLQNYARKKMISVDTISFDFQVMKQAMTELTELPTDGSYIRGLFLEGARWDVQSHKLGESRPKELYVNMPVIWLIPVAHRKPPTKGSYECPVYKTLTRAGTLSTTGHSTNFVFAIDLPTDKLAKHWVQRGVA 4210          
BLAST of Dynein heavy chain axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|21470554 (tr|A0A1S8WJX6|A0A1S8WJX6_9TREM ATPase family protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_09462 PE=4 SV=1)

HSP 1 Score: 6048 bits (15689), Expect = 0.000e+0
Identity = 2920/4161 (70.18%), Postives = 3486/4161 (83.78%), Query Frame = 2
Query:  275 EIPDQLNSNIDVHGESTKIDIIIDFPEKSFEPKLQLMYFVAPGMIPRRVRLEREKRAYXXXXXXXXXXXXGNITSDYLIPKYHPPNGKKFDGSWAPYLFLETFDNEEYEIRNPDEWLAMGLEDGVRKPVPGRALLPVTDDKHDVDIRDPSIDWTWQSVGVLDYDTDTKLWFVQKTDKSGRVIDDIGRPVIDGGLLPTGHFLEMSNQYWIPRIQLMFLAENPIKFSNRVIEAYQSRELHEALLRYHLYLDCMPMDGLGELDQSSLKRMIRLSKDETPILKKQKGLEDAVQSLEKEVMVDYWRSMNTIILHKLVGENPQKFNYITLPKPELPKVPMKGTIPMPKYDWDTKFEEFAFYSLLTKPEVVQAMCKSQYECLEARNKQLFHVPLAKHMRLEEFEQTQSQATQQVSLFLKDTWIDNLQKFIRTSLRDSKKGWFNIYETDFYVYTKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWI--EENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMR-----AVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLT-SVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLYGDFMSVAIENK-KYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKF-SKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIA-KNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAG--GKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            E+P  +  +I VHG +++++ +IDFP  SF+PK+Q+ ++  P   PR++++ER KR Y  LSL+ +L +E +I ++ LI ++     +  +G W  YL LE FD+E Y+ R P++WL MG+EDGVRKPVP   LLP  DD+  +DIRDP I W WQ  GVLDYD  +KLW VQK D++GR++D+ G P+++GGLLP G F E+S+QYWIPR+Q+MF+AENP  F+ R+  AY+ R+ HEA LRYHLYLDCMP +G+ EL    LKR++ L+K++T  +K  +GLE+A Q+LEKEVM D+WR MN +IL +LV +N  ++++I   + +  +VP KGT+ +P YD+D  F++FA  S+LTKPE + A+CK+Q+ECLEAR++ +FHVP+AKH RLEEFEQTQS  T QV++FLKDTWIDNL+K+IR+ LRDS KGWFNIYETDFYVYT+SKLKK MELVKYCMQD++RYL +DSLT+  NMI D C +C+ L + YEW NDLLTSSLPPKKNPIFLVDLVLD  G HYSTPL  F  V + LF++AI ++Q+VPQLE+F+M+ I+ A+NPLLE+VG+ EP V++LR+ LR+ L  +LIPME+YA +Y KF+ L   DI    N +L+ YE+Q+ +ALEIKL+VEK L EKE++E  IP  IIIGPFY+NTE VRQ L KK KA+ +A+LDLLAR+LRK ADQA E F+ I  +LYE+PNTIEEL E+REWI TIPD L+E+QE IDK ++DYELI+ F+Y LS DDFNAKWT +GWPHKI+  IIQVE+NL +DEERFRKLQ+++ +AF++KLD LTM V+SM SY +I+KA EVANEVRRI+KQL +AQ  A  +NNRERLF  P TNYEK+ +L+KDFEPF+NLW++ ++W+K  ++VMNDPL ++D+E VEK V E YKTMH+S +IF+ELP VQEVA QIK AIEEFKPFIPLIQGLRNPGMR RHWE LS+ LG+SI+PKSTLTF+KCLEMRLQDHIE I+K+A++AGKEY+IE ALNKM  EW+++ FE+L YK+TGT I+K+ DE+NQLLDDH+VMTQSM FSPYKKPFEERI +WE+ L  TQDV+DEW+ CQRQWLYLEPIFSSEDI RQLPVE KRY TMDR+WRK+MK A D P VITLCPD RLL +L+ECN+LL+QVQKGLSEYLETKRQ+FPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKL FE DLEITAM+S EGE + FEK+TYPTGNVEEWMLEIE+MMR S+R IIG+ L  Y + PRTEWVL+WPGQVVIAGCQT+WT EV+ AL    L+ LY  LL QLDGLR +VRGD+TKIG MTLSALIVIEVHARDVV+ M+ E ++N+NDFEWISQLRYYW+  EE LK+RAVNAEF YGYEYLGNT+RLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQI TIQKAQQQR+ RF+FEG EL+LKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDAR L+KKIVTTFKLSSEQLS+QDHYDFGMRAVKSVISAAGNLKRQN  MDEELICLRAI+DVNVPKFL DDLKLFNGIVSDLFPNI+E+P+DYGDL I+++T+  K GL DV GF+ KCIQL+ETTVVRHGLML+GPTGSGKTKCYEVL+ AL+SL+++ SPDGS FQ VHTYVLNPKSITMGQLYGEFDL+THEWTDGILSTLIRQGV AN  +KRWY+FDGPVDAVWIE+MNTVLDDNKKLCLSSGEIIKL + MTMMFEVADLAVASPATVSRCGMVYLEP+ILGL PFV+CWIR LPDAI+ HR+++Q  FD+Y+ +T++F+R   +E++PTT+GQL F+++K+++ F  PF+P     EA TSK K  R      +NLKAPLRP+     +KA+Q+ ++V+ +IG+A+ESWF+FSLIWSFGA+C  + R KFD YLRRKM      +PFPEEG VYDYRFD  G L ++  + ++++  I E+K+KWVHWMAN+ E  +  D+++SDII+PTID VR   + E LL++KKPV+CVGPTGTGKT++I +KLT+ MP EYI EF++FSAKT+A QTQ+LID KLDKRRK V+GPPMG+Y+IFFIDDLNMPALEVFG+QPPIELIRQW DF GWYD K IGEFR LVD+NFI +MGPPGGGRNP+T RLMRHFN L +NEL   SM+T+FGTILK W+ R       A L P  + LV+A I +Y  IQSQ+LPTPAKSHYTFNLRDLSKVFQGMLM+EP SL  S++Q+LRLWFHES RVFQDRLVND DR+WF+NL+  K  + F     + V  EPLLYGDF++ A  +  KY+E  ++ ++L+VIEENL+D+NQINTAKMNL+LFM AV H+CRIARIIRQP GNALLLGMGGSGRQSLT+LA+HMAEY+CFQIELSKNYG ++WR+DLK+IM+ AG+E+K + FLFSDTQIK ESFLED+NN+LN+GDVPN+Y+ DDL++IY  MK I  D GLQ TKTNLF+ Y+KRVR NLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFS WP EALESVAL+ L  +PEL+V +  I  ++ MC + HQSV   ++  + EL+R+NYVTPTS+LELLG+FSKIY  KK+ELK AR+RTK GLDKLL+TEE+V KLQEELEIMKP+LE+AVEESK T EEI RDS++A+ETQ VV  EE  A KKAKEC+ IRDDAQRDLDEA+PAL ESLE+LK LNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKK+ GDKPGVK+DDYW+ GK LLQDPGKFLDSL NYDKDNI D++I KI+PYI SESF PAAI KVS+ACTSIC WVRAMYKYH VAK VAPKR AL+ S  EL +T+KILKEAR++LKA E+RI  LQ K + C RRQ+ELE+KS LCEARL RADKLIGGL +EK+RWQDSVV  + L++N+VGNVL +AG VAY G F G+YR  M +EW   L+ + VPHT  P+  LV TFGDPVK+RNW I GLPKDTLSIENA IV+FSRRWPLFIDPQGQAN+WIK L   +G+ V+K+SDKDFLRSLEN IRFGKPCL+ENVGEELDPALEPILLKQTFK QGA VIKLGDAIIPYH+DFRFYITTKLPNPHY PEVSTKVT+VNFTLSP GLEDQLLG+VVAEERPDLE+AK+QLIVSNAKM++ELKEIED+IL RLS  EGSPVDDIDLIQTLEASKLKS+EI+AKV+ AEQTE DIDETRS+YIPVAVRTQILFFCVADLA IDPMYQYSLEWF+NIF +GI NA +AD + +R+ NINN+FTFSLYSNVCRSLFEKHKL+F+FL+A RILQ+ G I+  E+R+LLAGG+ K +++PNPAPEWISDR+W ++LTL +LP F+  PE  I    + FK IFDS EPHR + P  W D  D FQ +L+LRCLR DKVTNAMQDFV H LG+RF+EPQT +L  V+K+SSP  PLIF+LS GTDPASDLYKFAD+M+F  KKLSAISLGQGQGPRAEEL++ AM+RG WVFFQNCHLAPSWMP LERLVEQIDKD+VHRDFRLWLTSMPSP FPV+ILQNGSKMTVEPP+G+KA+L+++YT  +D++L+ +  KN+ +R LL SL  F+GVL+ERKKFGPLGFNIPYEFT GDLRIC++QL MFLTEY +VP+KVL YTAGHINYGGR+TDDWDRRC M++L  +YN +V+ +DY YS SGIY Q+   +DH  Y+ YI+SLPIND PEIFGLHDNANITFA NET  LL  LL+LQP+ ST    G+  EE+VEE+S+ +L   P+ F++E++ +RYPVMYEQSMNTVL QEVIRYN LL++I  +L DL+KA++GLVVMS +LE M+ SL++N+VP  WA+KAYPSLKPLA+WV DL  R+ FIQ WIDNG+PPVFWISGF+FPQAFLTGTLQN+ARKK IS+DTISF F+VM +A  E+TE+P+DG YIRGLFLEGARWDM   +L ESRPKEL+  MPVIWLIP A+R  P    Y+CPVYKTLTRAGTLSTTGHSTNFVF+I++PTDK  KHW++RGVA
Sbjct:    3 ELPAYIADHIAVHGPTSEVNFLIDFPRHSFDPKVQVPFYTPPTECPRKLQIERRKRRYQSLSLQRILENEYHIRTEDLIARFLD-GTQDANGEWTTYLPLENFDDETYDCRTPEDWLEMGIEDGVRKPVPALCLLPERDDQQHLDIRDPEIVWKWQLSGVLDYDKKSKLWLVQKVDENGRLLDEYGNPIVNGGLLPNGTFSELSSQYWIPRLQVMFIAENPDVFAQRIAAAYRDRKAHEAGLRYHLYLDCMPTEGIAELSNPVLKRIVHLAKNDTCTVKNYRGLEEATQALEKEVMFDFWRGMNDLILRELVEKNKAQYSFIRPVEVKKREVPWKGTLDIPSYDFDDMFDKFASRSMLTKPEAIVALCKAQFECLEARSRLMFHVPMAKHTRLEEFEQTQSMTTNQVAVFLKDTWIDNLRKYIRSCLRDSGKGWFNIYETDFYVYTQSKLKKLMELVKYCMQDTLRYLVMDSLTSLTNMIRDGCVSCLNLPENYEWTNDLLTSSLPPKKNPIFLVDLVLDADGPHYSTPLQNFINVLITLFNRAINSVQDVPQLERFVMEGITCAENPLLEAVGIREPPVEQLRQRLRDYLTASLIPMEAYARQYEKFMELTMLDI----NTYLKIYESQNQSALEIKLQVEKQLKEKEMVETTIPSSIIIGPFYVNTEPVRQTLIKKCKALTSALLDLLARQLRKQADQASEEFRMIAARLYEKPNTIEELTEMREWIATIPDRLEERQEGIDKAISDYELIDAFFYILSADDFNAKWTTIGWPHKIKQMIIQVEKNLEDDEERFRKLQISESSAFSDKLDTLTMMVSSMASYTEISKAQEVANEVRRIYKQLLDAQTLAGTYNNRERLFGLPSTNYEKIPRLLKDFEPFKNLWLSAAEWLKTQEAVMNDPLSSIDAEQVEKQVQECYKTMHRSTRIFHELPGVQEVANQIKQAIEEFKPFIPLIQGLRNPGMRKRHWEELSELLGVSIIPKSTLTFAKCLEMRLQDHIETIAKVADIAGKEYSIESALNKMVSEWQSVVFEILPYKDTGTCIVKIGDEVNQLLDDHVVMTQSMNFSPYKKPFEERIAQWESKLHITQDVLDEWITCQRQWLYLEPIFSSEDITRQLPVESKRYQTMDRIWRKVMKQAADQPQVITLCPDPRLLNSLRECNRLLDQVQKGLSEYLETKRQAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLNFEPDLEITAMYSSEGECVQFEKTTYPTGNVEEWMLEIESMMRTSVRAIIGRALEAYTKTPRTEWVLQWPGQVVIAGCQTFWTSEVTSALAGGSLEQLYPNLLRQLDGLRELVRGDLTKIGLMTLSALIVIEVHARDVVSRMMEEGVRNVNDFEWISQLRYYWLREEEELKLRAVNAEFNYGYEYLGNTTRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVTRFIFEGDELVLKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARLLAKKIVTTFKLSSEQLSTQDHYDFGMRAVKSVISAAGNLKRQNPEMDEELICLRAIRDVNVPKFLSDDLKLFNGIVSDLFPNIREQPVDYGDLTIALKTSCGKLGLMDVEGFLHKCIQLYETTVVRHGLMLIGPTGSGKTKCYEVLKDALTSLRNKPSPDGSFFQIVHTYVLNPKSITMGQLYGEFDLLTHEWTDGILSTLIRQGVNANNEEKRWYLFDGPVDAVWIESMNTVLDDNKKLCLSSGEIIKLTDAMTMMFEVADLAVASPATVSRCGMVYLEPTILGLDPFVQCWIRRLPDAIFAHRDKLQAFFDLYMNDTLEFIRKETKEVIPTTDGQLCFSLLKMLECFFTPFLPK----EAVTSKMK--RMQADKTKNLKAPLRPMVD---DKANQVTEDVLVRIGQALESWFIFSLIWSFGATCTNEGRIKFDEYLRRKMRELKSIMPFPEEGTVYDYRFDDAGLLRMDARDFDDDDVPIAEKKMKWVHWMANMSEVNVPSDIRFSDIIIPTIDTVRCGHLIEMLLVAKKPVLCVGPTGTGKTMTIMNKLTRNMPKEYIPEFMIFSAKTSARQTQELIDGKLDKRRKQVYGPPMGRYMIFFIDDLNMPALEVFGAQPPIELIRQWMDFGGWYDLKTIGEFRKLVDVNFIGAMGPPGGGRNPVTPRLMRHFNFLAYNELDVQSMQTIFGTILKSWLNRLGPDKPPALLLPHADALVQATISMYTTIQSQLLPTPAKSHYTFNLRDLSKVFQGMLMMEPTSLIGSLEQLLRLWFHESTRVFQDRLVNDTDRDWFRNLINDKSKAVFELPVSEYVTNEPLLYGDFLTAAASDVWKYIEMTDHAQVLQVIEENLDDYNQINTAKMNLILFMYAVEHICRIARIIRQPQGNALLLGMGGSGRQSLTRLASHMAEYECFQIELSKNYGFSDWREDLKKIMMTAGIEDKSVTFLFSDTQIKSESFLEDINNLLNAGDVPNIYTLDDLDKIYDAMKMIAADQGLQPTKTNLFNCYTKRVRANLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSPWPSEALESVALRTLKQMPELDVDDSTIEAMVKMCIDQHQSVVRNTDLLQNELNRHNYVTPTSFLELLGVFSKIYGLKKEELKTARNRTKIGLDKLLFTEEVVSKLQEELEIMKPELERAVEESKVTMEEIARDSKIAEETQSVVAHEERQAMKKAKECQTIRDDAQRDLDEAMPALYESLEALKSLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKVAGDKPGVKVDDYWEPGKMLLQDPGKFLDSLLNYDKDNIPDAIIAKIKPYIESESFMPAAIAKVSKACTSICLWVRAMYKYHHVAKNVAPKRAALQASELELAETEKILKEARSRLKACEERIASLQIKYDECIRRQRELEDKSQLCEARLVRADKLIGGLGSEKLRWQDSVVKFDQLLDNLVGNVLCAAGSVAYFGPFPGKYRADMSNEWVTKLRGHAVPHTTDPSPTLVQTFGDPVKLRNWHIFGLPKDTLSIENAFIVQFSRRWPLFIDPQGQANKWIKALGSADGMIVLKMSDKDFLRSLENTIRFGKPCLLENVGEELDPALEPILLKQTFKHQGATVIKLGDAIIPYHNDFRFYITTKLPNPHYKPEVSTKVTLVNFTLSPDGLEDQLLGLVVAEERPDLEEAKSQLIVSNAKMKEELKEIEDRILERLSATEGSPVDDIDLIQTLEASKLKSSEIQAKVVAAEQTEHDIDETRSKYIPVAVRTQILFFCVADLANIDPMYQYSLEWFVNIFLHGIRNADRADNVPQRVQNINNFFTFSLYSNVCRSLFEKHKLMFAFLIAIRILQNGGFINAEEYRYLLAGGTTKPREVPNPAPEWISDRMWGDVLTLTALPKFASLPES-ITSEKDGFKAIFDSPEPHRARFPDPWQDELDSFQRILLLRCLRADKVTNAMQDFVTHHLGQRFVEPQTTNLPEVFKESSPAAPLIFILSQGTDPASDLYKFADEMRFGGKKLSAISLGQGQGPRAEELMRAAMDRGIWVFFQNCHLAPSWMPVLERLVEQIDKDRVHRDFRLWLTSMPSPNFPVYILQNGSKMTVEPPKGMKAHLMRTYTGLNDNYLSQVPDKNSVFRQLLFSLAFFNGVLVERKKFGPLGFNIPYEFTTGDLRICMDQLIMFLTEYMEVPYKVLCYTAGHINYGGRITDDWDRRCAMSILDEYYNNRVLQDDYSYSPSGIYHQLPGTSDHGIYLEYIKSLPINDLPEIFGLHDNANITFAQNETFELLGYLLQLQPRASTGSSTGQQVEEVVEEISRSLLAKTPKPFDLEEVIQRYPVMYEQSMNTVLTQEVIRYNNLLSVIHQTLNDLIKAVKGLVVMSASLEEMAGSLFNNRVPTIWANKAYPSLKPLAAWVEDLILRVRFIQDWIDNGVPPVFWISGFYFPQAFLTGTLQNYARKKRISVDTISFDFQVMKQAVTELTELPTDGSYIRGLFLEGARWDMQNHKLGESRPKELYVNMPVIWLIPVAHRKPPTKGSYECPVYKTLTRAGTLSTTGHSTNFVFAIDIPTDKLAKHWVQRGVA 4148          
BLAST of Dynein heavy chain axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|21488652 (tr|A0A074ZNX3|A0A074ZNX3_9TREM Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_04421 PE=4 SV=1)

HSP 1 Score: 5980.98 bits (15515), Expect = 0.000e+0
Identity = 2891/4111 (70.32%), Postives = 3443/4111 (83.75%), Query Frame = 2
Query:  344 DFPEKSFEPKLQLMYFVAPGMIPRRVRLEREKRAYXXXXXXXXXXXXGNITSDYLIPKYHPPNGKKFDGSWAPYLFLETFDNEEYEIRNPDEWLAMGLEDGVRKPVPGRALLPVTDDKHDVDIRDPSIDWTWQSVGVLDYDTDTKLWFVQKTDKSGRVIDDIGRPVIDGGLLPTGHFLEMSNQYWIPRIQLMFLAENPIKFSNRVIEAYQSRELHEALLRYHLYLDCMPMDGLGELDQSSLKRMIRLSKDETPILKKQKGLEDAVQSLEKEVMVDYWRSMNTIILHKLVGENPQKFNYITLPKPELPKVPMKGTIPMPKYDWDTKFEEFAFYSLLTKPEVVQAMCKSQYECLEARNKQLFHVPLAKHMRLEEFEQTQSQATQQVSLFLKDTWIDNLQKFIRTSLRDSKKGWFNIYETDFYVYTKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWI--EENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMR-----AVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLT-SVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLYGDFMSVAIENK-KYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKF-SKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIA-KNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAG--GKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAG-TLST 12634
            DFP  SF+PK+Q+ ++  P   PR++++ER KR Y  LSL+ +L +E +I ++ LI ++     +  +G W  YL LE FD+E Y+ R P++WL MG+EDGVRKPVP   LLP  DD+  +DIRDP I W WQ  GVLDYD  +KLW VQK D++GR++D+ G P+++GGLLP G F E+S+QYWIPR+Q+MF+AENP  F+ R+  AY+ R+ HEA LRYHLYLDCMP +G+ EL    LKR++ L+K++T  +K  +GLE+A Q+LEKEVM D+WR MN +IL +LV +N  ++++I   + +  +VP KGT+ +P YD+D  F++FA  S+LTKPE + A+CK+Q+ECLEAR++ +FHVP+AKH RLEEFEQTQS  T QV++FLKDTWIDNL+K+IR+ LRDS KGWFNIYETDFYVYT+SKLKK MELVKYCMQD++RYL +DSLT+  NMI D C +C+ L + YEW NDLLTSSLPPKKNPIFLVDLVLD  G HYSTPL  F  V + LF++AI ++Q+VPQLE+F+M+ I+ A+NPLLE+VG+ EP V++LR+ LR+ L  +LIPME+YA +Y KF+ L   DI    N +L+ YE+Q+ +ALEIKL+VEK L EKE++E  IP  IIIGPFY+NTE VRQ L KK KA+ +A+LDLLAR+LRK ADQA E F+ I  +LYE+PNTIEEL E+REWI TIPD L+E+QE IDK ++DYELI+ F+Y LS DDFNAKWT +GWPHKI+  IIQVE+NL +DEERFRKLQ+++ +AF++KLD LTM V+SM SY +I+KA EVANEVRRI+KQL +AQ  A  +NNRERLF  P TNYEK+ +L+KDFEPF+NLW++ ++W+K  ++VMNDPL ++D+E VEK V E YKTMH+S +IF+ELP VQEVA QIK AIEEFKPFIPLIQGLRNPGMR RHWE LS+ LG+SI+PKSTLTF+KCLEMRLQDHIE I+K+A++AGKEY+IE ALNKM  EW+++ FE+L YK+TGT I+K+ DE+NQLLDDH+VMTQSM FSPYKKPFEERI +WE+ L  TQDV+DEW+ CQRQWLYLEPIFSSEDI RQLPVE KRY TMDR+WRK+MK A D P VITLCPD RLL +L+ECN+LL+QVQKGLSEYLETKRQ+FPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKL FE DLEITAM+S EGE + FEK+TYPTGNVEEWMLEIE+MMR S+R IIG+ L  Y + PRTEWVL+WPGQVVIAGCQT+WT EV+ AL    L+ LY  LL QLDGLR +VRGD+TKIG MTLSALIVIEVHARDVV+ M+ E ++N+NDFEWISQLRYYW+  EE LK+RAVNAEF YGYEYLGNT+RLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQI TIQKAQQQR+ RF+FEG EL+LKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDAR L+KKIVTTFKLSSEQLS+QDHYDFGMRAVKSVISAAGNLKRQN  MDEELICLRAI+DVNVPKFL DDLKLFNGIVSDLFPNI+E+P+DYGDL I+++T+  K GL DV GF+ KCIQL+ETTVVRHGLML+GPTGSGKTKCYEVL+ AL+SL+++ SPDGS FQ VHTYVLNPKSITMGQLYGEFDL+THEWTDGILSTLIRQGV AN  +KRWY+FDGPVDAVWIE+MNTVLDDNKKLCLSSGEIIKL + MTMMFEVADLAVASPATVSRCGMVYLEP+ILGL PFV+CWIR LPDAI+ HR+++Q  FD+Y+ +T++F+R   +E++PTT+GQL F+++K+++ F  PF+P     EA TSK K  R      +NLKAPLRP+     +KA+Q+ ++V+ +IG+A+ESWF+FSLIWSFGA+C  + R KFD YLRRKM      +PFPEEG VYDYRFD  G L ++  + ++++  I E+K+KWVHWMAN+ E  +  D+++SDII+PTID VR   + E LL++KKPV+CVGPTGTGKT++I +KLT+ MP EYI EF++FSAKT+A QTQ+LID KLDKRRK V+GPPMG+Y+IFFIDDLNMPALEVFG+QPPIELIRQW DF GWYD K IGEFR LVD+NFI +MGPPGGGRNP+T RLMRHFN L +NEL   SM+T+FGTILK W+ R       A L P  + LV+A I +Y  IQSQ+LPTPAKSHYTFNLRDLSKVFQGMLM+EP SL  S++Q+LRLWFHES RVFQDRLVND DR+WF+NL+  K  + F     + V  EPLLYGDF++ A  +  KY+E  ++ ++L+VIEENL+D+NQINTAKMNL+LFM AV H+CRIARIIRQP GNALLLGMGGSGRQSLT+LA+HMAEY+CFQIELSKNYG ++WR+DLK+IM+ AG+E+K + FLFSDTQIK ESFLED+NN+LN+GDVPN+Y+ DDL++IY  MK I  D GLQ TKTNLF+ Y+KRVR NLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFS WP EALESVAL+ L  +PEL+V +  I  ++ MC + HQSV   ++  + EL+R+NYVTPTS+LELLG+FSKIY  KK+ELK AR+RTK GLDKLL+TEE+V KLQEELEIMKP+LE+AVEESK T EEI RDS++A+ETQ VV  EE  A KKAKEC+ IRDDAQRDLDEA+PAL ESLE+LK LNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKK+ GDKPGVK+DDYW+ GK LLQDPGKFLDSL NYDKDNI D++I KI+PYI SESF PAAI KVS+ACTSIC WVRAMYKYH VAK VAPKR AL+ S  EL +T+KILKEAR++LKA E+RI  LQ K + C RRQ+ELE+KS LCEARL RADKLIGGL +EK+RWQDSVV  + L++N+VGNVL +AG VAY G F G+YR  M +EW   L+ + VPHT  P+  LV TFGDPVK+RNW I GLPKDTLSIENA IV+FSRRWPLFIDPQGQAN+WIK L   +G+ V+K+SDKDFLRSLEN IRFGKPCL+ENVGEELDPALEPILLKQTFK QGA VIKLGDAIIPYH+DFRFYITTKLPNPHY PEVSTKVT+VNFTLSP GLEDQLLG+VVAEERPDLE+AK+QLIVSNAKM++ELKEIED+IL RLS  EGSPVDDIDLIQTLEASKLKS+EI+AKV+ AEQTE DIDETRS+YIPVAVRTQILFFCVADLA IDPMYQYSLEWF+NIF +GI NA +AD + +R+ NINN+FTFSLYSNVCRSLFEKHKL+F+FL+A RILQ+ G I+  E+R+LLAGG+ K +++PNPAPEWISDR+W ++LTL +LP F+  PE  I    + FK IFDS EPHR + P  W D  D FQ +L+LRCLR DKVTNAMQDFV H LG+RF+EPQT +L  V+K+SSP  PLIF+LS GTDPASDLYKFAD+M+F  KKLSAISLGQGQGPRAEEL++ AM+RG WVFFQNCHLAPSWMP LERLVEQIDKD+VHRDFRLWLTSMPSP FPV+ILQNGSKMTVEPP+G+KA+L+++YT  +D++L+ +  KN+ +R LL SL  F+GVL+ERKKFGPLGFNIPYEFT GDLRIC++QL MFLTEY +VP+KVL YTAGHINYGGR+TDDWDRRC M++L  +YN +V+ +DY YS SGIY Q+   +DH  Y+ YI+SLPIND PEIFGLHDNANITFA NET  LL  LL+LQP+ ST    G+  EE+VEE+S+ +L   P+ F++E++ +RYPVMYEQSMNTVL QEVIRYN LL++I  +L DL+KA++GLVVMS +LE M+ SL++N+VP  WA+KAYPSLKPLA+WV DL  R+ FIQ WIDNG+PPVFWISGF+FPQAFLTGTLQN+ARKK IS+DTISF F+VM +A  E+TE+P+DG YIRGLFLEGARWDM   +L ESRPKEL+  MPVIWLIP A+R  P    Y+CPVYKTLTRAG TL T
Sbjct:   12 DFPRHSFDPKVQVPFYTPPTECPRKLQIERRKRRYQSLSLQRILENEYHIRTEDLIARFLD-GTQDANGEWTTYLPLENFDDETYDCRTPEDWLEMGIEDGVRKPVPALCLLPERDDQQHLDIRDPEIVWKWQLSGVLDYDKKSKLWLVQKVDENGRLLDEYGNPIVNGGLLPNGTFSELSSQYWIPRLQVMFIAENPDVFAQRIAAAYRDRKAHEAGLRYHLYLDCMPTEGIAELSNPVLKRIVHLAKNDTCTVKNYRGLEEATQALEKEVMFDFWRGMNDLILRELVEKNKAQYSFIRPVEVKKREVPWKGTLDIPSYDFDDMFDKFASRSMLTKPEAIVALCKAQFECLEARSRLMFHVPMAKHTRLEEFEQTQSMTTNQVAVFLKDTWIDNLRKYIRSCLRDSGKGWFNIYETDFYVYTQSKLKKLMELVKYCMQDTLRYLVMDSLTSLTNMIRDGCVSCLNLPENYEWTNDLLTSSLPPKKNPIFLVDLVLDADGPHYSTPLQNFINVLITLFNRAINSVQDVPQLERFVMEGITCAENPLLEAVGIREPPVEQLRQRLRDYLTASLIPMEAYARQYEKFMELTMLDI----NTYLKIYESQNQSALEIKLQVEKQLKEKEMVETTIPSSIIIGPFYVNTEPVRQTLIKKCKALTSALLDLLARQLRKQADQASEEFRMIAARLYEKPNTIEELTEMREWIATIPDRLEERQEGIDKAISDYELIDAFFYILSADDFNAKWTTIGWPHKIKQMIIQVEKNLEDDEERFRKLQISESSAFSDKLDTLTMMVSSMASYTEISKAQEVANEVRRIYKQLLDAQTLAGTYNNRERLFGLPSTNYEKIPRLLKDFEPFKNLWLSAAEWLKTQEAVMNDPLSSIDAEQVEKQVQECYKTMHRSTRIFHELPGVQEVANQIKQAIEEFKPFIPLIQGLRNPGMRKRHWEELSELLGVSIIPKSTLTFAKCLEMRLQDHIETIAKVADIAGKEYSIESALNKMVSEWQSVVFEILPYKDTGTCIVKIGDEVNQLLDDHVVMTQSMNFSPYKKPFEERIAQWESKLHITQDVLDEWITCQRQWLYLEPIFSSEDITRQLPVESKRYQTMDRIWRKVMKQAADQPQVITLCPDPRLLNSLRECNRLLDQVQKGLSEYLETKRQAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLNFEPDLEITAMYSSEGECVQFEKTTYPTGNVEEWMLEIESMMRTSVRAIIGRALEAYTKTPRTEWVLQWPGQVVIAGCQTFWTSEVTSALAGGSLEQLYPNLLRQLDGLRELVRGDLTKIGLMTLSALIVIEVHARDVVSRMMEEGVRNVNDFEWISQLRYYWLREEEELKLRAVNAEFNYGYEYLGNTTRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVTRFIFEGDELVLKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARLLAKKIVTTFKLSSEQLSTQDHYDFGMRAVKSVISAAGNLKRQNPEMDEELICLRAIRDVNVPKFLSDDLKLFNGIVSDLFPNIREQPVDYGDLTIALKTSCGKLGLMDVEGFLHKCIQLYETTVVRHGLMLIGPTGSGKTKCYEVLKDALTSLRNKPSPDGSFFQIVHTYVLNPKSITMGQLYGEFDLLTHEWTDGILSTLIRQGVNANNEEKRWYLFDGPVDAVWIESMNTVLDDNKKLCLSSGEIIKLTDAMTMMFEVADLAVASPATVSRCGMVYLEPTILGLDPFVQCWIRRLPDAIFAHRDKLQAFFDLYMNDTLEFIRKETKEVIPTTDGQLCFSLLKMLECFFTPFLPK----EAVTSKMK--RMQADKTKNLKAPLRPMVD---DKANQVTEDVLVRIGQALESWFIFSLIWSFGATCTNEGRIKFDEYLRRKMRELKSIMPFPEEGTVYDYRFDDAGLLRMDARDFDDDDVPIAEKKMKWVHWMANMSEVNVPSDIRFSDIIIPTIDTVRCGHLIEMLLVAKKPVLCVGPTGTGKTMTIMNKLTRNMPKEYIPEFMIFSAKTSARQTQELIDGKLDKRRKQVYGPPMGRYMIFFIDDLNMPALEVFGAQPPIELIRQWMDFGGWYDLKTIGEFRKLVDVNFIGAMGPPGGGRNPVTPRLMRHFNFLAYNELDVQSMQTIFGTILKSWLNRLGPDKPPALLLPHADALVQATISMYTTIQSQLLPTPAKSHYTFNLRDLSKVFQGMLMMEPTSLIGSLEQLLRLWFHESTRVFQDRLVNDTDRDWFRNLINDKSKAVFELPVSEYVTNEPLLYGDFLTAAASDVWKYIEMTDHAQVLQVIEENLDDYNQINTAKMNLILFMYAVEHICRIARIIRQPQGNALLLGMGGSGRQSLTRLASHMAEYECFQIELSKNYGFSDWREDLKKIMMTAGIEDKSVTFLFSDTQIKSESFLEDINNLLNAGDVPNIYTLDDLDKIYDAMKMIAADQGLQPTKTNLFNCYTKRVRANLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSPWPSEALESVALRTLKQMPELDVDDSTIEAMVKMCIDQHQSVVRNTDLLQNELNRHNYVTPTSFLELLGVFSKIYGLKKEELKTARNRTKIGLDKLLFTEEVVSKLQEELEIMKPELERAVEESKVTMEEIARDSKIAEETQSVVAHEERQAMKKAKECQTIRDDAQRDLDEAMPALYESLEALKSLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKVAGDKPGVKVDDYWEPGKMLLQDPGKFLDSLLNYDKDNIPDAIIAKIKPYIESESFMPAAIAKVSKACTSICLWVRAMYKYHHVAKNVAPKRAALQASELELAETEKILKEARSRLKACEERIASLQIKYDECIRRQRELEDKSQLCEARLVRADKLIGGLGSEKLRWQDSVVKFDQLLDNLVGNVLCAAGSVAYFGPFPGKYRADMSNEWVTKLRGHAVPHTTDPSPTLVQTFGDPVKLRNWHIFGLPKDTLSIENAFIVQFSRRWPLFIDPQGQANKWIKALGSADGMIVLKMSDKDFLRSLENTIRFGKPCLLENVGEELDPALEPILLKQTFKHQGATVIKLGDAIIPYHNDFRFYITTKLPNPHYKPEVSTKVTLVNFTLSPDGLEDQLLGLVVAEERPDLEEAKSQLIVSNAKMKEELKEIEDRILERLSATEGSPVDDIDLIQTLEASKLKSSEIQAKVVAAEQTEHDIDETRSKYIPVAVRTQILFFCVADLANIDPMYQYSLEWFVNIFLHGIRNADRADNVPQRVQNINNFFTFSLYSNVCRSLFEKHKLMFAFLIAIRILQNGGFINAEEYRYLLAGGTTKPREVPNPAPEWISDRMWGDVLTLTALPKFASLPES-ITSEKDGFKAIFDSPEPHRARFPDPWQDELDSFQRILLLRCLRADKVTNAMQDFVTHHLGQRFVEPQTTNLPEVFKESSPAAPLIFILSQGTDPASDLYKFADEMRFGGKKLSAISLGQGQGPRAEELMRAAMDRGIWVFFQNCHLAPSWMPVLERLVEQIDKDRVHRDFRLWLTSMPSPNFPVYILQNGSKMTVEPPKGMKAHLMRTYTGLNDNYLSQVPDKNSVFRQLLFSLAFFNGVLVERKKFGPLGFNIPYEFTTGDLRICMDQLIMFLTEYMEVPYKVLCYTAGHINYGGRITDDWDRRCAMSILDEYYNNRVLQDDYSYSPSGIYHQLPGTSDHGIYLEYIKSLPINDLPEIFGLHDNANITFAQNETFELLGYLLQLQPRASTGSSTGQQVEEVVEEISRSLLAKTPKPFDLEEVIQRYPVMYEQSMNTVLTQEVIRYNNLLSVIHQTLNDLIKAVKGLVVMSASLEEMAGSLFNNRVPTIWANKAYPSLKPLAAWVEDLILRVRFIQDWIDNGVPPVFWISGFYFPQAFLTGTLQNYARKKRISVDTISFDFQVMKQAVTELTELPTDGSYIRGLFLEGARWDMQNHKLGESRPKELYVNMPVIWLIPVAHRKPPTKGSYECPVYKTLTRAGPTLKT 4107          
BLAST of Dynein heavy chain axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|22834996 (tr|A0A5K4FAN6|A0A5K4FAN6_SCHMA Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 5925.13 bits (15370), Expect = 0.000e+0
Identity = 2878/4230 (68.04%), Postives = 3464/4230 (81.89%), Query Frame = 2
Query:   98 MSDREVDKYPEVKQRGYYSEILSDGAIEQLENVTHGPPEVQNLL-SQTIHYENTPKVGTFEIPDQLNSN------IDVHGESTKIDIIIDFPEKSFEPKLQLMYFVAPGMIPRRVRLEREKRAYXXXXXXXXXXXXGNITSDYLIPKYHPPNGKKF---DGSWAPYLFLETFDNEEYEIRNPDEWLAMGLEDGVRKPVPGRALLPVTDDKHDVDIRDPSIDWTWQSVGVLDYDTDTKLWFVQKTDKSGRVIDDIGRPVIDGGLLPTGHFLEMSNQYWIPRIQLMFLAENPIKFSNRVIEAYQSRELHEALLRYHLYLDCMPMDGLGELDQSSLKRMIRLSKDETPILKKQKGLEDAVQSLEKEVMVDYWRSMNTIILHKLVGENPQKFNYITLPKPELPKVPMKGTIPMPKYDWDTKFEEFAFYSLLTKPEVVQAMCKSQYECLEARNKQLFHVPLAKHMRLEEFEQTQSQATQQVSLFLKDTWIDNLQKFIRTSLRDSKKGWFNIYETDFYVYTKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWI--EENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAE-----LHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTS--VDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLYGDFMSVAIEN-KKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKF-SKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKM-STAG-GKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            MS  + D +P++KQRGYY++       +   N+T    + QNL  S   H  N  K   F    +L+ N       D+HG +++I++ +DFP +SF+PK+Q+ ++  P   PR++ +ER+KR +  LS+  +L  E +I ++ L+P++     +K+     SW  YL LE FD+++Y+ R P +WLA+G+E+GVRKP+P   LLPV D +H +DIR P IDW WQ  GVLDYD  +KLWFVQK D  GR++D+ G  VI+ GLLP+G  LE++ QYWIPRIQ+MFLAE+P  F+ RV  A++SR+ HE+ LRY+LYLDCMP +G+GEL  + LKRM  L+KDET  ++  KG++  +Q+LE+EV  DYWRSMN +IL +L+ +   +++++  P+ +  K P KGT+ +P YD+D  F+ F+  S+LTKPE + A+ K QYECLE R+K +FHV L+KHMR+EEFEQTQS    QVS+FLKD WI+NL+K IRT  RD  KGWFNIYETDFYVYT+SKLKKFME++K+CMQD +RYL +DSL NF NM+ D+C +C+ +   YEW NDL+TSSLPPK+NPIFLVDL LD  G HYSTP+ QFP   + +FDKAI ++Q+VPQ+EQ++++ I+  +  LLE+VG+ EPQV++LR+   E +  ALIPM +YA +Y +F+ L   DIT +    L+ YE+++ + LEIK E+EK+L EKE +EQ+IP +IIIGPFY+NTE VRQ L+KK KA+ NA+ +LLA++LRK AD   E  K+I  KLYE+PN+IEEL +LREWI T+PD L+E+QE IDK ++DYELI+ F+YNLS DDFNAKWT +GWPHKIR  IIQVE+NL EDEERF+KLQ+++ AAF +K+D LTM V+SM SY++I KA EVANEVRR++KQL +AQ    L N+RERLF  P TNYE + +L+KDFEPF+NLW+ VSDW+K  ++VMNDPLI++D++ VEK + E YKTMHKSV+IF+ELP++QE+A Q+K++IEEFKP++PLIQ LRNPGMR RHWE LS+ELG+SIVPK++LTFSKCLEM LQD+I+IISKIA++AGKEY+IE ALNKM  +WE++KF+V+ YK+TGT I+K++DE+NQLLDDHIVMTQSM FSPYKKPFEERI+ WE  L  TQDV+DEW+ CQRQWLYLEPIF+SEDIN+QLPVE KRYATMDR+WRK+MK+A +   VITLCPDARLL  L+ECN+LLEQVQKGLSEYLETKRQ+FPRFYFLSDDELLEILSQTKDP AVQPHLRKCFENIAKLQFEKDL+ITAMFSGEGE + FEK+TYPT NVEEWMLEIEN+MR S+R IIGK +  Y   PRT+WVL+WPGQ++IA CQTYWT EV++A+ T  +  LY  LL+QLDGLR +VRGD+TKIGRMTLSALIVIEVHARDVV  +I E +QN+NDFEWISQLRYYW   EE LK+RAVNAEF YGYEYLGNT+RLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQI TIQKAQQQ L RF+FEG +L LKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGF+DAR L+KKIVTTFKLSSEQLS+QDHYDFGMRAVKSVISAAGNLKRQNT MDE+LICLRAI+DVNVPKFL DDLKLF+GIVSDLFPNI E+PIDYGDL+++++T+  K GL +V GFV KCIQL+ETTVVRHGLMLVGPTGSGKTKCYEVLQ+AL+SL+++++PDG+ FQTVHTY+LNPKSITMGQLYGEF+L+THEWTDGILSTLIR GV ++  DKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKL + MTMMFEVADLAVASPATVSRCGMVYLEPSILGL PFV+CWI+ LPD IY + E++Q+LFD Y+E+++ F+R+  +EI+ TT+GQL F+++K+MD F  PF                    Q   +N+                   DEV+ +IG+A+ESWFLFSLIWS GA+C  + R KFD YLRRKM      L FPEEGL+YDYRF+  G LSL  +++E E+  I  +   W HWM N+PEY I PD++YSDII+PTIDNVR   I E LL++KKPV+C+GPTGTGK+L+I  KLT++MP EYI EFI+FSAKTTA QTQDLIDSKLDKRRK +FGPP+G+YIIFFIDDLNMPALEV+G+QPPIELIRQW DF GWYD K IGEFR L+D+NFI SMGPPGGGRNPIT RLMRHFN L +NEL + SM+ +F  ILK W+ RA +E     L      LVKA I VY  IQ Q+LPTPAKSHYTFNLRDLSKVFQGMLM++ + L+S  ++Q+LRLW+HESCRVFQDRLVND DR+WF  L+       FN    D V   PLLYGDF+S++  +  KY+E  +++K+L+VIEENL+D+NQINTAKM+L+LF+ AV+H+CRI+RIIRQP GNALLLGMGGSGRQ LT+LA+HMAEYDCFQIELSKNYG+ +WR+DLK+IM+ AG+ENKP+ FLFSDTQIK ESFLED+NNILN+GDVPN+Y  D+L++IY  MK +  +  LQ TKTNLFS Y+KR+R NLH VITMSPIGEIFRARLRQFPALVNCCTIDWFS+WP EAL+SVA + L ++ +LE+ E+ +  L+ +C +IHQSV   +E ++QEL+R+NYVTPTS+LELL +FSKIY  KK E+  AR+RT+ GLDKLLYTEE+V KLQEELE+MKP+L +AVEES+ T EEI  DS++A+ETQIVV REE  A KKA EC+ IRDDAQRDLDEALPAL ESLE+LK LNKNDITEVRAMMRPPEGVRLVIE VCIMKDVKPKK+ GDKPGVKIDDYW+ GK +LQDPGKFLDSL NYDK+NI + +I KI+PYI SESF+PA I KVS+ACTSIC WVRAM+KY+ VAK V PKR+AL+ S  EL +T+++L EAR +LKA EDRI  LQ K   C R+Q ELE KS LCEARL RADKLIGGL +EKIRW +SV NL +L+ N+VGNVL S+G VAY G F+ +YR +M +EW   LK + VPHT +PA NLV T+GDPVK+RNW I GLPKD LSIENAVIV+FSRRWPLFIDPQGQAN+WIK L +++G+ +IKLSDKDF+R+LENA+RFGKPCL+ENVGEELDP LE +LLKQTFKQQGA VIKLGDAIIPYH+DF+ YITTKL NPHY PEVSTKVT+VNFTLSPSGLEDQLLG+VVAEERPDLE+AKNQLI+SNAKM+QELKEIEDKIL RLS  EGSPVDD+DLIQTLEASKLKS+EI+++VI AEQTERDIDETRS+YIPVAVRTQILFFCVADLA IDPMYQYSLEWF+NIF  GITNA +AD + +R++NIN+YFTFSLY NVCRSLFEKHKL+F+FLLA RILQ+EG ID +E+RFLLAGG+ K ++LPNPAPEWISDR+W ++L LASLP F+  PE       + FK+IFDS +PHR   P  W    D FQ +L+LRCLR DK+TNAMQDFV+  LG++F+EPQTA+L  V+KDSSP+TPLIFVLS GTDPASDLYKFAD+M F  KKLSAISLGQGQGPRAEEL++ A+ERG WVFFQNCHLAPSWMP+LERLVEQIDKDKVHRDFRLWLTSMPSP FPV+ILQNGSKMTVEPP+G+KANLL++Y S +D +L   A N  +RHL LSL  FHGVLIERKKFGPLGFNIPYEFT GDLRIC++QL MFL EY   P+KVL YTAGHINYGGR+TDDWDRRC M++L  +Y P+V+ ++Y YS SGIY Q+   TDH  Y+ YIRSLPIND PEIFGLH+NANITFA NET  LL  LL LQPK  ST+G GK REEIVEE+S+ +L   P++F++  +  +YPVMYEQSMNTVL QEVIRYN LL+ I+++L DL+KA++G VVMS  LE M+ SL+DN+VP  WASKAYPSLKPLA+W+ DL  R+ FIQ WID+G+P VFWISGFFFPQAFLTGTLQN+ARKK+IS+DTISF FKVM +   ++ + P+DG YIRGL+LEGA WD     L ESRPKELF  MPVIWLIP  NR  P   IY+CPVYKTLTRAGTLSTTGHSTNFVFSIE+PTD+ QKHW++RGVA
Sbjct:    1 MSGEKEDFHPKIKQRGYYTD-------QYTANLTRHY-DFQNLAASLNQHIINYSKENCFLPHAELDINKPLINCTDIHGPTSEINMFVDFPPRSFDPKVQVPFYTPPKHCPRKLHIERKKRKFQSLSISEILEQEYHIQANELLPRF----CEKYIVEKNSWTSYLPLEYFDDDQYDFRTPSDWLALGMEEGVRKPIPAVCLLPVNDHQHSLDIRSPEIDWKWQLSGVLDYDVCSKLWFVQKVDSKGRILDESGNTVINDGLLPSGKLLELNTQYWIPRIQVMFLAEDPQIFAKRVATAFKSRQEHESALRYNLYLDCMPNEGIGELSSAVLKRMTFLAKDETRAIRNSKGIDSVLQNLEREVTFDYWRSMNDLILRQLIKKQGTQYHFVQPPEIKRRKTPWKGTLDIPLYDFDNIFQSFSSKSMLTKPEAIMAIRKCQYECLEVRSKSIFHVLLSKHMRIEEFEQTQSMVISQVSIFLKDAWIENLRKHIRTCFRDIGKGWFNIYETDFYVYTQSKLKKFMEMMKFCMQDGLRYLIMDSLLNFTNMLRDSCISCLNIPNEYEWTNDLMTSSLPPKRNPIFLVDLQLDTDGPHYSTPITQFPNTLIQIFDKAINSVQDVPQIEQYVIEGITCVEKQLLEAVGLHEPQVERLRQQFTEYINSALIPMRAYAKQYERFMELTILDITAH----LKAYESKNLSVLEIKQEIEKYLQEKETVEQIIPSFIIIGPFYVNTEPVRQNLSKKYKALINALSELLAKQLRKQADTISEELKSIAMKLYEKPNSIEELTDLREWISTVPDKLEERQEYIDKAVSDYELIDLFFYNLSADDFNAKWTTIGWPHKIRQIIIQVEKNLEEDEERFKKLQISESAAFADKIDTLTMMVSSMASYSEIGKAQEVANEVRRVYKQLLDAQNMGGLLNSRERLFGLPNTNYENIPRLLKDFEPFKNLWLNVSDWMKTQEAVMNDPLISIDADNVEKVIVECYKTMHKSVRIFHELPNIQELANQVKLSIEEFKPYLPLIQSLRNPGMRQRHWEQLSEELGVSIVPKTSLTFSKCLEMHLQDNIDIISKIADIAGKEYSIESALNKMMNDWESVKFDVIPYKDTGTCIIKIADEVNQLLDDHIVMTQSMNFSPYKKPFEERISHWENKLHLTQDVLDEWVTCQRQWLYLEPIFNSEDINKQLPVESKRYATMDRIWRKVMKSASEQSQVITLCPDARLLNALRECNRLLEQVQKGLSEYLETKRQAFPRFYFLSDDELLEILSQTKDPKAVQPHLRKCFENIAKLQFEKDLQITAMFSGEGECVKFEKTTYPTSNVEEWMLEIENLMRYSIRTIIGKSIKAYADTPRTDWVLQWPGQIIIAVCQTYWTTEVTEAICTNKMNELYSNLLKQLDGLRNLVRGDLTKIGRMTLSALIVIEVHARDVVAKIIEEGVQNVNDFEWISQLRYYWKNDEEQLKLRAVNAEFNYGYEYLGNTTRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQHLTRFLFEGDDLELKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFTDARLLAKKIVTTFKLSSEQLSTQDHYDFGMRAVKSVISAAGNLKRQNTDMDEDLICLRAIRDVNVPKFLSDDLKLFSGIVSDLFPNINEKPIDYGDLMVALKTSCSKLGLMEVEGFVHKCIQLYETTVVRHGLMLVGPTGSGKTKCYEVLQNALTSLRNKLAPDGTLFQTVHTYILNPKSITMGQLYGEFNLLTHEWTDGILSTLIRHGVNSSDDDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLTDPMTMMFEVADLAVASPATVSRCGMVYLEPSILGLKPFVQCWIKQLPDPIYHYHEKLQELFDRYMEDSIRFIRNETKEIITTTDGQLCFSLMKMMDCFFVPF--------------------QSKEKNIGT-----------------DEVITRIGQAIESWFLFSLIWSIGATCTNEGRMKFDQYLRRKMKELKCDLSFPEEGLIYDYRFEDDGLLSLGVKDDEEEDNCITRKMH-WAHWMINIPEYKITPDIRYSDIIIPTIDNVRSSHIIEMLLLAKKPVLCIGPTGTGKSLNILHKLTRHMPKEYIPEFIIFSAKTTAKQTQDLIDSKLDKRRKHLFGPPLGRYIIFFIDDLNMPALEVYGAQPPIELIRQWMDFSGWYDLKMIGEFRKLIDVNFICSMGPPGGGRNPITARLMRHFNFLAYNELDDSSMQLIFSVILKSWVNRATSENVTMKLMSYTNDLVKASISVYKTIQKQLLPTPAKSHYTFNLRDLSKVFQGMLMMDVDQLSSGNIEQLLRLWYHESCRVFQDRLVNDVDRDWFNQLINKTSKEMFNLNVNDYVTTTPLLYGDFLSISNNDASKYMEMTDHNKVLQVIEENLDDYNQINTAKMDLILFIYAVQHICRISRIIRQPQGNALLLGMGGSGRQCLTRLASHMAEYDCFQIELSKNYGMNDWREDLKKIMMKAGIENKPVTFLFSDTQIKSESFLEDINNILNAGDVPNIYQLDELDKIYDSMKIVAAESNLQPTKTNLFSCYTKRIRANLHIVITMSPIGEIFRARLRQFPALVNCCTIDWFSEWPTEALKSVAFRMLQNMSDLEIDEQTLESLVQLCIDIHQSVVQNTELFKQELNRHNYVTPTSFLELLSVFSKIYGLKKSEIITARNRTQTGLDKLLYTEEVVSKLQEELELMKPELLKAVEESRITMEEIACDSKIAEETQIVVAREEQQALKKAHECQTIRDDAQRDLDEALPALYESLEALKSLNKNDITEVRAMMRPPEGVRLVIEAVCIMKDVKPKKVAGDKPGVKIDDYWEPGKIMLQDPGKFLDSLMNYDKENIPEYIIHKIKPYIESESFSPATIAKVSKACTSICLWVRAMFKYYNVAKTVEPKRQALQSSELELAETEQVLNEARNRLKACEDRITSLQIKYNECIRKQHELEEKSQLCEARLIRADKLIGGLGSEKIRWNESVGNLNYLLTNLVGNVLCSSGSVAYFGPFSAKYRLNMINEWVDKLKYHRVPHTTEPAPNLVQTYGDPVKLRNWHILGLPKDVLSIENAVIVQFSRRWPLFIDPQGQANKWIKALGQQDGIIIIKLSDKDFIRNLENALRFGKPCLLENVGEELDPVLESVLLKQTFKQQGATVIKLGDAIIPYHNDFKLYITTKLSNPHYKPEVSTKVTVVNFTLSPSGLEDQLLGIVVAEERPDLEEAKNQLIISNAKMKQELKEIEDKILERLSATEGSPVDDVDLIQTLEASKLKSSEIKSRVIAAEQTERDIDETRSKYIPVAVRTQILFFCVADLANIDPMYQYSLEWFVNIFLQGITNAERADFVPQRVENINDYFTFSLYCNVCRSLFEKHKLMFAFLLAIRILQNEGLIDSSEYRFLLAGGTHKIKELPNPAPEWISDRIWGDVLNLASLPKFTNLPESMTQN-PDGFKQIFDSSDPHRTVFPEPWQTNLDNFQRILILRCLRTDKLTNAMQDFVSQHLGQKFVEPQTANLHQVFKDSSPSTPLIFVLSQGTDPASDLYKFADEMSFGGKKLSAISLGQGQGPRAEELMRTAIERGVWVFFQNCHLAPSWMPTLERLVEQIDKDKVHRDFRLWLTSMPSPDFPVYILQNGSKMTVEPPKGLKANLLRTYQSINDAYL---ANNDVFRHLFLSLAFFHGVLIERKKFGPLGFNIPYEFTTGDLRICMDQLIMFLDEYDITPYKVLCYTAGHINYGGRITDDWDRRCAMSILHEYYCPKVLGDNYSYSVSGIYHQLPGNTDHAVYLDYIRSLPINDPPEIFGLHENANITFAQNETFTLLGYLLLLQPKTSSTSGHGKQREEIVEEISRSLLTTCPQLFDLSSVIHKYPVMYEQSMNTVLTQEVIRYNNLLSTIQTTLNDLMKALKGFVVMSANLEEMARSLFDNRVPTMWASKAYPSLKPLAAWIEDLVMRVKFIQEWIDHGVPSVFWISGFFFPQAFLTGTLQNYARKKVISVDTISFDFKVMKENNEKLNKSPNDGSYIRGLYLEGAGWDSTLNLLCESRPKELFVNMPVIWLIPTENRKSPSQGIYECPVYKTLTRAGTLSTTGHSTNFVFSIEIPTDQQQKHWVQRGVA 4172          
BLAST of Dynein heavy chain axonemal vs. Ensembl Cavefish
Match: dnah12 (dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:ZDB-GENE-090311-9])

HSP 1 Score: 3026.88 bits (7846), Expect = 0.000e+0
Identity = 1650/3790 (43.54%), Postives = 2335/3790 (61.61%), Query Frame = 2
Query: 1610 TKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIP--------MESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTI-PDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQV-ADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVA---------------------------IEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEK---IVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETR--DLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRER--VQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFP-----------EEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYII-KPDMKYSDIIVPTIDNVRLISISEQLLISK--KPVMCVGPTGTGKTLSISDKLTKYMPPE-YISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRA--VAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVK--------IEPLLYGDFMSVAIE--NKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDM---KPIVQ--DLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDK-PGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEP-YIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFS--KFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKF-SKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTS--FSDDFLNSIAKNTE--WRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVM-TEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQ-PKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            T  KL  F       + + ++ +   S+  FVN+ +                       L   K P+F ++L  +     +           + +F      +Q V  ++ ++    S  +N ++++       V  +R     TLK A+           ++Y+  Y+  +N   QD+ E   +F++    + H+  +    +EK       +  L P         ++ E ++QGLAKK +  A  +L+ L    R+   + CE F+TI +K  ++P T E++ E+  +I       L+E    I +    +  +   +   S +D      MV WP  I   I  +   LLE  ++  + ++         KL+ L   +      +++    +   E++ + K L E + +    N  E L+    T Y ++  + ++ EP++ ++  V  W +     M+   + ++ E +E  + EF++ ++K +K F +     E   + +VA                           I+EFK  IP++  L NPG+RARHWE +S+ +   + P S  T  K L+  L  ++E    I+  A KE+++E+AL  M   W+ + F   +++ +G  IL   DEI  +LDD IV TQ+M  SP+ KPFE+ I  WE  L   QD IDEWL+ Q QWLYLEPIFSS+DI +Q+P EG+ + T+D+ WR++M+    +P V+       LL  L+E N LLEQ+ KGL+ YLE KR  FPRF+FLS+DE+LEILS+TKDP  VQPHL+KCFE IAKL F  +L+I AM+S EGE+   I    ++   G VE+W++++E++M  S+R +I +  + Y +  R++WV +WPGQVV+   Q YWTQEV +A+ +    LK  Y +L  QL  +  +VRG + K  R TL AL+ I+VHARDVV  MI + + +  DF+W++QLRYYW  +N+++  +N +  Y YEYLGN+ RLVITPLTDRCY TL GA +L  GGAP GPAGTGKTETTKDL KA A+QCVVFNCSD LD++AMGKFFKGLAS+GAWACFDEFNRI++EVLSVVAQQI  IQ+A + +L+ F FEG EL L P+C V ITMNPGYAGR+ELPDNLK LFR VAMMVP+YALIAEISL+S+GF +A+ LS KIV T++L SEQLSSQ HYD+GMRAVK+V+ AAGNLK +    +E+++ LR+I+DVN PKFL  D+ LFNGI SDLFP I     DY   L   Q   +K  ++ V  F+DK IQ +E  +VRHG MLVG   +GKTK   VL   L+ + ++   D    + V    +NPKSITMGQL+G+FD ++HEWTDGI++   R+  +A  PD++W +FDGP+D +WIE+MNTVLDDNKKLCL SGEII++  +M+++FE  DL+ ASPATVSRCGM+Y+EPS LG  P V  W+ +LP  +        + +LF+  +   +  +R N RE+V TTN     ++ +L +  +   V                   +  N+N++                            + + F FSL+WS G SCD DSR++FD +LR  +S +L   P P           ++GLVYDY ++  G                   K  W+HW  ++    +   + K  DIIVPTID +     +  ++     +P++ VGPTGTGK++ + +KL   +  E Y+  FI FSA+T+ANQ+Q++I ++LDKRRKGVFGPPMGK  I F+DD+NMPA+EVFG+QPPIEL+RQ+ D   WYD K   +  +LVD+  I +MGPPGGGRN +T R +RHFN+   N   +D+M  +F  ++ F++       +   +   +V A ++VY      +LPTPAKSHYTFNLRD S+V QG L+L+ ESL +   ++RL+ HE  RVF DRLV+DQDR+W   L+   +   F + ++ V +        +  LL+GD+M+  +E   + Y E    +   +V+E  L ++NQ +  +MNLV+F   + H+ RI+R+++QP GNALL+G+GGSGRQS+T+LA  MA+   FQ E+SKNYG+ EWR+DLK ++  AG++ +  VFL +D QIK+E+FLED++++LN+G+VPNL++ D+ + I   M   +PI Q  +  L+ +   LF+ +  R R NLH V+  SPIG+ FR RLRQFP+L+NCCTI+WF  WP+EALE VA KFL     LE+S+   + +M +CK  H S  + SEK+  EL R+NYVTPTSYLEL+  F  +   K+  +  A+ R  NGLDKL + E  V ++++EL  ++P+LEQA  ++    + IE +S   +    VV  EE  A++KA E + ++++ + DL EA+PAL+ +L +L  L  +D+T V++M  PP GV+LV+  VC+MKD+KP+KI      G KI DYW   K LL D   FL  L  YDKDNI   V+ KI   Y+ +  F P  + K S A   +C+W+ AM  Y  VAK VAPK+  L  + + L  T  +L + RA+LK VEDR+  L++ LE     Q +L+ + DLC  +L RA+KLIGGL  EK RW  +  +L+   +N+ G+VLISAG +AYLG FT  +R +   EW+   K+  +P +D    +L  T GDP+KIR W I GLP D+ SI+N VIV  SRRWPL IDPQGQAN+W+KN ++EN L+VIKL+D D++R+LEN I+FG P L+ENVGEELDP+LEP+LLKQ FKQ G   I+LG+++I +  DFRFYITTKL NPHY PE++TKV+++NF ++P GLEDQLLG+VVA+ERP+LE+ +N LI+ +A  +++LKEIEDKIL  L  +EG+ ++D   IQ L+++K+ SNEI  K  IAE+TE  I E+R  Y P+A  + ILFF +ADLA IDPMYQYSL WF+N++ N I ++ K+  L +R+  + N+FT++LY NVCRSLFEK KLLFSFLL + +L  + +I+ AE+ FLL GG     ++PNP P W+ D+ W+EI   + LP     ++P  F H     F  I+DS EP+   LP  WCD    FQ +++ RCLR DK+  A+ +++   LG++F+EP   DL+  Y DS+ T PL+FVLSPG DP + L KFA+D         +ISLGQGQGP A ++I++AM+ G WV  QNCHLA SWM +LE++ E    +  H DFRLWLTS PSP FPV ILQNG KMT EPP G++ NLL+SY S   SD    S   N E  W  LL  +C FH ++ ERKKFGPLG+NIPY F + DLRI I QL +F+  Y +VPF+ + Y  G  NYGGRVTDDWDRR ++ +L+ FYN  ++    Y++S SG Y    P + +  Y+ +IR+LP    PE+FG+H+N +I+  + +T  L D L+  Q            +  + +++ +I   +PE FNI+    ++PV+YE+SMNTVL+QE+ RYN L N I+ SL++LLKAI+GLVVM   LE+++ SL   KVP+ WA ++YPSLKPL S++ D   R+ F+Q W D   P VFW+SGFFF QAFLTG +QN+ARK  I ID +SF ++V+   +      P DG Y+ GLFL+GARWD     L E  PK LF  +P+IW+ P   +      +  C    T  R GTLSTTGHSTNFV SI +PT K  +HWIKRGVA
Sbjct:  228 TTEKLDAFYNCASTLLSNQLKAVVERSVVAFVNLFD----------------------PLSTHKLPLFRMNLTFEEEKMDFYPSFQDMEEAVLEIFTSISNTMQKVQTVQSWL----SETNNSVIDA-----KLVDHVRAWAETTLKNAVWKNLEAPNQHFQNYSNNYDWLVNRTAQDLVE---KFIQ----EEHSFDQYTQVIEKFQALSREISSL-PSVAHFDMIRLDCEELKQGLAKKAETFAQILLEQLINTQRQQCLEICEEFETIQKKAMKKPETTEDMIEMIAYISHARTKGLEELHSKIMETHQRFTYLLHVH-TFSAEDLELNSKMVLWPQNIN-PIFDLNNELLEQAKQKGEQELQGKREKLMLKLEKLGRRMEEFAECSELDMMQQYVTEIKTVQKWLQEVEDSISFINKEEALYKWDQTVYPEIDVMKENIEPYQKVFGLVLKWQRTEKRWMDGSFLDLNGESMEAELDEFFREIYKMLKSFQQKQKKAEQGRERQVAMKRRPGEGDDDHLESPTALMCIKVIEQIKEFKEHIPMVSILCNPGIRARHWEQMSEIVNHDLTPNSGTTLRKVLKQNLSAYMEHFETISAAASKEFSLEKALQNMVETWDIISFSHHAHRESGVSILTAVDEIQTMLDDQIVKTQTMRGSPFIKPFEKEIKAWEERLIRIQDTIDEWLKVQAQWLYLEPIFSSQDIMQQMPEEGQLFQTVDKHWREVMRHCVKDPKVLPATSLTGLLEKLQESNNLLEQIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLDFLPNLDIQAMYSSEGERVELIQLISTSEARGAVEKWLVQVEDVMLSSIRDVINRSRLAYPETKRSQWVREWPGQVVLCTSQMYWTQEVHEAIRSGVGGLKNYYNQLQSQLKDIVELVRGKLPKQTRTTLGALVTIDVHARDVVMEMIEKGVSHETDFQWLAQLRYYWNNDNVRVCIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIEMKLEFFDFEGTELRLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKFPDENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGISLPAADYQLFLDCAQECCKKHNVQPVKVFLDKMIQTYEMMIVRHGFMLVGEPFAGKTKVLHVLADTLTLMNERGYNDE---EKVQYRTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREYASAETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSNQMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWLPLVTSWLNTLPQPLQTQENSTLLLELFNWLIPPALRMLRKNCREVVSTTNSNTVVSLTRLFEMLLTEPVTE-----------------EPGNKNIRT--------------------------WIMAAFAFSLVWSIGGSCDRDSRERFDQFLREILSGKLEEHPIPAAVSKWECPFNDKGLVYDYSYEFKG-------------------KGCWIHWNESIKNVTLGDKNTKVQDIIVPTIDTIFCTLFTTLIIFFSPFRPLLFVGPTGTGKSVYVKEKLMNNLNKERYLPFFINFSARTSANQSQNIIMARLDKRRKGVFGPPMGKKCIIFVDDMNMPAMEVFGAQPPIELLRQYFDHGNWYDLKDTSKI-TLVDVQLISAMGPPGGGRNAVTPRFLRHFNICSMNAFSDDTMSRIFSNVVAFYLRNNDFPNDCFSIGNQIVAATLEVYKKAMENLLPTPAKSHYTFNLRDFSRVVQGCLLLKKESLENKRTMIRLFVHEVFRVFYDRLVDDQDRDWLYKLMKNIVKEHFKESFDTVFEHLKLCEEDMRSLLFGDYMTPDVEASERLYAEVPSMESFSQVVESYLTEYNQTHKNRMNLVIFRYVLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATFMADMTLFQPEISKNYGMNEWREDLKLLLKKAGVKGQKTVFLLTDAQIKEEAFLEDVDSVLNTGEVPNLFAVDEKQEIMEVMHAVRPIAQAGNKSLEFSPLALFAFFVNRCRENLHVVVAFSPIGDAFRNRLRQFPSLINCCTINWFQPWPEEALERVANKFLET---LEMSDHERQEVMLICKTFHTSAIHLSEKFLSELGRHNYVTPTSYLELIAAFRLLLTNKRDTVMNAKKRYTNGLDKLAFAESQVGEMKKELVDLQPKLEQAKIDNIKMVQVIEVESVQVEAKSKVVRVEEEAASQKAAEAQALKNECESDLAEAIPALEAALSALDTLKPSDVTIVKSMKNPPSGVKLVMAAVCVMKDIKPEKINDPAGTGQKILDYWGPSKKLLGD-MNFLRDLKVYDKDNIPAPVMHKIRSEYMTNPDFDPTKVAKASSAAEGLCKWITAMEVYDRVAKVVAPKKANLIVAQQSLAATMALLNQKRAELKEVEDRLAALKKTLEEKTEEQAQLQFQVDLCARKLERAEKLIGGLGGEKTRWSKAADDLQNTYDNLTGDVLISAGVIAYLGAFTAGFRQNCTKEWTKLCKSKNIPSSDD--FSLSKTLGDPIKIRAWNISGLPTDSFSIDNGVIVSNSRRWPLMIDPQGQANKWVKNSERENNLNVIKLTDADYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQIFKQGGMDCIRLGESVIEFSSDFRFYITTKLRNPHYLPELATKVSLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDKILETLQSSEGNILEDESAIQILDSAKIMSNEISKKQQIAEKTELKIAESREGYRPIAKHSSILFFSIADLANIDPMYQYSLNWFVNLYINSIQDSNKSKILEKRLRYLINHFTYNLYCNVCRSLFEKDKLLFSFLLCSNLLLAKKEIEYAEFMFLLTGGVGLQNNVPNPDPNWLQDKSWDEICRASDLPGLQGLRYP-PFCH-----FLPIYDSKEPYNTPLPKPWCDKLSDFQKMIIYRCLRPDKIEPAISNYITGKLGKKFVEPPPFDLSKSYNDSNSTIPLVFVLSPGADPMASLLKFANDKNMGGANFKSISLGQGQGPIAVKMIQSAMKEGTWVCLQNCHLAVSWMSTLEKICEDFSPETCHPDFRLWLTSYPSPMFPVTILQNGVKMTNEPPTGLRLNLLQSYLSDPVSDPQFFSACSNKELVWEKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFVNSYEEVPFEAITYLTGECNYGGRVTDDWDRRLLLTILADFYNKDIIENPRYMFSPSGKYYS-PPKSIYEDYVEFIRNLPATQHPEVFGMHENVDISKDLQQTKLLFDSLILTQGGGSKGGASSGGDSTLMDIANDIRTKLPENFNIDSALNKFPVLYEESMNTVLVQEMERYNNLCNTIRVSLQNLLKAIKGLVVMDAELEAIAGSLLVGKVPEKWAKRSYPSLKPLGSYITDFLTRLKFLQDWYDTTKPNVFWLSGFFFTQAFLTGAMQNYARKYSIPIDLLSFDYEVL--PFDTSATSPEDGVYVHGLFLDGARWDKKSGVLAEQHPKVLFDSVPIIWIKP---KHCCTFLLLSC----TSERKGTLSTTGHSTNFVISIMLPTSKRPQHWIKRGVA 3888          
BLAST of Dynein heavy chain axonemal vs. Ensembl Cavefish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 2553.86 bits (6618), Expect = 0.000e+0
Identity = 1402/3472 (40.38%), Postives = 2033/3472 (58.55%), Query Frame = 2
Query: 2399 TRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQ-EVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKST-LTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEK----DLEITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIP--RTEWVLKWPGQVVIAGCQTYWTQEVSDAL----ETRD---LKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEE--NLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKP-DMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVV--KIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQI-NTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHE-WSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSV--KAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMS----TAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYE--QSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPV-FWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDK-DQKHWIKRGVA 12718
              +L + P T+ EL E  + + T+   L++ +  I      + ++E++  ++  +  +    + G     +  +I  +  L + +++F+         F +K+        S   +     +     ++  +  QL   +       +   +F       + +  L KD +    +W     W    D        ++ +E +E +    YK ++K   +  EL   Q E+    K  IE+FK  IP+I  LR+P MR RHW  +  E+  S    S   T  K + + L+ H E I +I+  A KE +IEQ+L  ++  WE    ++  YK+ GT      +E+ Q L+D+ V   +M  S + + FE+ + +WE  L    +VI+  L  QRQW+YLE IF  EDI +QLP E   +  ++  W+ IM     + + +       LL  L E N  LE++QK L  YLETKRQ FPRFYFLS+D+LLEIL Q+++P AVQPHL+KCF+NI  L+  K      E   MFS +GE + F       G VE W+ ++E  MR +L+  +       K++   R +WV  WPGQ++I   Q  WT +V+  L    E+ D   LK +  K +  L      +RG+++KI R+ + AL+ +EVHARDV++ +      ++N F+W+ QLR YW ++  +  IR  N  F YGYEYLGN+ RLVITPLTDRCY+TLT ALHL  GG+P GPAGTGKTET KDLGK   +  +V NCSD LD+ +MG+ + GLA  GAW CFDEFNRI+IEVLSVVAQQI +I  A    L  F+FEG ++ L  SC +FITMNPGYAGRTELPDNLK++FRP++M+VPD  LIAEI+LF  GF++ + L+KK+ T + L+ +QLS QDHYDFG+RA+ S++  AG  +R    + +E I L +++D+N+ K    DL LFNGI+ DLFP ++   IDYG L  +I+    + GL+     V K IQL+ET   RH  M+VG TGS K+  +++LQ ALS++  +  P    F  VH Y LNPK++++G+LYGE+DL T+EWTDG+LS+L+R       PD++W +FDGPVD +WIE+MN+V+DDNK L L +GE I + E+++++FEV DLAVASPATVSRCGMVY + S LG  P+V+ WI         H   +++LFD Y+++T+ F R + +E+VP T      ++ +L DS   P                                        N AD          G  VE WF+FSLIWS  AS D D RKK D +LR    T      FP +  +Y+Y  D                     +   W  +   +P+    P +  +  I+VPT+D VR   +   L+  + PV+  GP GTGKT      L    P ++    I  S++TT+N  Q +I+S+++KR KG + P  GK ++ F+DDLNMPA++ FGSQPP+EL+R W D+  WYDR+        +D+  + SMGPPGGGR  I+ RL   FNL+      E  +K +FGT++   +     E+ P+   L +A +++Y AI ++ LPTPAK HY FNLRD+SKVFQG+L    +   +   + RLW HE  RVF DRLV+  D E F  LL  KL S F+  Y ++   K +P+ +GDF+    E   Y + +++  +   +E  LED+N       M+LVLF DA+ HV R+ R+I QP GN LL+G+GGSGRQSL++LAA++ EY  FQ+E++K Y   E+R+D+K++    G++NKP VFLF+DTQI DESFLED+NNIL+SG+VPNLY  D+ E +   +    +   +  T   +F+   +RVR NLH V+ MSP+GE FR R+RQ+PALVNC T+DWFS+WPQ+AL  VA ++L+ +  L   E++   +  +   +HQSV+ +S++ + EL R+NYVTPT+YLEL+  + K+ A K+ EL +   + +NGL K+  T   V+ +  ELE  K ++ +  ++ +     I +    A E Q+ V+        +  +C+ + ++AQRDLDEALPAL+E++++L+ LNK D+TE+++  RPP  V  V++ V I++  +P               W   K  L +   F+  L ++DKDNISD V++KI  Y     F P  I +VS A  S+C WVRAM  Y  + + V PKR  L  +  +L + +  L EA  K + VE+++  L+ + +    ++++L  KS+  E +L RA KL+ GL+ E++RW+ +V +LE  +  +VG+ L++A +++Y+G F   YR  +    W    +   VP +  P  N       P  +R+W I GLP D  S EN VIV    RWPL +DPQGQA +WIKN++ + GL VI L   DFLR LENA++FG P L++NV EELDP+L PIL K      G V++KLGD  + Y+ DF+FYITTKL NPHYTPE+STK TIVNF +   GLE QLLG+VV  ERP+LE+ K+ L+++ A  +++L+E+ED+IL  L+ A GS +DD+ L+ TL+ SK+ + E+  ++  +EQTE  ID  R  Y P A R  ILFF + D+ +IDPMYQ+SL+ ++++F   I  + ++  L ERI N+N+Y T+++Y   CR LFE+HKLLFSF +  +IL+  GK+++ E+ F L GG V  K   + NP   W++D  W+ I  L  L  F      F  KY  D+ + + S EP    LPGEW  +C+  Q +L++R LR D+V+  +  F+ + LG RF+EP   D+  V +DS+  TPLIFVLSPG DP   L + A+         A+SLGQGQ P A  +IK  ++ G WVF  NCHL+ SWMP L++LVEQ+  +  H DFRLWL+S P P+FP+ ILQ G KMT EPP+G+K+N+ + Y   ++   +  ++   +R LL SLC FH +L+ERKKF  LG+NI Y F D D  +  N + ++L EY ++P+  L+Y    +NYGG VTDDWDRR +   ++ ++    +   +    S     I        Y  YIR LP  + PE+FG H NA+I   I+ET  L D LL LQP+++    T  G SRE+ V E+S ++ Q +PE+ + E   K   ++ +    +N VL+QE+ RYN LL+ I++SL +L K I+GLVVMS +LE M   ++D +VP  W  KAYPSLKPLASW  DL QR+     W +   PPV FW+SGF FP  FLT  LQ+ AR+  +S+DT+S+ F V       +   P DG +IRGL+LEGA WD     L E+ P +L   MP I   P  NR      +Y CP Y    R+G         +FV  +++ +     +HWIKRG A
Sbjct: 1049 AHRLSQPPQTLVELVEGLKLLETLQGDLNKIESQIPPIHEQFAILEKYEVSVEREVQDLLEALNGEWQGFQQVVIDSDIMLKKHKDKFKSGLFFSAEEFKKKMQTTMQDFNSTGPFGSNVSSEAALEQISVLRAQLESLKEEEGTIRHGLSIFKTEQPTSKDMQNLEKDIDYLLQVWEISQQWDTHWDEWKAGQFASLQTENMESTAQTMYKNLNK---LSRELKDKQWEIVEFSKNRIEQFKRTIPMILDLRDPAMRDRHWNQIKQEMQRSFDHNSAEFTLEKIVALGLEQHAERICEISGAARKELSIEQSLEGIAKTWEETSLDIAPYKDKGT------EEVFQALEDNQVTLSTMKASRFVRAFEKEVDRWERCLSLVLEVIEMILTVQRQWMYLEIIFLGEDIRKQLPHESTEFDDINSSWKTIMDRLNKDNNALRGTHHPGLLEKLSEMNSKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPDAVQPHLKKCFDNIKSLRINKVRNNKSEAAGMFSADGEFVEFTHPVLLEGPVEAWLCDVERTMRWTLKDTLRNCRTALKKMTGKRDKWVKDWPGQMLITASQIQWTTDVTKCLITGKESADKSALKSMKKKQVSMLHRYSDAIRGNLSKILRLKIVALVTVEVHARDVIDKLAKAGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKGLGMYVIVVNCSDGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLTNFIFEGRDICLVSSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFGEGFNNCKVLAKKVFTLYCLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRVRPDIADEEILLMSMKDMNIAKLTSTDLPLFNGIIQDLFPAVETPTIDYGKLKETIEEELHQSGLQVTPFTVTKVIQLYETKNSRHSSMIVGKTGSSKSVTWQILQKALSAMHRKGEPG---FNLVHEYPLNPKAVSLGELYGEYDLSTNEWTDGVLSSLMRIACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAVASPATVSRCGMVYNDYSDLGWKPYVQSWIDKRQKMEVDH---LKRLFDRYIKKTISFKRTHCKELVPITELNGVISLCRLYDSLASP------------------------------------ENGVNPADN------ENYGRMVELWFIFSLIWSICASVDEDGRKKIDNFLREMEGT------FPNKDTIYEYYVD--------------------TKNKTWASFEDKLPKGWRYPSNAPFYKIMVPTVDTVRYHFLVNSLVCGQYPVLLTGPVGTGKTSVAQSVLQGLDPAKWTMLTINMSSQTTSNNVQAIIESRVEKRTKGTYVPVGGKKMLAFLDDLNMPAVDDFGSQPPLELLRLWIDYGFWYDRQM------KMDMFLLASMGPPGGGRTHISGRLQSRFNLINMTFPAESQIKHIFGTMINQKLQEFQEEVKPIGSILTQATLELYYAISARFLPTPAKIHYLFNLRDISKVFQGLLRSHRDFHDTKQSITRLWIHECFRVFSDRLVDQADTEAFVALLAEKLGSLFDLTYHNICPNKQQPI-FGDFLK---EPHVYEDLLDFKALKGFMESQLEDYNLTPGVVPMSLVLFRDAIEHVTRVVRVISQPRGNMLLVGIGGSGRQSLSRLAAYICEYMVFQVEVTKQYRKQEFREDIKKLYRLTGVDNKPTVFLFNDTQIIDESFLEDINNILSSGEVPNLYKSDEFEEVQSALSDSARKENVLETADAMFNYLIERVRNNLHIVLCMSPVGEPFRNRIRQYPALVNCTTLDWFSEWPQDALLEVAERYLDGLI-LGNVEKIQTKVARIFVTMHQSVAQFSQRMKLELKRHNYVTPTNYLELVSGYKKLLAEKRAELGEQVSKLRNGLFKIDDTRSKVEAMSVELEDAKKKVAEIQKQCEEYLVVIVQQKREADEQQMAVSAHSEKIGAEEIKCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMILRGCEPT--------------WAEAKRQLGE-SNFIKQLVHFDKDNISDRVLKKIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKRARLHGAMTQLAEKQAALAEAENKRREVEEKLKQLKNQYDEKLNQKEDLRKKSEDMELKLDRAGKLVSGLAGERVRWEQTVESLEKDMGYLVGDCLLAAAFLSYMGPFLSNYREELLTNIWMKQFRDLEVPCS--PGFNFATFLSKPTAVRDWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMESKRGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSFTHIGGRVLLKLGDKEVEYNPDFQFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVSDQLETSEQTEIKIDTAREAYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNLSIEKSQRSHKLEERIINLNDYHTYAVYRYTCRGLFERHKLLFSFHMCAKILEVAGKLNMDEYSFFLRGGLVLDKEGQMDNPCTSWLADSNWDNITELDKLANFHGLMSSF-EKYPKDWHQWYTSSEPENAPLPGEWETVCNELQKMLIVRSLRQDRVSFCVNSFIINNLGSRFVEPPVLDMKAVMEDSTTKTPLIFVLSPGVDPTGALVQLAEASGMGPSFHALSLGQGQAPIATRMIKEGVKNGHWVFLANCHLSLSWMPQLDKLVEQLQVEDSHPDFRLWLSSSPHPEFPIAILQAGIKMTTEPPKGVKSNMKRLYQLVTESQFSRCSRPVVYRKLLFSLCFFHSILLERKKFLQLGWNIVYSFNDSDFEVSENLMSLYLDEYEEIPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCEGAVNTPFFKLSSLPTYYIPRDGSQDTYREYIRQLPPVEHPEVFGQHPNADIASQISETRTLFDTLLSLQPQVTSTTATGAGPSREDKVLEISADVRQKVPELVDYESTQK---LLQDDPSPLNVVLLQEIQRYNALLHTIRTSLTELEKGIKGLVVMSSSLEEMFQCIHDARVPPLW-EKAYPSLKPLASWTRDLCQRVEQFAHWAETAHPPVLFWLSGFTFPTGFLTAVLQSSARQHNVSVDTLSWEFIVSTVDDNNLLFPPKDGVFIRGLYLEGAGWDKKNSCLVEAEPMQLVCPMPTIHFRPVENRKKVAKNMYSCPCYYFPVRSG----GAGRPSFVVGVDLKSGAVSYEHWIKRGTA 4400          
BLAST of Dynein heavy chain axonemal vs. Ensembl Cavefish
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 2017.66 bits (5226), Expect = 0.000e+0
Identity = 1228/3575 (34.35%), Postives = 1969/3575 (55.08%), Query Frame = 2
Query: 2237 IPQYIIIGPFYINTENVR---QGLAKKRKAMANAILDLLARELRKSADQACEAFKT----ITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKL----DNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLW----IAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSY-KNTG--TYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLE----ITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQI-PRTEWVLKWPGQVVIAGCQTYWTQEVSDAL------ETRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIE--ENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQ-GVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFM---------RHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIF-----LPFPEE-----GLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELHPLEETLVKAC-------IDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLYGDFMSVAIEN--KKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSE-EVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHE-WSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGG-SVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEF------IHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKF-SKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTD-----VPFKVLQYTAGHINYGGRVTDDWDRRCV---MNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMS-TAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRY-PVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVM-VKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            I Q +   P   +   VR   + LA   +    A +  L R L  SA +   A ++    ++  L + P+T+E+L  +   I  I DM  + +         Y  +  +   +  ++      +      +     QV+++L   ++ F ++    +  + +++    ++  M     V  N + K       +R   ++L + +A        E+LF+ P+T Y +L  + ++    R ++     A ++W +          + ++ +++++    F K++ K  K    +P    + G++K    EFK  +PL+  L+N  +R R+                   F  C  + L     +I              Q + ++   WE +KF V  Y K T    YIL   DEI Q LDD+ V  QSM  S +  PF   I +WE  L    +VI+ W+  QR+W+YLE IF   DI  QLP E K++  +D+M++KIM     +P +   C     L++L+  +  LE+ QK L++YL++KR +FPRF+F+SDDELL IL  + +P  VQ H+ K ++NIA L+F+          A+ S EGE +  ++     G VE+WM  +   MR + R+I  + +  Y Q   R +W+L + G VV+AG Q +WT EV D        E + +K    K+ +Q+D L   +   + K  R  L+ +++I+VHARD+V++ + ++I +  +FEW SQLR+YW +  ++L +R  +AEF YGYEY+G   RLVITPLTDR YLTLT AL +  GGAPAGPAGTGKTE+TKDL KA  + CVV NC + +D+MA+GK F GLA  GAW CFDEFNRID  VLSV++ QI TI+ A   +L RF FEG E+ L     +FITMNPGYAGRTELP+++KALFRPV ++VPD   I EI LFS GF  A+ L+KK+   +KL+ EQLS Q HYDFG+RA+KSV+  AG LKR +  ++E+++ +RA++D+N+PKF+ +D+ LF G++SDLFP +    + Y +   +++T   +     +   VDK +Q++ET + RH  M+VGPTG GK+     L  A + L                Y LNPK++++ +LYG  D +T +WTDGILS + R      +  ++R+ +FDG VDA+W+ENMN+V+DDNK L L++GE I+L     ++FEV DL  ASPATVSRCGMV+++P  L  AP+ + W+ S P      +  ++KLF+ Y+   ++ +            L+ IVP T+  +   +  ++D+ + P    DLS                                                E +E +F+ +L  S GA+     RKKFD  L +K+S  +       L  P E       ++D+ FD  GT                    KW+ W + V +YI  PD K+ DI+VPT+D  R+  + EQ++  K+PV+ VG +GT KT +  + L    P   +   I FS++TT+   Q  +++ ++KR K  +GPPMGK ++ F+DDLNMP ++ +G+Q PI L++   D  G YDR      + L D+ FI +MG  GGGRN +  R +  F++      +E+++  ++ +ILK           P EE +   C       +++Y  I   + PTP+K HY FNLRDLS+V+ G+ +   E   +  Q +R+W +E  RVF DRL+N+ D+   +  +   +   F  + +  ++ +P+L+GD+ +   E+  + Y +  +YD    + +E LE++N+ N  +MNLVLF DA+ H+ R+ RIIR   G+ALL+G+GGSG+QSLTKLAA  A  D F+I LS+ Y  + +R+DLK + +  G+ENK  VFLF+D  + +E FLE +NN+L SG VP L+  D+ E +   ++     +G   +K +++  +  +   NLH V+ MSP+G++ R R R FP LVN   IDWF  WP +AL +VA  FL + P +  +  E + G + M   +H SV  +S  ++Q+L R NYVTP +YL+ +  +S +   K Q +     R + GLDKL      +  L ++L   K  L +     ++  +EI  ++ +A+E + +   +     ++ K   + + DA+  L EALPAL+ +  +L+ L+K+D+TE+R+  +PP+ V++V E + +M+  K             +  W   KG++ +   FL SL   D D+IS   ++ +  ++ + + +   ++ +S+A + + ++V A+  Y  VA+ + PKRE + R  K   Q+K+ L++ +++L+A++  +  L EK  A    ++ L+ ++ L E RL  ADKLI GL +E  RW + +  L+     ++G+ LISA +++Y G F  ++RN M +E W   +   G+P +      +     D V+I  W  + LP D LS++N ++   + R+P+ IDPQ QA  WIK  +++N L +   +D DFL+ LE AI++G P L ++V E +DP ++ +L K     +G  VI LGD  + Y  +F+ Y+ TKL NP Y+P V  K  ++N+T++  GLEDQLL ++V  ER +LE+ + +LI   ++ ++ LK++ED +L  L+ + G+ +D+++L+ TLE +K K+ E+  K+ +AE T  DID+ R  Y P A R  ILFF +A++A ++ MYQYSL  FL +F   +  +     L +R+ NI N  T ++Y+  C  LFE+HKLLFSF +  +I Q EG+    E  F L G  S++      P  +W+ D+ W +I+ L  L     FP EF      I K   ++K  FD   P +   P ++ D    FQ LL+LRC R+D+V  A+ D+V   +GE++++P       +++ S+P +P++F+LSPG +PA+DL K A+   F + +L  +++GQGQ   A +L++ A+ RG+W+  QNCHL   W+  LE+ +E+I K   H DFRLWLT+ P   FP+ ILQ   K+  EPP G+K N+  +Y     + L S   +  +R L+  L  FH V+ ER+K+G +G+N+PY+F + D  +C+  L  +LT+  +     +P+  L+Y  G + YGGR  D +DRR +   M+   G +        + +    +  +I P      Y+  I SLP+ +TPE+FGLH NA I +      ++   L++LQP+   + GG SR+E + +V+++I   +P  F+++ I K+  P +   S+  VL+QE+ R+NRL+  +  SL +L +A+ G V MS  L+ ++ +L++ ++P  W   A  +LK L +W+I   +R     +W++ G P V W+SG   P+++LT  +Q   R+    +D  +    V   ++  E+TE P  GCY+ GL+LEGA WD+ +  L  S+PKEL  ++P++ +IP     +        PVY T  R   +         VF  ++ T +   HW+ +GV 
Sbjct:  935 IGQEVAQQPLVKDVHVVRLDLEPLAHTVQENVQAWVSSLGRLLNDSAREDLYALRSELQQLSENLKKSPDTLEDLKFVLSTISNIRDMSVDVELRFRDIQERYRTLTMYNIQVPEEELQLAANIRNMWSDLFSESRQVDRSLGRAKKTFTEITKEQIVQYKQEVAIFAESFNMHGPGAVGDN-LDKGR-----LRYCSEELAKIEAGRQDLVGAEKLFDLPITTYPELLNVQREMRALRQIYEVYKAAKTEWSQTL-------WVNLNIQLLQEGTEGFIKSLRKLPKDVRAMPVAFFLEGRMK----EFKESLPLLLDLKNEALRDRY------------------LFLHCYRLYLLKDWSLIGS-----------PQGVKEVVDTWEVMKFSVQRYFKGTQERGYILGSVDEIQQNLDDNAVNLQSMAGSRFIGPFLNVIQQWEKNLSLISEVIEVWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDHIDKMFKKIMSDTVRDPGIKRCCLVPNRLSDLQNLSDGLERCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSS-EPACVQEHMIKMYDNIASLRFDSGTNGETVAGALVSAEGEVMELKQPVPAEGRVEDWMTAVLLEMRRTNRLITKEAIFYYCQKKSRVDWMLDYQGMVVLAGNQVWWTWEVEDVFQKMSSGEKQAMKQYAKKMHQQIDNLVRRITQPLKKNDRRKLNTVLIIDVHARDIVDSFVRDSITDAGEFEWESQLRFYWDKKPDDLFVRQCSAEFSYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTESTKDLAKALGLLCVVTNCGEGMDYMAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALILQLKRFQFEGQEISLDSRMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLLAKVLAKKMTVLYKLAREQLSKQSHYDFGLRALKSVLVMAGELKRGSPDLNEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPNFNDAVETILEENKYSLLPNQVDKVVQMYETMMTRHTTMVVGPTGGGKSVVINTLCQAQTRLG----------LLTKMYALNPKAMSVIELYGILDPVTRDWTDGILSNIFRDINRPTDKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPYWQKWVNSRPPK---EQADLRKLFEKYVPSIIEMVVEGITDGKQGEKLKTIVPQTDLNMVVQLSMMLDALLEP---EDLS-----------------------------------------------SEELECFFIEALYCSLGAALLETGRKKFDD-LVKKLSCLVSVQDEKTLAGPGEIPGYLPTLFDFHFD--GT------------------TKKWMPWSSLVAKYIHNPDTKFIDILVPTVDTTRVNWLLEQMVKVKRPVVLVGESGTSKTATTQNFLNNLNPDFTMVLTINFSSRTTSMDLQRSLEASVEKRTKETYGPPMGKSLLVFMDDLNMPRVDEYGTQQPIALLKLLLDRGGMYDRGKELNCKQLKDLGFIAAMGKAGGGRNEVDSRFISLFSVFNIPFPEEEALHLIYSSILK-------GHTRPFEECIRNMCDKLTFCTLELYKTIIKDLPPTPSKFHYIFNLRDLSRVYNGLTLTNAERFLTEAQFVRVWRNECLRVFYDRLINETDKALVQGHIKSLIQEHFGSELDSAMR-DPILFGDYRTALSESEPRVYEDIQDYDACKALFQEILEEYNE-NKTRMNLVLFDDALDHLTRVHRIIRMDRGHALLVGVGGSGKQSLTKLAAFTAGCDVFEIVLSRGYSESNFREDLKTLYVKLGIENKRTVFLFTDAHVAEEGFLELINNMLTSGMVPALFPDDEKESVLNQIRDEAVKMGSGHSKESVWQYFINKSASNLHIVLGMSPVGDVLRTRCRNFPGLVNNTGIDWFLPWPPQALHAVAQSFLGESPMIPAAHSETVIGHVCM---VHGSVGEFSTLFQQKLRRSNYVTPKNYLDFISTYSTLLQDKDQFILAQCKRLEGGLDKLEEASVQLADLNKKLAEQKVVLAEKSSACESLLQEISTNTAIAEEKKKLAEEKAKEIEEQNKVILVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFAKPPKQVQVVCECILVMRGHK-------------EINWKTAKGMMSE-ANFLRSLMEMDCDSISGGQVKTVRGFLKNLNTSSEEMQAISKAGSGMLKFVEAVMGYCDVAREIKPKREKVARLEKNFFQSKRELEKIQSELEAIQKELGALGEKYSAAMGEKQLLQEEAQLMERRLIAADKLISGLGSENQRWTEDLEELKKKRVRLLGDCLISAAFLSYEGAFNWDFRNEMVYEVWQKDVLERGIPLSQ--PFRIESLLTDEVEISRWGSESLPPDELSVQNGILTTRASRFPMCIDPQQQALNWIKKKEEKNNLKISSFNDPDFLKQLEMAIKYGFPFLFQDVDEYIDPVIDNVLEKNVKGAEGRQVIVLGDKEVDYDPNFKLYLNTKLANPKYSPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLIQETSQNKRLLKDLEDSLLRELATSTGNMLDNVELVHTLEETKSKAGEVFEKLKLAETTSADIDKLRDGYRPAAKRGAILFFVLAEMALVNSMYQYSLASFLEVFDYSLRKSLPNSILPKRLSNIMNTLTLNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAPQEELEFFLKGNLSLEKSKRKKPC-DWLPDQGWEDIVRLNEL-----FPNEFGALIEDIEKNPKEWKNWFDLDSPEQAPFPMKYRDSLTVFQKLLLLRCFRVDRVYRAVSDYVTATMGEKYVQPPVISFEAIFEQSTPNSPIVFILSPGCEPANDLMKLAERSGFGTNRLKFLAMGQGQEKVALQLLETAVSRGQWLMLQNCHLLVKWLKDLEKALERITKP--HPDFRLWLTTDPIRDFPIGILQKSLKVVTEPPNGLKLNMRATYFKIQLETLMS-CPHPAYRSLVYVLAFFHAVVQERRKYGKIGWNVPYDFNESDFLVCMEILNTYLTKAHNQGEGSIPWGSLKYLIGEVMYGGRAIDSFDRRILTVYMDEYLGDFIFDTFQPFHFFHNKDVDYRIPPDGSKEVYVEEIESLPLANTPEVFGLHPNAEIGYYTQAARDMWTHLIELQPQTGDSGGGISRDEYIAQVARDIQNKLPSAFDLDVIRKKLGPDVSPTSV--VLLQELERFNRLVLRMSRSLSELQRALAGEVGMSSELDEVARALFNGQIPAIWRKLAPDTLKSLGNWMIHFRRRHQQYSSWVEVGEPAVMWLSGLHIPESYLTALVQATCRRNGWPLDRSTLYTHVTHYRSEDEVTEKPGQGCYVSGLYLEGADWDVEQGCLVRSKPKELVVQLPILKVIPIEAHRLRLQNTLRTPVYTTSMRRNAM-----GVGLVFEADLFTTEHHSHWVLQGVC 4334          
BLAST of Dynein heavy chain axonemal vs. Ensembl Cavefish
Match: ENSAMXT00000016172.2 (pep primary_assembly:Astyanax_mexicanus-2.0:4:1379218:1548247:-1 gene:ENSAMXG00000015711.2 transcript:ENSAMXT00000016172.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1991.85 bits (5159), Expect = 0.000e+0
Identity = 1185/3386 (35.00%), Postives = 1841/3386 (54.37%), Query Frame = 2
Query: 2750 DITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIF-SSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEIT------AMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRD------LKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRA--VNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNI---KEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQ-ISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYP-FVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRA--VAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNL---LVGKLNSDFNQKYEDVVKIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIP--ELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQ------------AVEESKATKEEIERDSEMAKETQI--VVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKI--DDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNS-MCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFS---KKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPK-----FPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPL---TDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAG---GKSREEIVEEVSKEILQGMPEIFNIED----ISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTW-IDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            DI   +E+ +     HKQ+ E ++          LF   + +Y++L +  K+    + LW  VS      ++    P   ++ E +E     F     K +++ ++     +    +   ++     +  I  L+NP +R RHW+ L    G+        T +  L + L    + +  I + A KE  +E+ L ++   W A++F   S+  T   +LK  +++ + L+D+ V  Q++  S +   F E ++ W+  L     VI  W + QR W +LE IF  SEDI  QLP + KR+  +D  ++++   A   P+V+       L + L++    L   +K L+EYL+TKR +FPRFYF+S  +LL+ILS   DP  VQ HL K F+N AK++FE D +         MFS E E + F +    TG VE W+  + + MR ++R  + + +V Y+  PR +W+  +P QV +   Q +WT +V  A    +      +K  Y K + QL+ L  ++ G ++   R  +  +  I+VHARDVV  +I + ++N   F W+SQLR+ W E      A   +A+F Y YEYLGNT RLVITPLTDRCY+TLT +LHL   GAPAGPAGTGKTETTKDLG+A  I   VFNCS+Q+D+ + G  +KGLA  GAW CFDEFNRI +EVLSVVA Q+ +IQ A + +  RF F G E+ L PS  +FITMNPGYAGRTELP+NLKALFRP AM+VPD+ LI EI L + GF +AR L++K +T ++L  E LS QDHYD+G+RA+KSV+  AG+LKR +    E+ + +RA++D NVPK + DD+ +F G++ DLFP +   ++  +D+      ++ +     L+    FV K +QL E   VRH + +VG  G+GK++  + L     ++K + +  D           LNPK++T  +L+G  +  T EW DG+ S ++R+    +    +W + DG +D +WIE++NTV+DDNK L L+S E I L   M ++FE++ L  A+PATVSR G++Y+  + LG  P V  WI      I   +  +  LFD YL   +D +R   ++I+P     +   +  L++  + P   P D                                                  E  E +F+F+ IW+FG +   D    +     +   T+   + FP +G V+DY  D                        K+  W   VP + + P++     +V T + +R+    E+LL  ++P+M VG  GTGK++ +  KL    P +Y  + + F+  TT+   Q +++  L+K+    +GPP  K +I+FIDD+NMP ++ +G+  P  LIRQ  D+  WYDR  + + + +  + ++  M P  G    I  RL RHF++   +    D++ T++ +IL   + R    A +      LV+  +D +  + +  LPT  K HY FNLRDLS +FQGML  + E + +   +++++ HES RV++D++V D+D   F  L   +VGK   D  +  E+   +   +Y  F ++ I   +Y+    ++ + K + E L+ +N++N A MNLVLF DA+ H+CRI RI+  P GNALL+G+GGSG+QSLT+LAA ++  + FQI L K YG+ + + DL  + + AG++N   VFL +D Q+ DE FL  +N++L SG++P+LY  D++E I   ++  V+  GL  ++ N +  + +RVR  L   +  SP+G   R R R+FPA+VNC  IDWF +WPQEALESV+L+FL ++   E EV + V + + Y    +H SV+  S+ Y     RYNY TP S+LE + ++  + A K+++L    +R +NGL KL  T   V  L+ +L   +  L+Q             VE  K ++E+   D E  K   I  VVTR+              + D + DL +A PAL  + E+L  LNKN++TE+++   P   V  V   V ++            PG ++  D  W A K ++     FLDSL N++K+NI ++ ++ I+PY+    F P  +   S A   +C WV  + K++ V   V PKR+AL +++ EL   ++ L   +AK+  + + +  L  K E     + + + +++     ++ A++L+GGL++E +RW ++V N +     + G+VL+   +V+YLG FT  YR+  M + W   L    VP    P  + +    D   +  WQ +GLP D +S ENA I+    RWPL +DPQ Q  +WIKN   +N L VI++  + +L S+E A+  G+  L+EN+ E +DP L P+L ++T K+     IK+GD    Y+  FR  + TKL NPHY PE+  + T++NFT++  GLEDQLL  VV+ ERPDLE+ K+ L       +  LK +ED +L RLS A G+ + D +L++ LE +K  + EIE KV  A+ TE  I+E R  Y P A R  +L+F + DL KI PMYQ+SL+ F  +F+  +  AA  + L +R+ N+ +  T S++    R LFE  KL ++  LA +IL    +I+ +E  FLL       Q       +++S   W  I  L S+  F     + I      +K+  +   P +EK P EW +     Q L ++R LR D++  A++DFV   LG +++  ++ D  + +++S   TP+ F+LSPG DP  D+ K    M ++   +    +SLGQGQ   AE+ +  A   G WV  QN HL   W+ +LE+ +EQ   +   ++FR+++++ PS        P  IL+N  K+T EPP G+ ANL K+  +F+ D L   A+  E++ +L SLC FH V+ ER+KFGP G+N  Y F  GDL I +N L  +L   + VP+  L+Y  G I YGG +TDDWDRR     L  F  P++M E  +Y   G      PL    D+ GY  YI      ++P ++GLH NA I F    +  L   +L++QP+ + +G   G SR+E V+ V +E L+ +PE FN+ +    + +R P +       V +QE  R N L   IK SL++L   ++G + M+  +E++ N++Y ++VPD+W  +AYPS+  LA W  DL  RI  +++W  D  +PP  W++GFF PQ+FLT  +Q+ AR+    +D +S    V+ K   + +  P +G Y+ GLF+EGARWD     + ++R KEL   +PVI++            +Y CPVYKT  R  T         +V++  + T ++   W   GVA
Sbjct: 1089 DIVNPYEMLDTT---HKQIQEMESIMAKLIESAGLFEVNIPDYKQLKQCRKEVSILKELWDVVSVVRFNLEAWRTTPWREINVEEMELECKRF----SKELRLLDKEARAWDAFCGLDSTVKNTLTSLRAIAELQNPAIRPRHWQQLMTATGVRFSMDEDTTLTDLLNLNLHHFEDEVRAIVDRAVKEMGMEKVLTELDATWTAMEFGYESHPRTSVPLLKSDEDLVETLEDNQVQLQNLMSSKHVAFFLEEVSSWQKRLSVADSVISIWFEVQRTWSHLESIFIGSEDIRSQLPEDSKRFEGIDTDFKELAYDAHKTPNVVEATNKPGLYSRLEDIQGRLALCEKALAEYLDTKRLAFPRFYFISSADLLDILSNGTDPHQVQRHLSKLFDNTAKMKFETDADGKPSKTGIGMFSKEEEYVPFNEPCDCTGQVEMWLNRVLDTMRATVRHEMTEAVVAYEDKPREQWLFDYPAQVALTCTQIWWTSDVGLAFSRLEEGYENAMKEYYKKQVSQLNTLITMLIGQLSPGDRQKVMTICTIDVHARDVVAKIIAQKVENSQAFVWLSQLRHRWDEREKHCFANICDAQFLYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIRDKKKRFNFMGEEINLFPSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFIEARLLARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPERPEDQVLMRALRDFNVPKIVTDDMPVFMGLIGDLFPALDVPRKRDLDFEKF---VRESVLDLKLQAEDNFVLKVVQLEELLAVRHSVFVVGNAGTGKSQVLKSLNKTYQNMKRRPVWAD-----------LNPKAVTNDELFGIINPATREWKDGLFSNIMRELANVSHAGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNPTMRLVFEISHLRTATPATVSRAGILYINQADLGWNPPVSSWIDK--REIQSEKANLTILFDKYLPACLDTLRSRFKKIIPIPEQSMVQMLCHLLECLLTPEHTPPDCH-----------------------------------------------KELYELYFVFAAIWAFGGALFQDQLVDYRVEFSKWWVTEFKTIKFPSQGTVFDYYID--------------------PETKKFEPWSKMVPRFEMDPEIPLQACLVHTTETIRVSYFMERLLERRRPIMLVGNAGTGKSVLVGGKLGSLDPDKYTIKNVPFNYYTTSAMLQAVLEKPLEKKAGRNYGPPGSKRLIYFIDDMNMPEVDAYGTVQPHTLIRQHMDYNHWYDRSKL-QLKEIHSVQYVSCMNPTSGSFT-INPRLQRHFSVFALSFPGVDALNTIYCSILGQHLSREGFSAVVQKSGPQLVQLALDFHQRVTATFLPTAIKFHYIFNLRDLSNIFQGMLFCKSECMKTPQDLVKVYLHESNRVYRDKMVEDKDFSTFDKLQSEMVGKFYEDMEEALEEAKVMN--MYCHF-ALGIGEPRYMPVQSWESLNKTLLEALDSYNEVNAA-MNLVLFGDAMSHICRINRILESPRGNALLVGVGGSGKQSLTRLAAFISSLEVFQITLKKGYGITDLKSDLGALCIKAGVKNIGTVFLMTDAQVADEKFLVLVNDLLASGEIPDLYPDDEVENIINSVRNEVRGQGLLDSRENCWKFFIERVRRQLKVALCFSPVGSKLRVRSRKFPAVVNCTVIDWFHEWPQEALESVSLRFLQEVEHIEPEVKDSVSKFMAY----VHVSVNKTSKDYLANERRYNYTTPKSFLEQIKLYRNLLALKRKDLTMKMERLENGLQKLNSTSAQVDDLKAKLAAQEVDLKQKNEDADRLIQVVGVETEKVSREKAVADEEEEKVASIAVVVTRK--------------QKDCEEDLAKAEPALIAAQEALNTLNKNNLTELKSFGSPVAAVTNVTAAVMVLM----------APGGRVPKDRSWKAAKVMMAKVDAFLDSLMNFNKENIHENCLKAIQPYLQDPEFKPELVAAKSNAAAGLCSWVINIVKFYEVYCEVEPKRQALNKANAELASAQEKLSVIKAKINHLNENLAKLTAKFEKATADKLKCQQEAETTARTISLANRLVGGLASENVRWAEAVNNFKQQERTLCGDVLLITAFVSYLGYFTKRYRHELMDNTWKPYLSQLKVPIPVTPGLDPLSMLMDDADVAAWQNEGLPADRMSTENATILTSCERWPLMVDPQLQGIKWIKNKYGDN-LQVIRIGQRGYLDSIERALSAGEVVLIENLEEAVDPVLGPLLGQETIKK--GRYIKIGDKECEYNPRFRLILHTKLANPHYQPELQAQCTLMNFTVTRDGLEDQLLAAVVSMERPDLEELKSNLTKQQNGFKITLKTLEDNLLSRLSSASGNFLGDTELVENLEITKRTAAEIEEKVKEAKVTEAKINEAREHYRPAAARASLLYFIMNDLNKIHPMYQFSLKAFSVVFQKAVLKAAPDEALKQRVLNLIDSITSSVFQYTTRGLFECDKLTYTAQLAFQILLMNKEINPSELDFLL---RYPVQPGVTSPVDFLSHHSWGGIKALCSMDEFRNLDRD-IESSAKRWKKFVECECPEKEKFPQEWKNKTS-LQKLCMMRALRPDRMNYAIRDFVEEKLGSKYVMGRSVDFAVSFEESGAATPMFFILSPGVDPLKDVEKHGRTMGYTFDNQNFHNVSLGQGQEVVAEQALDLAAREGHWVILQNIHLVAKWLGTLEKKLEQ-HGEGSSQNFRVFISAEPSSSPEGHIIPQGILENSIKITNEPPLGMHANLHKALDNFNQDTLEMCARENEFKSILFSLCYFHAVVAERRKFGPQGWNRSYPFNTGDLTISVNVLYNYLEANSKVPYDDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFIKPEMM-EGELYLAPGF-----PLPGNMDYNGYHQYIDDALPAESPYLYGLHPNAEIGFLTQTSEKLFRTVLEMQPRDAGSGEGSGTSRDEKVKAVLEETLEKLPEEFNMVELMGKVEERSPYV------VVALQECERMNILTQEIKRSLKELNLGLKGELTMTNDMENLQNAIYLDQVPDSWTKRAYPSMCGLALWFTDLLNRIRELESWSSDFNLPPAVWLAGFFNPQSFLTAIMQSTARRNEWPLDKMSLQCDVLKKNREDFSSPPREGAYVHGLFMEGARWDTQAGVIVDARLKELTPAIPVIFIKAVPVDKQETRNVYQCPVYKTRQRGPT---------YVWTFNLKTKENPSKWTLAGVA 4320          
BLAST of Dynein heavy chain axonemal vs. Ensembl Cavefish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 1860.11 bits (4817), Expect = 0.000e+0
Identity = 1190/3616 (32.91%), Postives = 1893/3616 (52.35%), Query Frame = 2
Query: 2078 ALE-YNKFLNLQNQDITEYVNEF------LRNYEAQ--HHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEV---IDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISI-VPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILK--VSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLC-PDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGL----VNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDAL-----ETRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEE--NLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELI-LKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWI--RSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQL--IFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDM--KYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTIL--KFWIMRAVAE-LHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLY-GDFMSVAIE-NKKYVEFVEYDKMLKVIEE-----NLED--------FNQ-INTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQ--ATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLN--DIP-ELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGG-SVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTD-------VPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPK-MSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYE-QSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFAR-KKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            ALE ++++ ++  +D    + EF      L  +E+Q  ++  LE+++  E             P++I +G   + T +++  L  + K           R+ R   +Q        ++KL  RP  I++L ++R  +  + ++ + Q  +   +      Y ++ ++  +++ ++     T+     K+     +V+  L+  +  FR   +++V  F E  D+                  + ++ +     +        V F   E LF  PVT + +L ++ K     + L+   ++ I+  +   +     V  E +   + +F     K  +   E  +  +    +K  I++F    PL++ + N  M  RHW+ +++  G +  V   T      +E  L  + E I  I   A KE  IEQ L ++  EW+   F    +K  G  +L+   + EI   ++D +++  S+  + Y  PF+ +I KW   L  T D+I+ W+  Q  W+YLE +F   DI +QLP E KR++ +D+ W KIM  A + P+V+  C  D  +   L      LE  QK L+ YLE KR  FPRF+F+SD  LLEIL Q  D   +Q HL   F+NI                   + +VF   T                 R    ++I K +    + +K + +  ++L    QV + G Q  WT++  +AL     + + +       LE L+ L  +   D+  + R     LI I VH +D+ +++   NI++ +DFEW+ Q R+Y+IE+   + I   +  F Y  E+LG T RLVITPLTDRCY+TL  AL +  GGAPAGPAGTGKTETTKD+G+      VVFNCSDQ+DF  +G+ +KGLA +G+W CFDEFNRID+ VLSV AQQIA +   +++R   F F   +++ + P   +F+TMNPGYAGR ELP+NLK  FR VAMMVPD  +I  + L S GF D   L++K  T +KL  EQLS Q HYDFG+R + SV+   G  KR N T  E  I +R ++D+N+ K + +D  LF  ++ DLFP I+ +   Y +L  +I     + GL +   +  K IQLFET  VRHG+M +GP+G+GK+ C   L  A++         G P + +    +NPK+IT  Q++G  D+ T++WTDGI STL R+ + A   +  W + DGPVDA+WIEN+N+VLDDN+ L L++G+ I +     ++FE  ++  ASPATVSR GMV++  S+L  +P +E W+  RS  ++                    + +RH      PT                +Y F  S  S++ K    +A   MQ  N  L+  ++P             D+      E +E  ++F+L+WS GA  + D RKK + +LR   S  L   ++P   +  ++DY   + G                     +WVHW   V EYI   D+  +YS I+VP +DNVR   + + +    K V+ +G  GT KT+ I   L+K  P  + ++ + FS+ TT    Q  ++S +DKR    +GPP GK +  FIDD+NMP +  +G Q   E++RQ  + KG+++ +  GEF ++VDI F+ +M  PGGGRN I QRL R F++         S+  +FG I    +   R   E +  +   LV     ++   + +MLPTPA  HY FNLRDLS+++QGML +  + + +   +L LW HE  RV  DR  + +D  WF ++L   +  +  ++Y DVVK E   Y  DF+  A E   +  E  ++D M KV E      +L D        +N+ I  A M+LV F DA+ H+ +I+RIIR P GNALL+G+GGSG+QSLT+LA+ +A Y  FQI L+++Y  A   +DLK +   AG + K I F+ +D +IKDESFLE +NN+L+SG+V NL++ D+++ I  D+ P+++    +   T  NL   +  RVR NLH V+  SP           FPAL++ CT+DWFS+WP++AL +V+  FL+  DI    +V  EV++ +      + +   +Y ++YR    R  +VTP SYL  +  +  IY  K++ L+  +     GL KL    E V  L +ELE+ + +L+ A E++    +E+   +  A++ +I V + +  A          +  A+  L+ A PAL+E+  +L+ +  +DI  VR + RPP  +  +++ V ++   +   ++ D     I   W     L+   G FL SL  + KD I++ V++ + PY     +     ++V      +C W +AM  +  + + V P +  L      L      L++A+A+L A +  +  +Q + E     ++ L   ++ C  ++  A  LI GL+ EK RW +           +VG+VL++  +++Y G F  E+RN +  +W   ++   +P       NL +   D   +  W + GLP D LSI+N +IV  + R+PL IDPQ Q   WI+N + +N L +  L+ K F   LE+++  G+P L+E+VGEELDPAL+ +L K   K      +K+GD  +     FR Y+TTKLPNP YTPE+S + +I++FT++  GLEDQLLG V+  E+ +LE  +  L+      ++++KE+ED +LYRL+  +GS VDD  LI  L  +K  S E+  K+ IA +TE  I+  R  Y PVA R  IL+F + +++ ++ MYQ SL  FL +F   +  ++K+   ++RI NI  + T+ +++   R L+E+HK LF+ LL  +I     +I   E+  L+ GG S+  +  P    +WI D  W  ++ L+ L  FS   ++ I ++   ++  FD   P  E +P  +    D F+ LL++R    D+     + ++   +GER+ E    DL   +++S P TP+I +LS G+DP   +       K   + + +S+GQGQ   A +L++  M  G W   QNCHL   ++  L   V   + D +H  FRLW+T+     FP+ +LQ   K T EPP+G+KA L ++Y   + + L+ ++   +WR +L S+   H  + ER+K+GPLG++IPYEF   D    +     F+  + D       V +  ++Y  G I YGGRVTDD+D+R +      +++  +   ++ + +      I   T    Y+ YI+ LP  DTPE+FGLH NA+IT+      ++LD +L +QPK  S+ GG++RE  V  ++ ++L+ +P  ++  ++ KR   M   + MN  L QE+ R  R+L +++S+L DL  AI G +VMSE L    + +YD ++P  W   ++ S   L  W  +L +R    Q WI  G P  FW++GFF PQ FLT   Q   R  K  ++D +    +V      +IT+ P +G Y+ GL+LEGA WD    +L +S+PK LF  MPV+ +    N  +  S +Y CP+YK   R           N + ++++ T +  ++WI RGVA
Sbjct:  737 ALERFSRYHHIWRKDRESTIQEFSQGNPLLAEFESQILYYKDLELEINAE-------------PEFITVGALALYTADLKLALTAETKGWMLDFGHHCKRKYRTEMEQVFTFVDEASKKL-NRP--IKDLDDIRIAMAALKEIREHQITIDFQVGPIEESYAMLNKYELSVAKEEMEKVDTLRYTWEKLLARSSEVQNELVSLQPNFRGELISNVQTFVEDCDHFYQEYDKDGPMVMGLAPQDASDRLIMFQNRFDNLYRKFVTFTGGEELFGLPVTQHPQLLEIRKQLTLLQKLYGLYNNVIETVNGYYDVLWADVHIERINNELLDFQTRCRKLPRALKEWQAFLD----LKKTIDDFSECCPLLELMANRAMMTRHWKRITEVTGHTFEVETDTFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVIAEWDNKTFTFAQFKTRGELLLRGDSTSEIISNMEDSLMVLGSLMSNRYNTPFKAQIQKWVQNLSNTTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQSCVGDETMGQLLPHLLDQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNI-------------------KSVVFHDKT-----------------RRVNHVLISKQVKHHCILFKVMFKFVFLL---AQVGLLGIQMIWTKDSEEALTNARFDRKIMTKTKQSFLELLNTLIDMTTKDLGTMERTKYETLITIHVHQKDIFDDLCHLNIRSPSDFEWLKQCRFYFIEDLDRMMINITDVGFKYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIDLSVLSVAAQQIAVVLTGKKERKKTFTFTDGDIVEMNPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASCGFIDNVELARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRSNPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPGIQLDKAGYPELEAAIDKQVTEAGLINHPPWRLKIIQLFETQRVRHGMMALGPSGAGKSTCIHTLMKAMTDC-------GQPHREMR---MNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLNWSPILEGWLMKRSAQES--------------------EVLRHLFSSSFPT----------------LYQF--SIQSLDFKMDMLEAFVIMQCINM-LQGLIQP------------KDQGGELSREHMERLYVFALMWSIGALLEQDDRKKMEHWLRHHDSIHLDLPYIPPDSQDTMFDYHVTNDG---------------------QWVHWNLRVEEYIYPKDITPEYSSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGYLSKSNPESHTAKSLNFSSATTPLMFQRSVESYVDKRMGTTYGPPAGKKMSIFIDDINMPVINEWGDQVTNEIVRQLMEQKGFFNLEKPGEFTNIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGTGHYCSQRGFEEDVRKVVSRLVPLTRRLWQMTKVKMLPTPANFHYIFNLRDLSRIWQGMLNVNADVIHTPKVLLCLWKHECKRVIADRFTSPEDVAWFDSMLANLVEEELGEEYRDVVKPEVDAYFVDFLQDAPEATGEEPENADFD-MPKVYEPIASFPSLRDRLNMFLGLYNESIRGAGMDLVFFTDAMIHLVKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYGIFQITLTRSYNTANLMEDLKNLYRTAGQQGKGISFIITDNEIKDESFLEYMNNVLSSGEVSNLFARDEMDEILSDLIPVMKREFPRRPPTNENLHEYFMSRVRQNLHVVLCFSP-----------FPALISGCTMDWFSRWPKDALVAVSEHFLSSYDIDCTPQVKGEVVQCMGSFQDGVAEKCVDYFQRYR----RSTHVTPMSYLSFIQGYKAIY--KEKHLESVKFAMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAHAAEKVKIEVQKVKDKAQAIVDSISADKAIAKEKLEAAKPALEEAEAALQTIKPSDIATVRTLARPPHLIMRIMDCVLLLFQRRLNAVKIDAEKNCITPSWQESLKLMT-AGNFLGSLQQFPKDTINEEVVELLTPYFDMPDYNIETAKRVCGNVAGLCSWTKAMATFFSINREVLPLKANLVVQENRLAIAHADLQKAQAELDAKQAELDVVQAEYEKAVTEKQMLLEDAERCRHKMQTASSLISGLAGEKARWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNLLLSDWQKEMRARCIPFGIN--LNLTEMLIDAPTVSEWNLQGLPNDDLSIQNGIIVTKAARFPLLIDPQTQGKIWIRNKEAKNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMKGFRLYVTTKLPNPAYTPEISARTSIIDFTVTMRGLEDQLLGRVILTEKQELEKDRMDLVEDVMANKRKMKELEDSLLYRLTSTKGSLVDDESLIVVLSNTKRTSEEVTQKLQIAAETEVKINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSSKSPITSKRIGNIIEHMTYEVHNYAARGLYEEHKFLFTLLLTLKIDMQSNRIKHEEFLTLIKGGASLDLKACPPKPSKWIPDMTWLNLVELSKLWQFSDILDQ-IGRHEKQWRSWFDKEAPEEEVIPNAYDQSLDCFKRLLLIRSWCPDRTIAQARKYIVDSMGERYAEGVILDLERTWEESDPRTPIICLLSMGSDPTDIIIALGKRQKV--ETAYVSMGQGQEVHARKLLQQFMANGGWALLQNCHLGLDFLDELMDTV--TETDSIHESFRLWITTETHRNFPITLLQMSIKFTNEPPQGLKAGLKRTYQGINQELLD-VSNMVQWRPMLYSVAFLHSTVQERRKYGPLGWSIPYEFNQADFNATVQ----FVQNHLDDMDMKRGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFNHEFQFYKD---YHIPRCTSVDQYLQYIQGLPAYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSSGGGETREAAVGRLADDMLEKLPPDYSPFEVMKRLETMGRLEPMNIFLRQEIDRMQRVLALVRSTLTDLKLAIDGTIVMSENLRDALDCMYDARIPARWKKASWAS-STLGFWFTELLERNQQFQAWIFEGRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDRMVLCNEVTRWMKDDITQPPQEGVYVYGLYLEGAGWDRRNCRLVDSKPKVLFEMMPVVRMY-AENNGVKDSRLYSCPIYKKPART--------DQNIIAAVDLRTSQRPEYWILRGVA 4167          
BLAST of Dynein heavy chain axonemal vs. Ensembl Sea Lamprey
Match: DNAH6 (dynein axonemal heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:2951])

HSP 1 Score: 2733.36 bits (7084), Expect = 0.000e+0
Identity = 1543/3834 (40.25%), Postives = 2245/3834 (58.56%), Query Frame = 2
Query: 1616 SKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDA-----------CYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFP---IVCVNLFDKAIQALQNV------PQLEQFIM----KDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKF--------------LNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLD------NLTMSVASMVSYN----DITKAHEVANEVRRIHKQLT-EAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKST-LTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNT-GTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQF---------EKDL--EITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLK-WPGQVVIAGCQTYWTQEVSDALETRDLKGLYV------KLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEE--NLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPF-QTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHR-ERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMP-PEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDR-----KAIGEFRSLVDINFIVSM-GPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIE-PLLYGDFMSVAIE--NKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGL-QATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPN-PAPEWISDRVWNEILTLAS-LPAFSKFPEEFIH-KYLNDFKRIFDSLEPH-----------------REKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDK--VHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIY--RQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAG-GKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQ----SMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEIT------------------EIPS--DGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
             KL  F+ L  Y + +++  L +++++  +N +               +AC   ++       ++      +  P+FL + +L+     ++   ++F     V ++ F   + ++ N+          Q I+    ++ S  + P LE++  ++  + K+   ++E ++ A      YA  + +F              L  +  D+  +  E L  Y  QH  A+ IK   +                  +G   ++   +++ L        NAI DLL    RK  D      +    KL   P+T  E      ++  I D +   +E +   +  Y+LIE+F      +D     T+         SII V QN ++     R     ++  F + LD      N+ + +    + +    DIT       E+ +     T E Q  A+ +   ++ F   VTN++ L+++  + +  + +W ++ +W       +      +D E +   V ++ K +++  K    LP    V   +K  +E  +  +P++  LRNP ++ARHWEML + +G  +  K T LT +  +E+ +  + E I  ++  A  E ++E  L K+   W+  +F VL ++++   +IL  +DEI  LLDD I+   ++  S Y  P + R+ +W+  L      ++EW+ CQR WLYLE IFS+ DI RQLP E K +  +D+ W+ IM+  +  P+ +       LL   K  N LLEQ+QK L  YLE+KR  FPRFYFLS+DELLEIL+QT++P AVQPHLRKCF+ IA+L+F         E+    +I AM S EGEK+   K     GNVE+W+ ++E  M +SLR +    +  Y+ +PRTEWV+   P QVV+   Q  W ++++  LE  D   L        +  E+L+ L  +VRG++ KI R  ++ALI ++VHARD+V +M+ E ++  N+FEW  QLRYYW  E  N   R   +++ YGYEYLG   RLVITPLTDRCYL L GAL L  GGAPAGPAGTGKTETTKDL KA AIQCVVFNCSD LD+  MG+FF GLA +GAW CFDEFNRIDIEVLSV+AQQ+ TI+ A+  ++ RFMFEG E+ L  +CA FITMNPGYAGRTELPDNLKALFRP+AMMVP+YALIAE+ L+S GF  +R L++K+   +KL SEQLS QDHYDFGMRAVKSV+  AG+LKR+N  + E+++ +RA++D N+PKFL DD  LF+GI+SDLFP ++    DYG L  SI+ A + + L+ V   V K IQL+ET +VRHG+MLVGPTG GKT  Y  L  AL SL +      +PF Q VHT VLNPKSI+MG+LYGE + +T EW DG+++  +R  V  +  D +W + DGPVDA+WIEN+NTVLDDNK LCL++ E IKL  ++ M+FEV DL VASPATVSRCGMVY++   L   P+V+ W+  + D       + +  LF+ Y+E+ + F+     + +P                        D+S     S       + K   +LK                      +++   V   F+F  +W+ G +   +   +FDT+++ +          P  G ++ Y  D+                       +   W   VP +    ++ + +++VPT D +R   + E+LL  K  V+  G TG GK++     L K     +Y+  +I FSA+T++ +TQ++I+SKL+K+RK + G P  K +I F+DDLNMP L+ +GSQPPIEL+RQ+ DF G+YDR     K I + R   D   +     PPGGGRNP+T R +RHF++L      E S+K +F  IL  +++     +  +   +V+A +++Y  + +++LPTPAKSHY FNLRDLSK  QG+L  +  ++   +Q+ RL+ HE  RVF DRL+N++D+++F  +L    +  F  + E    ++ P+L+GDFM V ++  ++ Y +  + +K+  V+++ L+D+N  +  +M LV F DA+ HV RI R+IRQ  GNALL+G+GG+G+QSLT+LA HM  Y CFQIELS+ Y    + +DL+++   AG+E+K  VFLF+DTQI  E FLED+NNILNSG+VPNL+  D+LE++    +P  ++ G+ +  +  +   +  RVR  LH V+ MSP+G+ FRAR R FP++VNCCTIDWF QWP+EAL SV+  F    P    S+E+   L  MC EIH SV+  +E Y  EL R  Y TPTSYLEL+ ++  +   K+ +L  +RDR KNGL KLL T E+V KLQ EL  ++P L+Q  E+ +A  E++  D E A + + VV  +EAVA  KA+E + +  DAQRDLDEALPALQ +  +L  L+++DI+EVR    PPEGVR V+E +CI+   KP               W + K LL D   FL  L +YDK+NIS+ VIQK++ YI ++ F P  +E+VS+AC S+C WVRAM  Y  V K V PKR+ L  +  EL+ T  +L + + +LK VED+I  LQ++ +     ++ L     L +AR++RA KL   L +E+IRWQ+SV   +  INN++GNV I++  VAY G FT  YR  +   W +  +  G+P       +L+   GDP +IR W  DGLP+DT+S EN ++V   RRWPL IDPQ QANRWI+N + +NGL +IKL+D +FLR+LENAIR G P L+E + E LDPALEPILLKQTF   G ++I+LGD+ + Y  +FRFY+TTK+ NPHY PEV  KVTI+NFT++ SGLEDQLL  VV  E+P+LE+ +N+LIV     + +LK IED+IL  L  +EG+ +D+ +LI+TL+ SK+ S  I+ ++  AE TE  I+  R +Y PVA R  +++F +A L++IDPMYQYSL++F  +F   I  + K   L ER++ +      + Y+N+ R LFE+HKL+FSF+L   IL+  G +  AEW   L G +   ++ P  P   W+++  WN    L   LP F     E +    L    R+   L P                    ++ G W +   +FQ L++++    +KV  AM DFV   LG+ FIE    DL  +Y+D S +TPL+FVLS G+DP     +FA +M +S+++ AISLGQGQGP AE+LI+ A++ G WVF QNCHLA SWM ++E +++ + +    +H ++RL+L+SMP+  FPV +LQN  K+T EPP+G++AN+ +++T  +  F         WR ++  +C FH ++ ERKKFGPLG+NI YEF D D    +  L +F  +   +P+  L Y  G I YGGRVTD WD+RC+  +L  F++P+ +   Y+YS SGIY   +   L DH     YI +LP+ND PEIFG+H+NAN+ F   ET  L+  +L++QP+ S  G G S +EIV+E++  IL  +PEI ++E   +      E+    S+ TVL QEV R+N LL +I+SSL  L KAI G VVMSE +E + NS  +++VP  W+  AYPSLKPL  WV DL  R  FI  WI  G P  FWISGFFFPQ FLTGTLQN ARK  + ID + F +K +     + +                  ++P+  DG  + GLF++ +RWD   M + ++   ++   +PV+   PC N    PS +Y  P+YKT  RAGTLSTTGHSTNFV ++ +P+ +D  +WI +G A
Sbjct:  393 GKLTCFIRLADYVIVNTLHILAVNTVSTLLNQLTKQLQKTPSKELIEAWACEPREEPITKKEAVIAQEETEQVFPLFLTEFMLEPESLMFAPSQNEFQDGLSVVIDSFKDTVLSVDNLVTDIYFDAFTQPIINKKHEEKSCGEGPSLETIFQDDKHLHKIIGGVQEVIRTAFNAAGLYADTFEQFRLFYKENESLDLEALKNKEHDVA-FFEESLAKYHEQHKDAVAIKERRD------------------LGMLLVDATKLKKKLIPSPLRCQNAINDLLPVLSRKKTDAIISEARDGQFKLEIVPSTTFEFVNSLTFLDEIQDRIQVLEEEMQIVVQMYQLIEQFKVPTPPEDLVVYSTL-------EQSIISV-QNTIDKAVGERD---GNLEKFCQHLDKDILELNMEVKIVKQRAQDPMILDITSDKTKVREILKEQMIATDEFQQQALQYRAYQKNFKVEVTNFDALNEVCDELKRKQMMWDSLDEWEVFTKEWLECQFETLDPEQLNSEVAKYAKIVNQLEK---GLPP-NNVVPLLKKKVEFIREKLPVVAFLRNPSLKARHWEMLEEIIGAPLRDKETPLTLAGLIELEVFHYAEQIQDVSGQASGEASLESILKKVEDGWKTAEFVVLPHRDSKDVFILAGTDEIQILLDDSIINISTITSSRYVGPIKSRVDEWQRQLLLFNQTLEEWMTCQRNWLYLESIFSAPDIQRQLPAEAKMFMQVDKSWKDIMRKIYRLPNALRAATQPGLLDTFKNNNALLEQIQKCLEAYLESKRVVFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDAIARLEFALAPAEGEQERTFTNDILAMVSPEGEKVSLGKGLKARGNVEDWLGKVEEAMFQSLRRLTKMAIGEYQSMPRTEWVVSGLPSQVVLTVAQLMWCRDLTQCLEGGDHDHLQSVANFEKENFERLNSLACLVRGNLPKIHRCIITALITVDVHARDIVTDMVQEKVETANNFEWQRQLRYYWDLELDNCVARMALSQYVYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKVPRFMFEGREIKLIQTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPNYALIAEVILYSEGFESSRVLARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPHLREDVVLIRALRDSNLPKFLADDAMLFSGILSDLFPGVEIPNHDYGSLQSSIENALKARKLQAVPSMVHKVIQLYETMLVRHGVMLVGPTGGGKTTVYTALSDALGSLHEAGESKHNPFYQKVHTTVLNPKSISMGELYGEVNNLTLEWRDGLMALSVRVAVADDSEDHKWIVCDGPVDALWIENLNTVLDDNKMLCLANSERIKLTPQIHMIFEVQDLKVASPATVSRCGMVYIDSEELKWMPYVQTWMNGIIDKFGEDTGQYIMALFENYVEDGLRFVNKKCTQAMPQV----------------------DISKVTTLSCLLESLLLGKGGPDLKMEH-------------------SRLTSIVCQTFVFCYLWAVGGNLVENCWDQFDTFVKHQFEENHD-AKLPSSGDLWSYYMDYDSK--------------------RLDPWERIVPNFRYNKEVPFFEMLVPTTDTMRFGYLMEKLLAVKHSVLFTGTTGVGKSVVARGLLDKIQEEAQYVPLYINFSAQTSSTRTQEIIESKLEKKRKNIIGAPGKKRVIIFVDDLNMPKLDRYGSQPPIELLRQYQDFGGFYDREKMFWKEIQDARE--DRGAMQPFCAPPGGGRNPVTPRFIRHFSMLCLPSPSEHSLKQIFQAILTGFLVDFPVAVKQVATNIVEAAVEMYGRMSTELLPTPAKSHYIFNLRDLSKCMQGILQCDSGTVRDQNQIFRLFCHECQRVFHDRLINNEDKDYFNTMLAEMASKQFGVQVEAEYFVKHPILFGDFMKVGVQRADRVYEDLTDVEKLKGVLQDYLDDYNLSSAKEMKLVFFQDAIEHVTRITRMIRQERGNALLVGVGGTGKQSLTRLACHMCGYRCFQIELSRGYSYDTFHEDLRKLYTIAGVEDKDTVFLFTDTQIVIEEFLEDINNILNSGEVPNLFEKDELEKVLAATRPKAKEAGIPEGNRDEVLQFFINRVRARLHIVLCMSPVGDAFRARCRMFPSIVNCCTIDWFVQWPREALLSVSKTFFT--PVDLGSDELKENLSEMCVEIHMSVTELAEHYYAELRRRYYTTPTSYLELINLYLSMLGEKRSQLTNSRDRIKNGLTKLLETNELVDKLQLELSALEPVLKQKSEDVEALMEKLATDQENADQVRRVVMEDEAVAKVKAEETQAMAADAQRDLDEALPALQAANRALDSLDRSDISEVRVFTNPPEGVRTVMEAICIVLSKKPD--------------WASAKQLLGD-SNFLKRLTDYDKENISEDVIQKLKVYINNKDFVPEKVERVSKACKSMCMWVRAMDLYSRVLKDVGPKRQRLATAQAELDATMAMLNDKQRRLKQVEDQIGALQDQFDMSVAEKESLAKNMALTQARMSRAGKLTSALGDEQIRWQESVAQFQVEINNVIGNVFIASACVAYYGAFTSHYRQMLIDRWISRCQELGIPINAN--FSLIGILGDPFEIRQWNTDGLPRDTVSTENGILVTRGRRWPLMIDPQDQANRWIRNKEMKNGLKIIKLTDGNFLRTLENAIRLGMPVLLEELKETLDPALEPILLKQTFVSGGRLLIRLGDSDVDYDKNFRFYMTTKMANPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPELEEQRNELIVRINADKNQLKVIEDRILKLLFTSEGNILDNEELIKTLQESKVTSGAIKTRLKEAEATEEMINTAREKYRPVAARGSVMYFVIASLSEIDPMYQYSLKYFKQLFNMTIETSEKRSDLAERLELLLKQTLLATYTNISRGLFEQHKLIFSFMLCIEILRQHGHVSDAEWNLFLRGAAGMDKERPTKPEIGWLAESTWNLCCDLEDHLPCFKGLKREIVAIPILVTLGRLEIRLNPEAWEGCMKEPLHFTEEVSENEIQGHWNERLSKFQKLVLVKSFMEEKVVFAMTDFVIENLGKAFIENPPVDLATLYQDMSASTPLVFVLSTGSDPMGAFQRFAREMGYSERVHAISLGQGQGPIAEKLIEEAVKSGDWVFLQNCHLAASWMLAMEEIIKALSEPNAVIHPNYRLFLSSMPTRNFPVTVLQNSVKVTNEPPKGLRANIRRAFTEITPAFFEKNVLGQNWRKIIFGICFFHAIIQERKKFGPLGWNIHYEFNDSDRECALLNLNLFCQD-GRIPWDALIYITGEITYGGRVTDSWDQRCLRTILKRFFSPKTLEPGYLYSTSGIYYASEEKTLQDHKD---YIENLPLNDDPEIFGMHENANLAFQRQETGTLVKTILEVQPRSSGQGAGTSNDEIVKELADSILAKLPEILDMEGAMESLFTRDEKGRINSLTTVLEQEVDRFNTLLQVIRSSLHTLKKAIAGFVVMSEEMEKIYNSFLNSQVPVLWSDNAYPSLKPLGGWVKDLALRTTFIDAWIKTGPPKSFWISGFFFPQGFLTGTLQNHARKYNLPIDELGFHYKTLPVYRDQTSVAEAMRTQQFGQELEADIQLPAVQDGVLVHGLFMDASRWDDEDMVMEDALAAQMNPPLPVLHFEPCQNYQPDPS-LYHAPLYKTSARAGTLSTTGHSTNFVVTVFIPSKRDSDYWISKGAA 4104          
BLAST of Dynein heavy chain axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001140.1 (pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 gene:ENSPMAG00000001005.1 transcript:ENSPMAT00000001140.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1940.62 bits (5026), Expect = 0.000e+0
Identity = 1104/2682 (41.16%), Postives = 1599/2682 (59.62%), Query Frame = 2
Query: 1574 WFNIYETDFYVYTKSKL-KKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQV-----KKLRENLR-ETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLI--PQYII-IGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKSTYPT---GNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALE--TRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAI-YPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQL--------------------IFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPE-YISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVA---ELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNS----DFNQKYEDVVK---------IEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPI----VQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKI-QGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEP-YIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRN 9442
            W +  +T +Y   K KL  K   + +           L S  N    +  +    + L+  Y++ + + ++     K+P F++ L+L      +      F +V +N+FD  ++ L  VP++E  +     ++D P+ ++    +P V     ++L+ ++R E ++++L+P E +   Y  F  L        V  FL    ++ HT  E +  V  +   +E+   ++   Q ++ +G F ++ + +   LAK+ + + + +L  +++E +K   + CE F++I  K    P   + L EL+E+I  +      Q +V      D+ L    + +LS  +     T   W  ++     +  + L E  E++++        F E L+          +  D+   ++   + + +H +L  A      FN  E  F  P + Y +  K+     P+  L+    ++   H + M  PL  V+ +VVE+ V  +++ ++K  +     P    +  Q+K  +E F+  +P+ Q L NPG+R RHW+ LS+ +G  ++ +  +   K LEM L+  +   + I++ A KEY++E+AL KM  EW+ ++F ++ Y+++GT IL   D+I  LLDDHIV TQ+M  SP+ KPFE  + +WE  L   Q+++DEWL+ Q  WLYLEPIFSS DI  Q+P EG+R+ T+D+ WR ++K    +  V+ +    ++L  L++  +LLE + KGL++YLE KR  FPRF+FLS+DELLEILS+TKDPT VQPHL+KCFE I++++F + L+IT M S EGE +   ++   +   G VE+W+LE+E +M  S+  +IG+ +  Y   PR EWV  WPGQ V+   Q +WT EV +A+    + L+    +   Q+D +  +VRG +++  R+TL AL+V++VHARDV+  ++   I + +DF+W+SQLRYYW + +L+ R +NA  PYGYEYLGNT RLVITPLTDRCY TL GAL+L  GGAP GPAGTGKTETTKDL KA A QCVVFNCSD LD++A+GKFFKGL S GAWACFDEFNRID+EVLSVVAQQI TIQ+      D  MFEG EL L P+CAVFITMNPGYAGR+ELPDNLKALFR VAMMVPDYA+IAEI L+SFGF  AR LS KIV T++L SEQLSSQ HYD+GMRAVKSV++AAGNLK +  + +E+++ LR+I DVN+PKFL  DL LF GI SDLFP +K    DY  LL +I+    K  L+    F +K +Q++E  +VRHG M+VG    GKT  Y VL +AL  + ++     +  Q     VLNPK+ITMGQLYG+FD ++HEW+DG+L+   R   T+  PD++W +FDGPVDAVWIENMNTVLDDNKKLCL SGEII+L     ++FE  DL VASPATVSRCGM+Y+EP ILG  P +  W+ + P  +  PH+  +  LF+  +   + F+R + +E+ PT++  L  +++ LMD                                        +M  F+   +I       +   +E  FLFSL+WS GASC T  +  FD  LR  MS  L                      +PFP  G VY+YRF   G                K R   W   ++  P   I  DM ++DIIVPT+D +R  ++ E L+  +KPV+ VGPTGTGK++ I++ L K++    Y    I FSA+TTA QTQ++I  KLD+RRKGV+GP  GK ++ F+DD+NMPA E +G+QPP+EL+RQW D   WYD K     + L ++  + +MGPPGGGRN +T R +RHFN +  NE  + SM T+F  I+ +      A   +   L E LV++ ++VY A    +LPTP KSHY FNLRD S+V QG+ +  PE+      + RLW HE  RVF DRLV+D DR W    +   +++    DF Q ++             +  L++ DF     + K+YVE  + +++  V+E +LE+FN ++   MNLVLF  A+ HVCRI+RI++QP  +ALL+G+GGSGRQSLT+LAAHMA+ + FQ+E+SK Y   EWR+DLKRI+  +    +  VFLF+DTQIK ESFLED+NN+LNSG++PNL++ D+ + I   M+ I     +D     +   L + +  R R  LH V+ MSPIG+ FR RLR+FP+LVNCCTIDWF  WP +AL++VA ++L D+   EVSEE +   + MCK  H S    S+K++ E  RYNYVTPTSYLEL+  F  +  +K+ E+ + + R + GL+KL      V  +Q EL  ++PQL +A  +   T   IER+SE    T+ VV  +EAVA ++A   ++I+D+   DL EALP L+ +L +L  L + DIT V+ M  PP GV+LV+E + I+K VKP ++      G  ++D W   K LL D  KFL SL ++DKDNI  ++++ I   YI +  F P  I   S A   +C+WV AM  Y  VAK VAPK+  L ++  EL      L+  +  L+ V+D++ GLQ+ LEA  +++ +LEN+ D+C  +L RA++LIGGL  E+ RW ++   L    N++ G+ L+S+G VAYLG F   +R 
Sbjct:  212 WLSEIQTIYYQSNKKKLVPKLTNVTR-----------LASYFNCAAALMTSLLQKLALNSIYDYTDLICSTQTGTVKHPGFVLRLILSKDTIKFEPDFKDFQVVLLNVFDVMMKTLATVPRVETKL-----YSDWPMDKAHTHLQPVVLREVLEELQSHVRAEIIQQSLLPRE-HLRHYEPFEGLVGGQAERDVERFL----SEEHTFSEHEQLVSHY---RELSHSILYSSQLVVRLGMFELHCDELVAALAKRAENLGSRLLGRMSQEHQKFIQRLCEEFESIAEKALSTPINTKALMELKEYIQKVEVQEMSQLQVKLNEAKDHLLFLLDHASLSPSEMRHNNTAFQWCGRMPGIFTEHRRILTEKTEQYQESLKFRRRRFEEDLEAYAKQAEEFSTLGDLADVNKYLKKAQVLHTKLEAATEMIESFNAEEEAFAWPTSQYPQKKKIQDVLMPYLRLYEMAVEFTSKHKAWMEGPLADVNPDVVEQDVGNYWRGLYKLERSLQASPQALLIQQQLKSNVEAFRTHLPMAQVLCNPGLRGRHWDALSEVVGFPLLTQEQVCLEKFLEMNLESFLSKFNDISDTASKEYSLEKALEKMVREWDEMQFTLIVYRDSGTSILSAVDDIQMLLDDHIVKTQTMRGSPFIKPFESDMKEWERKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFTTVDKTWRDLIKQTLTDTHVLAVVSIDKMLERLQKSTELLELILKGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGISRVEFTEALDITHMKSSEGEVVQLIETISTSKARGQVEKWLLELEAVMIRSVHNVIGEAMEAYPSTPRAEWVRAWPGQTVLCVSQAFWTSEVHEAIRGGQQVLERYLAQCNGQIDEVVGLVRGQLSQQSRVTLGALVVLDVHARDVLVALLKGGIAHDSDFQWLSQLRYYWEDGHLQTRMINAGLPYGYEYLGNTPRLVITPLTDRCYRTLFGALNLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINTGSDTLMFEGTELKLNPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIMLYSFGFVSARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPSENEDILMLRSIVDVNLPKFLAHDLPLFEGITSDLFPGVKLPKPDYVVLLEAIKENCEKMNLQMTDFFAEKILQIYEMMIVRHGFMIVGEPFGGKTCAYRVLAAALGDICEKALMAENKVQIT---VLNPKAITMGQLYGQFDAISHEWSDGVLAVSYRAFATSTSPDRKWLVFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQLASTTNLIFEPMDLEVASPATVSRCGMIYMEPHILGWRPLLTSWLNARPPPLSAPHKALICALFERLVPCCLQFVRKSTKELSPTSDTNLVCSLMNLMDC---------------------------------------QMDDFHDETKIKAMDDRDVSAWIEGIFLFSLVWSVGASCSTHGQVLFDQLLRELMSGPLSADTSKRFHLSENVEPPAEPFSVPFPAAGSVYEYRFIQEG----------------KGRWELWTEALSLAPP--IPRDMNFNDIIVPTLDTIRFTALMEMLVTHQKPVLFVGPTGTGKSVYITNFLLKHLDKNTYKPLTINFSAQTTAAQTQNIIMGKLDRRRKGVYGPAQGKRMVLFVDDVNMPAREEYGAQPPVELLRQWLDHSNWYDLKDCSMIK-LENVQILGAMGPPGGGRNAVTARFLRHFNTVTINEFDDKSMFTIFSRIMGWHFTARFAFPTDFSVLTEQLVQSTMEVYKAATQNLLPTPTKSHYLFNLRDFSRVIQGVCLSLPETCPVAASIQRLWVHEVLRVFYDRLVDDADRTWLVAFIRKTIHTYMKEDFTQLFQHDSNGDGQVEDDDLRSLMFCDFSDSKDDAKRYVEVSDVERLRLVVEGHLEEFNNLSKKPMNLVLFRFAIEHVCRISRILKQPRSHALLVGVGGSGRQSLTRLAAHMADCELFQVEISKGYATNEWREDLKRILRRSTDGEQNGVFLFTDTQIKQESFLEDINNLLNSGEIPNLFAPDEKQEICEKMRQIDRQRDKDKQTDGSPLALLNMFVDRCRDQLHVVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQSWPGDALQAVATRYLEDV---EVSEETLASCIDMCKLFHTSTIALSQKFQAEQQRYNYVTPTSYLELISTFKDLLEKKRLEVMRMKRRYEVGLEKLESATSQVAGMQAELAALQPQLLEAGIQVVNTMAVIERESEEVSRTERVVKADEAVANEQAMAAKVIKDECDADLAEALPILRSALAALDTLTQQDITVVKTMKSPPAGVKLVMEAISILKGVKPDRVPDPSGSGRMVEDLWGPAKRLLGD-MKFLQSLHDFDKDNIPVAIMKTIRAKYITNLEFDPDKIRNASTAAEGLCKWVIAMESYDKVAKVVAPKKVKLNQAEAELAVAMGSLRRKQEALREVQDKLAGLQQTLEANKQKKADLENQVDMCTKKLDRAEQLIGGLGGERSRWMEAARLLGIRYNDLTGDTLVSSGIVAYLGAFISSFRQ 2804          
BLAST of Dynein heavy chain axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003955.1 (pep scaffold:Pmarinus_7.0:GL495754:4342:49943:-1 gene:ENSPMAG00000003592.1 transcript:ENSPMAT00000003955.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1431 bits (3703), Expect = 0.000e+0
Identity = 807/1896 (42.56%), Postives = 1158/1896 (61.08%), Query Frame = 2
Query: 2285 VRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWI-----LTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQI----KVAIEEFKPFIPLIQGLRNPGM---RARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKI-VFEK--STYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKGLYV---KLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYP--HRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFP-----------EEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDM-----KYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPE-YISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRA--VAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWF----KNLLVGKLNSDFNQKYEDVVK---------IEPLLYGDFMSVAI--ENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLK 7810
            ++QGL  K +   N +LD L  + R      C+AF+ + ++  + P   EE+ EL  ++       I D+ D+ QE    C      + + +  LS +D      ++ WP +I  +  + E+ +   + +     +A       +LD L+  V      +++    +  +++R I K+L +A       N  E L+   +T+Y ++  +    +PF+ L+  +  W +     M+   + ++ E +   + EF++ M+K +K F +     E   Q     K   +  +  +   Q   +P +   R RHW  +S+ +   I P S  T  K L+  L  +++   +I+  A KEY++E+AL+ M   W+ + F  L Y+ TG  IL   DEI   LDD IV TQ+M  S + KPFE  I  WE  L   Q+ +DEWL+ Q QWLYLEPIFSS+DI +Q+P EG+ + T+DR WR++MK    +P V+       LL  L+ CN LL+++ KGL+ YLE KR  FPRF+FLS+DE+LEILS+TKDP  VQPHL+KCFE IA+L F  +L+I AMFS EGE++ + E+  ++   G VE+W+L++E++M  S+R +I +    Y    R +WV +WPGQVVI   Q +WT EV +A++    +GL     +L +QL  +  +VRGD++K  R+TL AL+ I+VHARDVV +MI + + N  DF+W++QLRYYW  E +++R VN    Y YEYLGN+ RLVITPLTDRCY TL GA +L  GGAP GPAGTGKTETTKDL KA A+QCVVFNCSD LD++AM KFFKGLAS+GAWACFDEFNRI++EVLSVVAQQI  IQ+A Q ++  F FEG EL+L P+C V ITMNPGYAGR+ELPDNLK LFR VAMMVP+YALIAEISL+S+GF +A+ LS KIV T++L SEQLSSQ HYD+GMRAVK+V+ AAGNLK +    +E+++ LR+I+DVN PKFL  D+ LFNGI SDLFP I     DY   L + +    +  ++ V  F+DK IQ +E  +VRHG MLVG   +GKTK  +VL   L+ + ++    G   + V    +NPK+ITMGQL+G+FD ++HEWTDGI++   R+  +++ PD++W +FDGP+D +WIE+MNTVLDD  +LCL SGEII++ + M+++FE  DL+ ASPATVSRCGM+Y+EPS LG  P V+ W+ +LP  +    +R+ +Q+LF   +  ++  +R   + +           M+KL  +      PSD++ E  ++  ++   M  N+                               ++++ F FSL+WS GASCD+D R KFD++LR  ++ +    P P           E GLVYDY ++  G                   +  WVHW     E I  P +     K  DIIVPTID  R   + +  +   +P++ VGPTGTGK++ I +KL   +  E Y+  F+ FSA+T+ANQTQ++I SKLDKRRKGVFGPPMGK  + F+DD+NMPALE FG+QPPIEL+RQ+ D   WYD K   + R L D+  + +MGPPGGGRN +T R +RHFN+   N   +++M  +F +++ F++       E   +   +V A ++VY      +LPTP KSHYTFNLRD S+V QG+L+L  E+      +LRL+ HE  RVF DRLV+DQDR W     ++LL       F+  +ED+ +         +  L++GD+M+  +  E + Y E     +   V+E+ LE++NQ +  +MNLV+F   + H+ RI+R+++QP G+ALL+G+GGSGRQSLT+LA  M+    FQ E+SK+YG  EWR+D+K
Sbjct:  476 LKQGLMDKARGFINLLLDKLLNQHRAHNAMICQAFEVMRQRCLKVPENSEEMIELGSYVDNARSKGIADLNDKIQE----CYRRMSFLLDVHI-LSPEDIAFNSQVLCWPREIAPAFDRNEELMEVAQRKGESELLARRERLLLELDKLSRRVDGFAECSELDMIAQYVSDMRMIGKRLQDADDTITFINKEEVLYKWELTSYPEVDAIRTKLDPFQKLFTLILRWQRAEKKWMDGSFLELNGETMATELEEFFREMYKHLKFFQQRQKKAEQERQRDAPRKKRGDSAEAEMEEAQEQSDPSVQMCRDRHWVQMSEVVENDITPDSGTTLRKVLKQNLIPYLDKFEQISAAASKEYSLEKALHTMVETWDTIAFTTLQYRETGVSILSSVDEIQSTLDDQIVKTQTMRGSAFIKPFETEIKVWEERLVRIQETLDEWLKVQAQWLYLEPIFSSQDIMQQMPEEGRLFQTVDRNWREVMKFCTRDPKVLVATSMTGLLEKLQNCNGLLDKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIARLGFLPNLDIGAMFSSEGERVELVERVSTSEARGAVEKWLLQVEDVMLRSVRDVIVRARTAYANTQRKDWVREWPGQVVICVSQMFWTTEVHEAIKGGPQQGLREYSERLQDQLKDIVELVRGDLSKQTRVTLGALVTIDVHARDVVFDMIDKGVSNETDFQWLAQLRYYWESEQVRVRIVNCNVKYAYEYLGNSPRLVITPLTDRCYRTLVGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMSKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQTKMVTFAFEGTELVLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLIAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGITLPAADYTLFLEAARECCSRHNVQPVKVFLDKLIQTYEMMIVRHGFMLVGEPFAGKTKVLQVLADTLTLMSER-GQGGE--ERVQLRTVNPKAITMGQLFGQFDPVSHEWTDGIVANTFREFASSDTPDRKWVVFDGPIDTLWIESMNTVLDDCLQLCLMSGEIIQMSQPMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWQPLVQSWLGTLPPTLQQEDNRDLLQELFTWLVAPSLRMVRKQCKML-----------MLKLWLNTRTQLCPSDITKERYSNAPESCIFMHANSIY-----------------------------SLQASFAFSLVWSVGASCDSDGRVKFDSFLRELLTGKSKDHPLPPTVGKWECPLEERGLVYDYMYELKG-------------------RGHWVHW----NELIKNPHLGDKGTKVQDIIVPTIDTARYTYLMDLCIQHSRPLLFVGPTGTGKSVYIKNKLMNNLDKERYLPFFVNFSAQTSANQTQNIIMSKLDKRRKGVFGPPMGKRSVIFVDDMNMPALEKFGAQPPIELLRQFFDHGNWYDLKDTSKIR-LEDLQLLAAMGPPGGGRNAVTARFLRHFNICTINSFSDETMVHIFSSVMAFYLRNNDFPPEFFSVGNQIVSATLEVYKKAMQNLLPTPTKSHYTFNLRDFSRVIQGVLLLRREAADGRRSMLRLFVHEVYRVFHDRLVDDQDRRWLYGLSRDLLRDHFKESFDAVFEDLKEEGRPLCQEDMRKLMFGDYMNPDLMDEERLYAEVPSVQQFSSVVEQCLEEYNQTHKNRMNLVIFGYVLEHLSRISRVLKQPGGHALLVGVGGSGRQSLTRLATAMSGMALFQPEISKSYGHTEWREDVK 2299          
BLAST of Dynein heavy chain axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009595.1 (pep scaffold:Pmarinus_7.0:GL478108:144315:184457:1 gene:ENSPMAG00000008659.1 transcript:ENSPMAT00000009595.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1293.49 bits (3346), Expect = 0.000e+0
Identity = 740/2192 (33.76%), Postives = 1205/2192 (54.97%), Query Frame = 2
Query: 6260 VESWFLFSLIWSFGASCDTDSRKKFDTYLRR-----------KMSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMP-ALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLYGDFMSVAI--ENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRG-LMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHE-WSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIK-LSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGG-SVKAQDLPNPAPEWISDRVWNEILTLASLP--AFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFS-KKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTD-----VPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYR---------QISPLTDHTGYM--AYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAG-GKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWP-EITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            +E  FL +L  S GA+   ++R  FD++++            K S Q   LP  +   +++Y FD                         WV W   VP Y+    +++ DI+VPT+D VR   + EQ++ +++PV+ VG +GT KT +  + L        +   I FS++T++   Q  +++ ++KR K  +GPP+GK ++ F+DDLNMP  ++ +G+Q PI L++   +    YDR      ++L D+ ++ +MG  GGGRN +  R +  F +       E+S+  ++ +IL+   +    E+    + L    + +Y A  S++ PTP+K HY FNLRDLS+++QG+ +  PE  T+V  ++RLW +E  RVF DRL+N  D+   +  +   L   F    E V   +P+L+GD+ S     E + Y +  +Y+    + +E LE++N   T  MNLVLF DA+ HV R+ R +R   G+ALL+G+GGSG+QSL++LAA+ A    F+I LS+ Y  +  RDDLK +    G+E KP  FLF+D  + +E FLE +NN+L +G VP L+  D+ E + G ++      G    + +++  +  +   NLH V+ MSP G+  R R R FP LVN   IDWF  WP++AL +VA  FL     +   +   RG ++     +H SV ++S +++++L R NYVTP +YL+ L  ++++   K   +     R + GLDKL      + +L E L   K  L        A  EEI R +E   E + +   +      + +   + + +A+  L  ALPALQ +  +L++L+K+D+TE+R+   PP+ V+ V E + +M+  K             +  W A KG++ +   FL +L   D D I    ++ I   + S   T   +  +SRA   + ++V A+  Y  VA+ + PKR+ + R  ++  Q+K+ L+  +A+L  +++ +  L  K EA    +++L+ ++++ E RL  ADKLI GL +E  RW   +  L      ++G+ L+SA ++ Y G F+ E+R++M  + W   ++   +P +       + T  D V+I  W  +GLP D LS++N ++   + R+PL IDPQ QA  WI+  +++N L V+   +D DFL+ LE AI++G P L ++V + +DP ++ +L +    QQG   + LGD  + Y   FR Y+ TKL NP  +P +  K  ++N+T++  GLEDQLL ++VA ER +LE+ + +LI   +  ++ LKE+ED +L  L+ + G+ +D+ +L+ TLE +K K+ E+  K+ +AE+T  DID  R  Y P A R  +LFF +AD+A++  MYQYSL  FL +F   +  +     L +R+ NI +  T ++Y+  C  LFEKHKLLFS  +A R+ Q E ++  +E  F L G  S++      P  +W+ ++ W +++ LA +   AF+  P+  + +    + + FD   P +  LP  +      FQ LLVLRC R+D+V  A+ D+VA  +GER+++P   +L  V + SSPT+P++F+LS G+DPA DL K A+   FS  +L  +++GQGQ   A +L+ +A+ RG W+  QNCHL P W+  LE+ +E I K   H DFRLWLT+ P+P FP+ ILQ   K+  EPP G+K NL  +Y   S + L+S   +  +R L+ +L  FH V+ ER+K+G LG+N+ Y+F + D ++C+  L  +L++  +     +P+  L+Y  G + YGGR  D +DRR +   +  +        D+++    ++          ++ P      Y+  A + SLP+ +TPE+FGLH NA I +      ++   L+ LQP+    G G SR+E +  V+++I   +P  F +    KR   +   +   VL+QE+ R+N LL  +  SL +L KA+ G V MS  L+ ++ +L++  +P  W   A  +LK LA+W++  HQR      W+++G P V W+SG   P+++LT  +Q   RK    +D  +   +V     P E+TE P  GC++ GLFLEGA WD+    L  S+PK L  ++PV+ +IP  +  +        PVY T TR   +         VF  ++ T K   HW+ +GV 
Sbjct:  160 LECHFLEALYCSLGATLLEEARATFDSHVKGLSAMTTVADDLKTSAQPGELP-GQCPTLFEYHFDR--------------------ESQSWVPWSRLVPAYVYDAQVRFCDILVPTVDTVRTSWLLEQMVRTRRPVLLVGESGTSKTATTHNFLKGLDSDTTLLLPINFSSRTSSLDVQRSLEASVEKRTKDTYGPPVGKRLLIFMDDLNMPRVVDEYGTQQPIALLKLLLERGSLYDRGKEMTCKTLRDLGYVAAMGKAGGGRNQVDPRFLSLFTVFHVTFPSEESLHYIYASILRGHTLMFSEEVRAACDRLTSCTLQLYHAAVSELPPTPSKFHYIFNLRDLSRIYQGLCLTTPERFTTVGHMVRLWRNECLRVFHDRLINTDDKILVERHVRRLLEEHFPHDVE-VTMRDPILFGDYRSALSPGEPRLYEDIQDYEAARALFQEILEEYNSSETP-MNLVLFEDALEHVTRVHRTLRMERGHALLVGVGGSGKQSLSRLAAYAAGCQVFEITLSRGYNESSLRDDLKALYTRLGVEGKPTAFLFTDAHVVEEGFLELINNMLTAGIVPALFPDDEKEALIGQVRDEAARAGCGPARESVWHYFVSKCASNLHIVLAMSPDGDTLRTRCRNFPGLVNNTCIDWFLPWPEQALLAVAQSFLAGENPMIPGDH--RGAVVSHVVSVHCSVGDFSVQFQRKLRRSNYVTPKNYLDYLATYTRLLEEKDLYILGQCQRLEGGLDKLAEASVQLAELNERLAEQKVVLAAKSLACDALLEEISRSTETVNEKKQLAEEKAREIEDQNRVIAVEKGEAEEALTAALPALQAARRALQELDKSDVTEIRSFATPPKQVQTVCECILLMRGHK-------------EVSWKAAKGMMSE-SNFLRNLMEMDCDAIGQGQVKLIRGILKSLGTTYEEMVPISRAGAGMLKFVEAVMGYCEVAREIKPKRDKVARLERDFYQSKRELERIQAELATLQEELAALGSKYEAAMSERQQLQAENEVMERRLLAADKLISGLGSENARWTSELQELRQRRVRLLGDCLLSAAFLCYSGAFSWEFRSAMLSDAWEKEVREREIPLSQPFRVESLLT--DDVEISRWGSEGLPPDELSVQNGILTTHASRFPLCIDPQQQALNWIRRKEQKNNLKVVSSFNDPDFLKQLEMAIKYGFPFLFQDVDDYIDPVIDNVLERNIKGQQGRQYVVLGDKEVDYDPSFRLYLNTKLANPRLSPSIFGKAMVINYTVTLKGLEDQLLSVIVAFERSELEEQRERLIQETSHNKRLLKELEDSLLRELATSTGNMLDNAELVLTLEDTKAKATEVAEKLALAEKTALDIDRLRDGYRPAAKRGALLFFSLADMAQVSGMYQYSLSAFLGVFDLSLRKSLPDTVLPKRLVNITDTLTHNIYNYGCTGLFEKHKLLFSLNMAIRLEQAEERVPQSELDFFLKGNISLEKSARARPF-DWLPEQGWQDVVQLAEVSPDAFASLPDH-VERNGQAWGQWFDLDTPEQAPLPDGYAHSLSAFQHLLVLRCFRVDRVYRAISDYVASTMGERYVQPPVVNLEGVLEQSSPTSPVVFILSAGSDPAGDLAKLAERTGFSGSRLKMLAMGQGQEKAALQLLGHAVSRGHWLMLQNCHLLPRWLKELEKALEGISKP--HPDFRLWLTTDPTPSFPIGILQRSLKVVTEPPNGLKLNLRATYFRVSHEALDS-CPHPAFRPLVYTLAFFHAVVQERRKYGKLGWNVSYDFNESDFQVCMEILCTYLSKAHEQANGRIPWASLKYLIGEVMYGGRAIDSFDRRILTTYMDEYLG------DFLFDSFQVFHFFCNSETDYRLPPDGPKDAYIVTAEVESLPLANTPEVFGLHSNAEIGYYTQAARDMWRHLVDLQPQTGETGSGVSRDEFISGVARDIQARLPLPFELGQTRKRLGAVLSPTA-VVLLQEMQRFNALLQRMARSLAELQKALAGEVGMSGELDEVARALFNGTIPAIWRRLAPDTLKSLANWMVHFHQRHQQYSAWVEDGEPTVMWLSGLHIPESYLTALVQATCRKNGWPLDRSTLYTQVTTFRGPEEVTERPGQGCFVSGLFLEGADWDVEASCLVRSKPKVLMVQLPVLKIIPIESHRLKLQSTLRTPVYTTSTRRNAM-----GVGLVFEADLFTTKHPSHWVLQGVC 2293          

HSP 2 Score: 117.472 bits (293), Expect = 6.560e-26
Identity = 57/149 (38.26%), Postives = 93/149 (62.42%), Query Frame = 2
Query: 5669 KRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPH-RERVQKLFDVYLEETVDFMRHN---------LREIVPTTNGQLTFNMIKLMDSFIY 6085
            +R+ +FDG VDA+W+ENMN+V+DDNK L L++GE I+L     ++FEV DL  ASPATVSRCGMVY++P  L   P+ + W+ S P  +  H +  +Q+LF+ Y+   ++ +            L+ IVP T+  +   +  ++++ ++
Sbjct:    1 RRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNTCALLFEVGDLQYASPATVSRCGMVYVDPKNLEYQPYWQRWLNSRPAKVRLHDQAELQRLFEKYVPSCMEMIVDGVVDGRQGEPLKTIVPQTDLNMVSQLCAMLNAVLH 149          
BLAST of Dynein heavy chain axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001372.1 (pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001372.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1122.84 bits (2903), Expect = 0.000e+0
Identity = 706/2106 (33.52%), Postives = 1125/2106 (53.42%), Query Frame = 2
Query: 3302 AGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSD--EINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPD----ARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDL--EITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGL--VNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALET-----RDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEE--NLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELI-LKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQL---IFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDM--KYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTI--LKFWIMRAVAE-LHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKI-EPLLYGDFMSVAIEN-------------KKYVEFVEYDKMLKVIEENLEDFNQ-INTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQ--SLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIV--QDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIP---ELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALK 9475
            A KE  IE  L ++  EW+   F   ++K  G  +L+  +  EI   ++D +++  S+  + Y  PF+ +I KW + L  T D+I+ W+  Q  W+YLE +F   DI +QLP E KR++ +D+ W KIM  A +  +V+  C       +LL +L E    LE  QK L+ YLE KR  FPRF+F+SD  LLEIL Q  D   +Q HL   F+NI  ++F + +   I A+ S EGE +  +K     GNVE W+  +    ++SL  +I      V        E++  +P QV + G Q  WT++  +AL       + +       L  L+ L ++   D++ + R+    LI I VH RD+ +++   +I++  DFEW+ Q R+Y+ E+   L +   +  F Y  E+LG T RLVITPLTDRCY+TL  AL +  GGAPAGPAGTGKTETTKD+G+      VVFNCSDQ+DF  +G+ FKGLA +G+W CFDEFNRID+ VLSV AQQIA +   +++R  +F F   +L+ + P   +F+TMNPGYAGR ELP+NLK  FR VAMMVPD  +I  + L S GF D   L++K  T +KL  EQLS Q ++ +G+  V   +     + + +T+   +L C+R+ + V++ K + +D  LF  ++ DLFP I  +   Y  L  +I     + GL     +  K IQL+ET  VRHG+M +GP+G+GKT C   L  A++         GSP + +    +NPK+IT  Q++G  D+ T++WTDGI STL R+   A   +  W + DGPVDA+WIEN+N+VLDDNK L L++G+ I +     ++FE  ++  ASPATVSR GMV++  S+L  +P +E W++         RE ++ L+     E   +  H+           L+F M  L ++F+                          + N+   L P K    +   ++  E + ++       ++F+L+WS  A  + D R++ + +LR   S +L      P  E+ + +DY     G                     +WVHW + V EY    D   +Y+ I+VP +DNVR   +   +    K V+ +G  GT KT+ +   L+KY P  ++++ + FS+ TT    Q  I+S +DK+    +GPP GK +  FIDD+NMP +  +G Q   E++RQ  + +G+Y+ +  GEF ++VD+ F+ +M  PGGGRN I QRL R  ++         S+  +FG I    +   R   E +  L   LV A   ++   + +MLPTPAK HY FNLRDLS+++QG+L    + ++S + +LRL+ HE  RV  DR    +D +WF+  L    + +      + + + E   + DF+  A E              K Y     YD++   +   L+ +N+ +  A+M+LV F DA+ H+ +   ++   + N  L+   G   Q  ++  +  H A++  F +  S +Y  +   +DLK +   AG + K I FLF+D +IKDE+FLE +NN+L+SG+V NL++ D+++ I  ++ P++  Q      T+ NL   +  RVR+NLH V+  SP+GE FR R  +FPAL++ CT+DWFS+WP++AL +V+  FL+       +EV +EV+  +      + +  ++Y +++R    R  +VTP SYL  +  +  +Y  K  E++   +R + GL KL    E V  L  ELE+ + +L+ A E++    +E+   ++ A++ ++ V + +  A +      + +  A++ L  A PAL+E+  +L+ + ++DI  VR + RPP  +  +++ V ++   +   ++ D     +   W     L+   G FL SL  + KD I++ +++ + PY     +      KV      +C W +AM  +  + K V P +  L      L      L+ A+A+L A +  +  +Q   E   R ++EL + ++ C  ++  A  LI GL+ EK RW +        I  +VG+VL++  +++Y G F  E+RN +  EW   LK
Sbjct:    7 AVKERDIEFKLKQVVAEWDGKTFTFGNFKTRGELLLRGDNTTEIIATMEDSLMVLGSLMSNRYNAPFKSQIQKWVSNLSNTTDIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMNNVVQCCVGDETMGQLLPHLLE---QLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVEFHEKVYDRILAVCSREGETVQLDKPVMADGNVEVWLNALLKESQQSLHGVIRSAALAVQDSAFSLIEFLDSYPAQVGLLGIQLLWTRDSEEALANARYNRKAMPQTNQAFLVLLNRLISMTTQDLSAVERIKYETLITIHVHQRDIFDDLCRMHIKSPTDFEWLKQCRFYFKEDVDKLIVWITDVSFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRSQFTFTDGDLVEMNPEFGIFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFLDNIVLARKFYTLYKLCEEQLSKQVYWVYGILEVMYSLKTCKAMGKAHTSSTAQLFCIRSYRRVSMMKVIDEDEPLFLSLIDDLFPGIALDKAGYPQLEAAINRQVEQAGLVIHAPWKLKVIQLYETQCVRHGMMALGPSGAGKTTCIHTLMRAMTEC-------GSPHREMR---MNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTTRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGWLKQRSPQ---ERETLRSLYAKSFLELYRYAAHS-----------LSFKMDTL-EAFVIV-----------------------QSLNMLQGLIPSK----DHGGEVTPEHLGRL-------YVFALMWSVCAYLELDDRRRMELWLRSHESMRLDLPAVSPHGEDSM-FDYMVGADG---------------------QWVHWSSRVEEYAYPGDHTPEYNSILVPNVDNVRTDFLIHNIAKQGKSVLLMGEQGTAKTVMLKGYLSKYDPETHLAKNLNFSSATTPLMFQRTIESYVDKKMGTTYGPPAGKKLTVFIDDINMPIINEWGDQVTNEIVRQLMEQRGFYNLEKPGEFTNIVDVQFVAAMIHPGGGRNDIPQRLKRQLSIFNCTLPSNASIDKIFGVIGTGHYSAARGFTEGVRALAAQLVPATRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGLLNTTADVVSSPELLLRLFKHECERVIADRFTCAEDTDWFEERLAAVASEELGAAAGEALAVGERAFFVDFLRDAPEATGDEPEDADFDMPKIYEPIASYDELRDRLNFFLQQYNESVRGARMDLVFFTDAMLHLVKFIPVL--GVTNLTLMTFDGHSLQDWAVPGVVRHDAQHIQFDLTFSTSYSTSNLLEDLKVLYRVAGQQGKGITFLFTDNEIKDEAFLEYMNNVLSSGEVSNLFARDEMDEILSELAPVMKKQHPRRPPTQENLHEFFMTRVRLNLHVVLCFSPVGERFRTRALRFPALISGCTMDWFSRWPKDALVAVSEHFLSSYTMDCTVEVKQEVVACMGSFQDGVAEKCTDYFQRFR----RSTHVTPKSYLSFVQGYKTVYKEKHTEVQTLANRMQMGLQKLKEASESVAGLSVELEMKEKELQVANEKADKVLKEVTVKAQAAEKVKMEVQKVKETAERIVDSISVDKAVAEKKLVAAKPALEEAEAALQTIKQSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNPVRMDPERGCVTPSWQESLKLMT-AGNFLGSLKQFPKDTITEEMVELLHPYFDMPDYNIDTARKVCGNVAGLCSWTKAMAYFFGINKEVLPLKSNLVVQQGRLNIAMGDLQSAQAELDAKQAELDLVQAGYEKALREKQELMDDAERCRRKMQTASGLISGLAGEKERWTNMSKEFAAQIKRLVGDVLMATAFLSYAGPFNQEFRNLLLGEWQRELK 2021          
BLAST of Dynein heavy chain axonemal vs. Ensembl Yeast
Match: DYN1 (Cytoplasmic heavy chain dynein; microtubule motor protein; member of the AAA+ protein family, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p; motility along microtubules inhibited by She1p [Source:SGD;Acc:S000001762])

HSP 1 Score: 387.497 bits (994), Expect = 1.090e-107
Identity = 311/1135 (27.40%), Postives = 550/1135 (48.46%), Query Frame = 2
Query: 2606 IRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMS----------VASMVSYNDITKAHEVANE-VRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEI--------ISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSE-DINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKSTYPTGNVE--EWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVL-KWPGQVVIAGCQTYWTQEVSDALETRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEF--------PYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQ---GVTANGPDKR-WYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVE 5905
            +R S+  VEQ L    ++ R +    +    E ++NL+ S          ++  ++  +  K  E  NE + ++ K++    A A       ++   PV   ++L+ +V++ + +  +W ++ +  +        P   VD  +++  +  F +   +  +   +    + +  Q+ +     K  + L  G     ++ RHW M+  ++G   + K+ L     LE  L+D + +        ++KI E A KE+ IE++LN++   W+  ++EV+ + ++G  +++  D + Q   + +    SM  S Y K FE+     E+ L    ++   W++ Q  WL L  I     DI   LP+E  ++ ++   ++ I   AF   + I +       T LK     L+ ++  LS +LE +R+ FPRFYFL +D+LL+I+   K    V   ++K F +I  + F +D  IT + S EGE +   +      +++  EW+  ++  ++ S+       L   K     E V+ K+  Q ++   Q  WT+ V   L+T      + ++  ++ GL   +      + +  + AL+V  +H  +V+  +   + +      W    ++Y  ++N  +  +N+ F         Y +EY+G   RL+ TPL    + TLT +LH K+GG   GPAGTGKTET K  G+      VVFNC D  D+  + +   G+   GAW CFDEFNR+D +VLS V+  I  IQ   Q           E  L P  AVFIT+NPGY GR+ELP+NLK  FR  +M  P    IAE+ L   GF D+++L+ KIV   +L S + SS +HY FG+R +K V+     L  +    + E   + +++ V +P     D  +F   +S +F +    P++   ++  ++ A ++ G      F+ KC+Q +     +  L+LVG  G GKT  ++ +  A++        DG        YV++ K +T   LYG     T EW DG+ ++++R+    +T    + R W +FD  +D  ++E MN+VLDDNK L L +GE + +     ++FE  +L   +PAT++RCG+++    +  ++  ++
Sbjct: 1128 LRQSLSYVEQEL----QKHRVVIAKSLEEGVENINNLSQSLNESWSVRKPISPTLTPPEALKILEFFNESITKLKKKMHSVAAAA-------KMLLIPVVLNDQLTHVVEEVKTYDLVWRSIKNLWEDVQRTFETPWCRVDVLLLQSDLANFLRRADELPRAVKQFEMYKSLFSQVNMLTSVNKILVELKDG----ALKPRHWNMIFRDIGKRQIQKNLL---DKLEFSLKDVMVLNLTLNEILLTKIIERAQKEFVIEKSLNRIKKFWKEAQYEVIEH-SSGLKLVREWDVLEQACKEDLEELVSMKASNYYKIFEQDCLDLESKLTKLSEIQVNWVEVQFYWLDLYGILGENLDIQNFLPLETSKFKSLTSEYKMITTRAFQLDTTIEVIHIPNFDTTLKLTIDSLKMIKSSLSTFLERQRRQFPRFYFLGNDDLLKIIGSGKHHDQVSKFMKKMFGSIESIIFLEDF-ITGVRSVEGEVLNLNEKIELKDSIQAQEWLNILDTEIKLSVFTQFRDCLGQLKDGTDIEVVVSKYIFQAILLSAQVMWTELVEKCLQTNQFSKYWKEVDMKIKGLLDKLNKSSDNVKK-KIEALLVEYLHFNNVIGQLKNCSTKEEARLLWAKVQKFY--QKNDTLDDLNSVFISQSGYLLQYKFEYIGIPERLIYTPLLLIGFATLTDSLHQKYGGCFFGPAGTGKTETVKAFGQNLGRVVVVFNCDDSFDYQVLSRLLVGITQIGAWGCFDEFNRLDEKVLSAVSANIQQIQNGLQVGKSHITLLEEETPLSPHTAVFITLNPGYNGRSELPENLKKSFREFSMKSPQSGTIAEMILQIMGFEDSKSLASKIVHFLELLSSKCSSMNHYHFGLRTLKGVLRNCSPLISEFG--EGEKTVVESLKRVILPSLGDTDELVFKDELSKIFDSAG-TPLNSKAIVQCLKDAGQRSGFSMSEEFLKKCMQFYYMQKTQQALILVGKAGCGKTATWKTVIDAMAIF------DG---HANVVYVIDTKVLTKESLYGSMLKATLEWRDGLFTSILRRVNDDITGTFKNSRIWVVFDSDLDPEYVEAMNSVLDDNKILTLPNGERLPIPPNFRILFETDNLDHTTPATITRCGLLWFSTDVCSISSKID 2227          

HSP 2 Score: 353.599 bits (906), Expect = 1.637e-97
Identity = 317/1358 (23.34%), Postives = 633/1358 (46.61%), Query Frame = 2
Query: 6557 DIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLD--KRRKGVFGPPMG--KYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGG-GRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLM-LEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKL-----NSDFNQKYEDVVKIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQA-TKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSE----EVIRGLMYM--CKEIHQSVSN----YSEKYRQELS-RYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKAT-------KEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKI--EPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPH-TDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSR-RWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKN-GITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLL 10525
            DI++PTID ++   I   LL SK+ ++  GP G+GKT+ +++ L      + +   I FS  TT       +    +     KG+   P    K ++ F D++N+P L+ +GSQ  +  +RQ  + +G++ +    ++ ++  I+ + +  PP   GR P+++R  RH  +L        S+  ++    K  I + V E     E   +A + +Y   +++   T  +SHY F+ R+L+++ +G+   +      ++  ++RLW +E+ R+F DRLV  +++  F+ LL   +     N D        +    LL  DF  V       V F+E ++     +E LE         + +V+    V H+ RI R ++Q  G+ +L+G   +G+  LT+  A +      Q ++ ++  ++++   LK+ +    L+      +  ++ I + +FLE +N +L + D+P+L+  ++ +++  +++   + LGL   T+  L+  +   +  NLH V T+        + +   PAL N C I+W   W  + +  VA   ++ IP +E ++    EV + L++    + I  +V N    +   + Q++    N  +P  +++ L    K+   K Q+L++ +     GL+KL  +   V +L + L     +L +  +E+++T       + E ER  E  +E + ++  +E    K+       ++   + + +  P + E+   +K + K  +TE+R+M+ PP GV++V+E VC +             G +  ++ D  + + +D   F+ ++ +YD        I+K   E +++  +FT   I + S+AC  + QWV A   +  V + V P R+ ++R   E  +TK  L  A    + +E  I   + K     R  + ++ +    +A L R+  L+  L+ EK RW ++          ++GN +IS+ Y  Y G      R  M       L  + V +  +    + + T  + +K   W   GL K+   +EN  IV  S+   P  +DP       I N    N   ++   ++ F++ LENAIRFG   ++++ GE  DP +  ++ ++       V +++GD  +    DF+ +I +  P+      + ++V +V+F  +   +E ++  + + EE  +++  +  LI  N + + +LK +E ++L  L+ ++G+ +++ +L+ TL   K ++  IE K+  +E+     D     Y  +   +  +F  +    +    Y  S+  FL+ FK   I  + +      R+D I       +Y     +L +K K++ +  +
Sbjct: 2389 DIVIPTIDTIKHEKIFYDLLNSKRGIILCGPPGSGKTMIMNNALRNSSLYDVVG--INFSKDTTTEHILSALHRHTNYVTTSKGLTLLPKSDIKNLVLFCDEINLPKLDKYGSQNVVLFLRQLMEKQGFW-KTPENKWVTIERIHIVGACNPPTDPGRIPMSERFTRHAAILYLGYPSGKSLSQIYEIYYK-AIFKLVPEFRSYTEPFARASVHLYNECKARY-STGLQSHYLFSPRELTRLVRGVYTAINTGPRQTLRSLIRLWAYEAWRIFADRLVGVKEKNSFEQLLYETVDKYLPNQDLGNISSTSLLFSGLLSLDFKEV--NKTDLVNFIE-ERFKTFCDEELE---------VPMVIHESMVDHILRIDRALKQVQGHMMLIGASRTGKTILTRFVAWLNGLKIVQPKIHRHSNLSDFDMILKKAISDCSLKESRTCLIIDESNILETAFLERMNTLLANADIPDLFQGEEYDKLLNNLRNKTRSLGLLLDTEQELYDWFVGEIAKNLHVVFTICDPTNNKSSAMISSPALFNRCIINWMGDWDTKTMSQVANNMVDVIP-MEFTDFIVPEVNKELVFTEPIQTIRDAVVNILIHFDRNFYQKMKVGVNPRSPGYFIDGLRALVKLVTAKYQDLQENQRFVNVGLEKLNESVLKVNELNKTLSKKSTELTEKEKEARSTLDKMLMEQNESERKQEATEEIKKILKVQEEDIRKR-------KEVVMKSIQDIEPTILEAQRGVKNIKKQQLTEIRSMVNPPSGVKIVMEAVCAI------------LGYQFSNWRDIQQFIRKD--DFIHNIVHYDTTLHMKPQIRKYMEEEFLSDPNFTYETINRASKACGPLYQWVNAQINFSKVLENVDPLRQEMKRIEFESLKTKANLLAAEEMTQDLEASIEVSKRKYSLLIRDVEAIKTEMSNVQANLDRSISLVKSLTFEKERWLNTTKQFSKTSQELIGNCIISSIYETYFGHLNERERADMLVILKRLLGKFAVKYDVNYRFIDYLVTLDEKMK---WLECGLDKNDYFLENMSIVMNSQDAVPFLLDPSSHMITVISNYYG-NKTVLLSFLEEGFVKRLENAIRFGSVVIIQD-GEFFDPIISRLISREFNHAGNRVTVEIGDHEVDVSGDFKLFIHSCDPSGDIPIFLRSRVRLVHFVTNKESIETRIFDITLTEENAEMQRKREDLIKLNTEYKLKLKNLEKRLLEELNNSQGNMLENDELMVTLNNLKKEAMNIEKKLSESEEFFPQFDNLVEEYSIIGKHSVKIFSMLEKFGQFHWFYGISIGQFLSCFKRVFIKKSRETRAARTRVDEILWLLYQEVYCQFSTALDKKFKMIMAMTM 3702          

HSP 3 Score: 60.8474 bits (146), Expect = 5.933e-9
Identity = 56/230 (24.35%), Postives = 98/230 (42.61%), Query Frame = 2
Query: 11006 YKFADDMKFSKK-LSAISLGQGQGPR-AEELIKNAMERGKWVFFQNCHLAPSWMPS-LERLVEQIDKDKVHRDFRLWLTS-MPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYT--DVPFKVLQYTAGHINYGGRVTDDWDRRCV----MNVLSGFYNPQVM 11665
            +K  +  K SK+ L  I LG  +    A+E I  +   G W+  QN  ++ SW+ + L + VE+    + H  F++++T  +   K P  +LQ   +   E   GI   +   + S    F           +    L  FH ++  R +  P GF+  Y F D D +     L   L   +  ++P+  ++     I YGG++ ++ D   V     +V  G  N Q++
Sbjct: 3798 FKLIELAKASKESLKIIPLGSIENLNYAQEEISKSKIEGGWILLQNIQMSLSWVKTYLHKHVEETKAAEEHEKFKMFMTCHLTGDKLPAPLLQRTDRFVYEDIPGILDTVKDLWGS---QFFTGKISGVWSVYCTFLLSWFHALITARTRLVPHGFSKKYYFNDCDFQFASVYLENVLATNSTNNIPWAQVRDHIATIVYGGKIDEEKDLEVVAKLCAHVFCGSDNLQIV 4024          
BLAST of Dynein heavy chain axonemal vs. Ensembl Nematostella
Match: EDO45806 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRR2])

HSP 1 Score: 3068.1 bits (7953), Expect = 0.000e+0
Identity = 1685/3806 (44.27%), Postives = 2358/3806 (61.95%), Query Frame = 2
Query: 1568 KGWFNIYETDFYVYTKSK----------LKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPD--MLDEQQEVIDK-----CLTDYELIEEFYYNLSNDDFNAKWTM--VGWPHK--IRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFE---KSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALE--TRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYP-HRERVQKLFDVYLEETVDFMRHN-LREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQL--------------------IFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVA------ELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVK--------------IEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPI--VQDLGLQ--ATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKI-QGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKI-EPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTK-------KILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAA--LKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKF-SKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSY----TSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTED-YIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            K WF   +  +Y   K K          L+ F       M + ++ L L+S++++  +       C              +SS+   ++P F++ LVL+     +      F +V +N++D  I+A+  VP++E  +  + S     L   +   E  V + +  +   ++  +   + +   Y+K+ +L  +     V++FL     + H       EVEK     + ++    + I +G F ++ + + + LAK+   +   +L  ++++ +      CE ++ I  K    P   E L EL+ +I  + +  + D ++ +++       L DY         L+N  F   + M  V   HK  +  + +Q E +L    ERF    V ++ +++++L+          ++ D+++      + + +H++L  A    V FN  E  F    T+Y +  +L+    P+  L+    ++   +   M  P   +D + VE     ++++++K  K   E+P  Q +AG++K  +EEFK ++PL+Q + NPG+R RHWE +S+ LG  + P   +  +K  EM L+ ++     I+E A KE+++E+A+ KM GEW+A++F ++ Y+ TGT+IL   D+I  LLDD IV TQ+M  SP+ KPFE  I +WE  L  TQ++IDEWL+ Q  WLYLEPIFSS DI  Q+P EG+R++T+D+ WR+ MK A  +  V+T+    ++L  LK+ N+LLE + KGL+EYLE KR  FPRF+FLS+DELLEILS+TKDPT VQPHL+KCFE IA LQF   L+IT M S EGE ++ +    ++   G VE+W+LE++  M  S+R +I + +  Y +  R +WV  WPGQ V+   Q YWT EV  A+    + L     +   Q+D +  +VRG ++K  R TL AL+V++VHARDV+  +    I + +DFEW++QLRYY+ EEN+  R ++A   YGYEYLGN+ RLVITPLTDRCY TL GAL L  GGAP GPAGTGKTETTKDL KA A QCVVFNCSD LD++A+GKFFKGLAS GAW+CFDEFNRID+EVLSVVAQQI TIQ   +   D  +FEG E+ L P+CAVFITMNPGYAGR+ELPDNLKALFR VAMMVP+YA+IAEISL+S+GF +AR+L+ KIVTT+ L SEQLSSQ HYD+GMRAVKSV++AAGNLK +    +E+++ LR+I DVN+PKFL  DL LF GI SDLFP ++    DY  L  +     +   L+ V  F+ K +Q++E  +VRHG M+VG    GKT  Y VL  ALS + ++   + +  Q V   V+NPKSITMGQLYG+FD ++HEW+DG+L+   R   ++  PD++W IFDGPVDAVWIENMNTVLDDNKKLCL+SGEII+L     ++FE  DL VASPATVSRCGM+Y+EP +LG  P +  W+ +LP  +   ++E ++ LFD   E  + F+R    +E+ PT +  L  + + +MD+                                        M +F+   +  +    ++   +E  +LFS +WS GA+ D + RK FD  LR  +   L                       PFP +  VYDYRF   G                  +   W   + + P   I  DM +++II+PT+D VR   + EQL+   KP + VGPTGTGK++ I++ L K +   Y    I FSA+TTA QTQD+I SKLDKRRKGV+GPP+GK  + F+DDLNMPA EV+G+QPPIEL+RQW D   WYD K       LVDI  + +MGPPGGGRNPIT R +RHFN +   +  + +M  +F  I+ + +    +      +  P+ + LV   +++Y      +LPTPAKSHY FNLRD ++V QG L+  P+ +T  D + RLW HE  RVF DRLV+  DR+W  N L     S  N +++ + +              +  L++ DF     + K YVE  + DK+  V+E  L++FN ++   M LVLF  A+ HV RI+R+I+QP G+ LL+G+GGSGRQSLT+LAAHMA++D FQ+E+ K Y   EWR+D+K I+          VFLF+DTQIK+ESFLED+NN+LN+G+VPNL+  D+ + I   M+     +D   Q   +   LF+ + +RVR  LH V+ MSPIG+ FR RLR+FP+LVNCCTIDWF  WP +AL+ VA +FL    E E+  +V  G + MCK  H S  + S +Y+ EL R+NYVTPTSYLEL+  F  +  +K+QE+ +A+ R + GL+KL   +  V  +QEELE ++PQL QA +E       IERDS    +T+ +V  +EAVA ++A   + I+D+  +DL EA+P L+ +L +L  L   DIT V+ M  PP GV+LV+E +CI+K VKP +I      G KI+D+W   K +L D  KFL  L  YDKDNI    I++I + Y ++  F P  I+  S A   +C+WV AM  Y         K + L  + K ++          + L + RA LK V+D++  LQEK EA  +++ +LE + DLC  +L RA+KLIGGL  EK RW +    L     N++G+VL+S+G VAYLG FT  +R   C  +S++  L  YG          LV     PVKIR+W I GLP D+ SIEN +I+  + RWPL IDPQGQAN+WIKN++K+N L VIKL+D D++R+LEN I+FG P L+ENVGEELDP LEP+LLKQTFKQ G++ IK+GD++I Y  DFRFYITTKL NPHY PE + KVT++NF ++P GLEDQLLG+VVA ERP+LE+ KN LI+ +A+ +++LKEIEDKIL  LS +EG+ ++D   I  L +SK+ +NEI  K  IAE+TE  ID+TR  Y P+AV + ILFF +ADLA I+PMYQYSL WF+N+F   I N+ K++ L +R++N+ N+FT+SLY NVCRSLFEK KLLFSFLL   IL H+G++   EWRFLL GG        NPA  W+  R W+EI  L  +  F  F ++F  + L  +K+I+DS EP    LPGEW +  D FQ +++LRCLR DK+T  +Q+FV   LG+++IEP   DL   + DS+   PLIFVLSPG+DP + L KFADD  F   KLS++SLGQGQGP A  +I+ A++ G WV  QNCHLA SWMP+LE+L E+++ D  H DFRLWLTS PSP FPV +LQNG KMT EPP+GI+AN+++SY     S  + F  +  K+ +++ +L  LC FH ++ ER++FGPLG+NIPYEF + DLRI + QL MF+ +Y +V ++ L+Y  G  NYGGRVTDD DRR ++ +L+ FY P V+ +D Y +S SG Y       D+  Y+ Y RSLP+ + PEIF +H N           ++L      Q  + + GG+S +EIV  VS++IL  MP+ F+ +   +++P  Y QSMNTVL+QE++R+NRL+ +++SSL ++ KAI+GLVVMS  LE + + +   K+P  W  K+YPSLKPL S+V DL  R+ F+Q W DNG P VFWISGFFF QAFLTG+ QNFARK  I ID ++F F+V+     E    P DG Y+ GLF+EGARWD     + ES+ K LF  +PV+WL PC    I     Y  PVYKT  R GTLSTTGHSTNFV  + +P+D+ Q+HW+ RGVA
Sbjct:  250 KRWFPEVQNIYYQGNKRKQVPSNQNAKRLEAFFNSASVLMTNQLQMLALNSISDYTELF------CPP------------SSSIRVLEHPGFIMRLVLEGDTVKFEPDFKDFEVVLLNVYDVMIKAVMVVPRVETKLYSEWSGTKKTLKPIIS--EEIVNEAKAKVHAVIEHEMAGPKEHLKFYDKYKDLITRKAEADVDQFL----LEGHKFNRFSKEVEKFAKLVDEIQYNSRKVIRVGMFELHCDELIRALAKRGDGLRTKLLQRMSKDHQVLNKMLCEEYEKIAEKALTSPANTEHLMELKNYIEQVENETIFDLEKRLVETKSRLGFLVDYASFSPADMRLNNSVFQWHFRMPEVFEEHKKIVNANRVQYENSLKMRRERF----VEELESYSKQLEEFQ-------TFGDMSEVPRYLKKAQALHQRLETAAEKIVTFNVEEEAFGWDTTSYPQRQQLINTLNPYLKLYETTVEFQNKYKEWMEGPWGTIDPDKVESETGNYWRSLYKLEKQLTEVPLAQRIAGRMKTKVEEFKEYLPLVQVVFNPGLRDRHWEQMSEILGFPLKPDEDMNLAKMAEMNLEPYLAQFETISEAASKEFSLEKAMEKMVGEWDAVEFVMIPYRETGTHILSSIDDIQTLLDDQIVKTQTMRGSPFIKPFENEIKEWEGKLILTQEIIDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFSTVDKNWRETMKVAVLDKHVLTVIGIEKMLGKLKKSNELLELILKGLNEYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLQFTDTLDITHMKSSEGELVLLKDVISTSKARGQVEKWLLELQEDMVASVRKVIMEAMEAYLKEERVKWVRDWPGQTVLCVTQYYWTAEVHKAIRGGQKQLDQYLQQNNSQIDDIVTLVRGKLSKQNRATLGALVVLDVHARDVLTKLCELGISSEDDFEWLAQLRYYFEEENVMTRMISAHLAYGYEYLGNSGRLVITPLTDRCYRTLFGALQLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQMGIKSGGDTLLFEGTEIKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPNYAMIAEISLYSYGFVNARSLAVKIVTTYTLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPDENEDILMLRSINDVNLPKFLAHDLPLFAGITSDLFPGVQLPKPDYTVLTAAAAEVCKSMNLQMVDEFLTKILQIYEMMIVRHGFMIVGEPFGGKTCAYRVLAKALSDVAEKGLMEENKVQIV---VINPKSITMGQLYGQFDPVSHEWSDGVLAVNYRAFASSTTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLNSGEIIQLASTTNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWKPLLTSWLHTLPKTLNEENKELIKDLFDRMEEALLQFIRKGGFKELSPTNDTNLVNSHMNMMDTL---------------------------------------MDEFHDEQRFKELNEREVAAWLECIYLFSCVWSLGATLDGEGRKSFDKLLREIVEGPLSLESKSKYHILEIVDPPPRPFLCPFPSKATVYDYRFIKEG----------------MGKWELWTEEIKDAPP--IPKDMAFNEIIIPTVDTVRYTYLMEQLVTHGKPSLFVGPTGTGKSVYITNFLLKKLEETYKPLLINFSAQTTAKQTQDIIMSKLDKRRKGVYGPPLGKKTVVFVDDLNMPAREVYGAQPPIELLRQWLDHWQWYDLKDTSPIH-LVDIQILAAMGPPGGGRNPITPRFLRHFNTISITKFDDGTMVKIFSRIMNWHLTTNASCRGFSKDFGPIGDMLVNGTLEIYRNAIVNLLPTPAKSHYLFNLRDFARVIQGTLLSAPDRITEHDMLKRLWSHEVFRVFYDRLVDGGDRDWLYNNLREVCKSHLNVEFDTLFQRLDFDGDGKVKEDDLRSLVFCDFTDAKADPKPYVEVEDLDKLRGVVENYLDEFNNMSKKPMTLVLFRFAIEHVSRISRVIKQPRGHCLLVGVGGSGRQSLTRLAAHMADFDLFQVEIGKGYTSTEWREDIKAILRKTAEGETNGVFLFTDTQIKEESFLEDINNLLNAGEVPNLFPLDEKQEICEKMRQFDRQRDKSKQTDGSPVALFNYFIERVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQSWPADALQVVAQRFLE---ECEIEADVKEGCVEMCKSFHTSTRDLSLRYQSELKRHNYVTPTSYLELISTFKALLNKKQQEVVKAKRRYEVGLEKLNSAQSQVASMQEELEALQPQLIQAGKEVDDIMVIIERDSIEVAKTEKIVKADEAVANEQAMAAKAIKDECDKDLGEAIPILESALAALNTLTPADITVVKTMKSPPAGVKLVMEAICILKGVKPDRIPDPSGSGKKIEDFWAPSKRILGD-MKFLQGLQTYDKDNIPAPAIKQIRQKYTSNPEFDPDKIKVASTAAEGLCRWVIAMDSYE--------KYDHLTTTFKSIDLLLMSVLCDFQGLNKKRAALKEVQDKLARLQEKYEANVKKKSDLEKQVDLCSKKLDRAEKLIGGLGGEKTRWTEVANALGVRYTNLIGDVLVSSGVVAYLGAFTAAFRQGTCRAYSSSGRLVEYG--------RVLVALIAQPVKIRDWTIFGLPTDSFSIENGIIINNANRWPLMIDPQGQANKWIKNMEKKNNLHVIKLTDADYVRTLENCIQFGTPVLLENVGEELDPLLEPLLLKQTFKQGGSICIKVGDSVIEYSKDFRFYITTKLRNPHYLPETAVKVTLLNFMITPEGLEDQLLGIVVARERPELEEEKNALILQSAENKRQLKEIEDKILEVLSSSEGNILEDETAINVLSSSKVLANEISEKQAIAEETEEKIDKTRMGYTPIAVHSAILFFSIADLANIEPMYQYSLTWFINLFIMSIDNSEKSEELDKRLENLRNHFTYSLYCNVCRSLFEKDKLLFSFLLCVNILMHDGEVCRDEWRFLLTGGVGLDNPHSNPA-SWLPSRSWDEICRLDDMSKFKGFRQKF-PRTLEGWKKIYDSNEPQTMPLPGEWEEKFDFFQKMVLLRCLRPDKITPCVQNFVTVKLGKKYIEPPPFDLGKAFADSNSCAPLIFVLSPGSDPTAALLKFADDQGFSGSKLSSLSLGQGQGPIALRMIEKAVKDGTWVVLQNCHLATSWMPTLEKLCEELNPDTTHPDFRLWLTSYPSPNFPVTVLQNGVKMTNEPPKGIRANIIRSYLGDPISDPEFFTGTGQKSPQFKKMLFGLCFFHALVQERRQFGPLGWNIPYEFNETDLRISVQQLHMFMNKYDEVQYEALKYLTGECNYGGRVTDDRDRRTLLTILNKFYTPGVIKDDRYKFSPSGNYYAPDD-GDYETYIEYARSLPLINHPEIFDMHANVFSLRTSMRHISVLTHQTCTQCVLLSGGGRSDDEIVASVSEDILSKMPQEFDTDAALRKFPTTYTQSMNTVLVQEMVRFNRLIKVVRSSLVNIQKAIKGLVVMSSELEEVVSGILKGKIPGLWMKKSYPSLKPLGSYVNDLLARLKFLQDWYDNGAPSVFWISGFFFTQAFLTGSKQNFARKYTIPIDLLTFDFEVLEDKKYETP--PEDGVYVNGLFMEGARWDRDTKAIGESQAKVLFDSLPVMWLCPCKTEDIKKRPHYVTPVYKTSERRGTLSTTGHSTNFVMEMRLPSDQPQEHWVMRGVA 3934          
BLAST of Dynein heavy chain axonemal vs. Ensembl Nematostella
Match: EDO34727 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNG1])

HSP 1 Score: 2892.45 bits (7497), Expect = 0.000e+0
Identity = 1635/3826 (42.73%), Postives = 2306/3826 (60.27%), Query Frame = 2
Query: 1457 EFEQTQSQATQQVSLFLKDTWIDNLQKFIRTSLRDSKKGWFNIYETDFYVYTKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYE-----AQHHTA-LEIKLEVEK-----------HLNEKEILEQLIPQYIIIGPF---YINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPD-MLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVAD----VAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHK---QLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKSTYPT---GNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYP-HRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRR---------------KMSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHW--MANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAV-AELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVV-------------KIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLG--LQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKP-KKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKI-EPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKF-SKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQ-IDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTS--FSD-DFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            EFE+   +   +   FLK TWI          L   +  W  +   +    T   +++F   V   M   +R + ++SL +FV+ +N            Y+  ND   S    +     + +  +D     ++ P  Q P      FD    A     Q+E  +  D+     PL  SV +EE  V+   +   +  K   +  + Y   Y K+ +L N      V  FL++       A+ HT  L +   V K            ++E + L + I    +  P     +N + V Q L+ +   +A+ ++  +  + R      C  +  ++ K+ E P+  ++L  L +++      M+ + Q  +D        + + Y  L  +D     T+  WP  I+  I ++ +N +      + L + D    V  + EKL+     V +     +I  A E+   V ++ +    L  A+   +  N  E L     T +  L  ++   EP+  LW    ++   H++ +N P + +++E VE+ +   ++T+ K  K F + P+ + VA  ++  I++FK  +PL+Q + NPG+R RHW  +S+ +G  I P+++ +    LE  L  H++ + +I+  A KE+ +E+A+ KM  EW  + FE + Y++TG  IL   D+I  LLDDHIV  Q+M  SP+ KPFE  I  W   L   QD+ID WL+CQ  WLYLEPIFSSEDI  Q+P EG+++  +D  W+ IM  +  +  V+       +L  L+E N+LLE++QKGL+ YLE K+  FPRF+FLS+DELLEILS+TKDP  VQPHL+KCFE IA+L+F ++ E+  M S E E + F     P    G VE+W++++E +M +SL+ + G  +  Y    R +WV +WPGQ               + LE  +         +Q+D + A+VRG +    R+TL AL VI+VHARDV   M  + + ++ DF+W+SQLRYY+ E+ + +R +     YGYEYLGN+ RLVITPLTDRCY    GA        P GPAGTGKTET+KDL KA A QCVVFNCSD LDF AMGKFFKGLA AGAWACFDEFNRI++EVLSVVAQQI TIQKA  +   +F+FEG EL+L P+C +FITMNPGYAGR ELPDNLK LFR VAMMVPDYALI+EISL+S GF +AR+L++KIV T+ L SEQLSSQ HYD+GMRAVKSV++AAGNLK +    DE  + LRA+ +VN+ KFL  D+ LF GI+SDLFP  K    DYG L+ S++    ++ L+    ++ K IQ++E  +VRHG M+VG    GKT  ++VL  A++ L       G PFQ V   ++NPKSITMGQLYG FD ++HEW+DG+L+   R   ++   D++W IFDGPVDAVWIENMNTVLDDNKKLCL SGEII++  + +++FE ADL  ASPATVSRCGM+Y+EP  LG  P +E ++ +LP+++   HRE V+ LFD  +E  ++F+RH+ +  + +++  L     +L    +         I A+   + A+R   +   N    L                             ++FS++WS G + + DSRKKFD + R                KMS Q +F   P+ G VYDY F    + S                   W +W  + +  + +I    K S++ + T D  R I   E  L  + P++ VGPTGTGK+   +  L K    +Y+   I FSA+T+A QTQD+I  KLD+RRKGV+GPP GK  + F+DDLNMPA E +G+QPPIEL+RQ  D   WYD K   +   L+D+ F+ +MGPPGGGRN IT R +RH N++  +   +++M  +F +I  +   +   A    L + +V A + VY +   + LPTP+KSHY FNLRD ++V  G L++    L   D+++RLW HE  RVF DRL++D DR+ F  ++   +   F  + + +V              I  L +GD+M+    +K Y E  +   +   +E  L+++NQ++   M+LV+F  A+ H+ R++R+++Q  G+ LL+G+GGSGRQS T+LA  MA+YD FQIE++KNY   EWRDDLK++++ AG++ KP VFLFSD QIK+ESF+ED+N ILN+GDVPN+++ D+   +   M+ + +  G  + AT   +++ +  RVR NLH V+ MSPIG+ FR RLR FP+L+NCCTIDWF  WP++ALE VA KFL    E+++S EV +  ++MCK  H+SV   SE+Y + L R+NYVTPTSYLEL+  F  +   K+ E+   ++R   GL+KL +    V  +Q+EL  ++P+L Q   E++    +IE+D+   +  + +V  +EAVA + A   + I+++ + DL EALPAL+ +L++L  L  +DI+ V++M  PP  V+LV+E VCIMK VKP +K      G  I+DYW + + +L D  KFLDSL  YDKDNI   V++KI E Y+ +  F P  I  VS AC  +C+WVRAM  Y  VAK VAPK+E L  +  EL    + L   RA+LK V D++  L ++ +A   ++KELE   DLCE +L RA+KLIGGL  EK RW ++   LE     + G+VL+S+G VAYLG FT ++RN     W     T  +P ++  + N   T GD VKIR W I GLP D  S++N +IV+ +RRWPL IDPQGQAN+WIKN++KEN L VIKLSD +++R+LEN+I FG P L+EN+GE+LDP LEP+LLKQTFKQ G   +KLG+  I Y  DF+FY+TT+L NPHY PE+S KVT++NF ++P GLEDQLLG+V A+E+P+LE+ KN+LI+ +A  +++LKEIEDKIL  LS +EG+ ++D   I+ L +SK+ S EI AK  IA  TE++IDETR+ Y PVA  + +LFFC++DLA I+PMYQYSL WF+N++   I N+ ++  L+ERI+ +N++FT S+YSNVCRSLFEK KLLFSF+L   IL+   K+D   WRFLL GG       PNP PEW+ D+ W+EI+  + LP      ++  +     +K+ +DS  P  E +P  W D+      ++VLRCLR DK+  A+QDF+   +G  +IEP T +L L Y DS    PLIFVLSPG DP + L KFA+D  F   ++  ISLGQGQGP A  +I  A+++G WV  QNCHLA SWMP LE++ E+ I+ D  H+DFRLWLTS PSP FPV ILQNG KMT EPP+G+++N+L+SY +   SD +F  +  K   W  LL  LC FH ++ ER+KFGPLG+NIPYEF + DLRI + QL MFL +Y ++P   L Y  G  NYGGRVTDD DRR ++ +LS                                +   R +  N+       H N            L D +L   P+ S  GGKS  E++EE++ +IL   P +F++E + K+YPV+Y  SMNTVL QE+IR+NRL  ++ S+LR+L KAI+GLVVMS  LE + N++   KVP  WA+K+YPSLKPL S+V DL  R+ F Q WID+G P VFW+SGF+F Q+FLTG  QNFARK  I ID + F F VM K   ++   P DG Y+ GLFLEGARWD   M + ES PK LF  +PV+W+IP           Y CPVYKT  R GTLSTTGHSTNFV  +++P+DK ++HW+ RGVA
Sbjct:  335 EFEELVVKQCARTREFLKKTWIPACANL----LYSGRSHWSYLVPGNEGEST-VLVQQFFSCVSALMSIQLRSMVINSLKDFVDFLNH-----------YQDGNDFGESYSDLR---YVMGEHSVDLTVGWWALPSPQTP------FDYP-HARTGTRQVETELFPDMRDKRLPL-RSVAVEEMLVQDYMDRAVDVFKLNTVGPQKYLNTYKKYQDLLNNKAETDVQAFLQDDPVLLALAKKHTHWLPLSTFVTKLKRIFLIGDFQKIDEFQSLSREIASLHLTVPLNMLCLNCQEVNQELSLRASKLADTMIHYVVDQNRDKNRGICRQYDEVSDKVQEMPDNTKDLVTLTQFLEKASTVMVVQLQSHVDDAGERLLFLLD-YATLPYEDIKLNSTVFHWPEHIQ-KIFELSKNRIGHR---KDLAMDDLKHRVKMYEEKLNGYNKEVEAF-RKKEIMAAEEMKKNVEKLDELGTALDAARDELMDLNTEEELLQWEPTQFPILQSMMAYKEPYEKLWRTALNFQNKHEAWLNGPFVEINAEDVEEEIGGMFRTVIKLSKTFGDSPAPRRVAESVRSKIDKFKVHLPLLQVICNPGIRERHWTQMSEVVGFDIKPEASTSLCNMLEYNLHKHLDRLEEISGSASKEFGLEKAMEKMKVEWNDMFFEFVPYRDTGVSILSAVDDIQMLLDDHIVKAQTMSGSPFIKPFEAEIKSWCEKLILMQDIIDAWLKCQATWLYLEPIFSSEDIMAQMPEEGRKFGIVDSYWKDIMTESVKDTKVLVATGQPNMLGRLQESNQLLEEIQKGLNAYLEKKQLFFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIARLEFTEEQEVVGMVSAENETVPFSTKIVPAKAKGMVEKWLIQVEEVMMDSLKKVAGDAVAAYVNTVRGKWVQEWPGQ---------------EYLEKSN---------KQIDEIVALVRGKLDPGVRVTLGALTVIDVHARDVTAQMAHDGVHSLEDFQWLSQLRYYFEEKRVIVRMITTSINYGYEYLGNSGRLVITPLTDRCYRH--GA--------PEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDFKAMGKFFKGLAQAGAWACFDEFNRIELEVLSVVAQQIHTIQKAIAEHKKKFIFEGTELVLNPTCTMFITMNPGYAGRQELPDNLKVLFRTVAMMVPDYALISEISLYSMGFLNARSLAQKIVATYTLCSEQLSSQSHYDYGMRAVKSVLTAAGNLKLRYPDDDEAELMLRAVLEVNLAKFLSQDVPLFEGIISDLFPGTKWPNPDYGVLMDSLRENCSRRNLQATDWYMKKIIQVYEMMIVRHGFMIVGDPLGGKTMAFKVLSEAMTDLNKA----GYPFQKVIYKIINPKSITMGQLYGCFDPVSHEWSDGVLANSFRDFASSTTEDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKQSLIFEPADLEQASPATVSRCGMIYMEPYQLGWKPLMESYLNTLPESLSKEHRETVRLLFDWLMEPCLNFIRHDCKFFLTSSDMHLVTCFQRLYSCLMD-------EIRAQDHAEGADRMSSQQITNWLMGL-----------------------------YIFSMVWSIGGTLNGDSRKKFDAFFRLLISGTDKDHPKPKEIKMSKQNVF---PDRGTVYDYYFVKQASGS-------------------WGNWIELTHKGKSVIPKTAKASELTIETDDTARQIFFLETFLTHEVPMLFVGPTGTGKSAITNSYLVKLPKEKYLPVNINFSARTSAGQTQDIIMGKLDRRRKGVYGPPPGKKCVMFVDDLNMPAKEKYGAQPPIELLRQLLDHGHWYDPKDTSKLE-LLDLLFVSAMGPPGGGRNDITGRFVRHANVISIDSFDDNTMNKIFTSIADWHFAKGFDATFQRLGKIVVMATMQVYKSAVDKFLPTPSKSHYVFNLRDFARVMFGTLLVPSTHLNEGDKLIRLWIHEVYRVFYDRLIDDTDRQMFFEVIKDTIKQQFKLEMDRLVGHLVPTGQKLKDEHIRNLFFGDYMAPESPDKIYDEVSDLKALTTQMEAYLDEYNQMSKTPMSLVMFKFAIEHISRVSRVLKQDNGHCLLVGIGGSGRQSATRLATFMADYDLFQIEITKNYTKTEWRDDLKKMLIKAGVDGKPTVFLFSDNQIKEESFVEDINMILNTGDVPNIFAADEKADVIEKMQTVARVEGKKIDATPLAMYNFFIDRVRCNLHVVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLE---EVDISLEVKKQCVFMCKYFHESVRMLSERYYETLRRHNYVTPTSYLELIMTFKTLLDIKRNEILALKNRYLTGLEKLEFAASQVSVMQKELSDLQPELIQTSAETEKLMVKIEQDTVEVEAKKEIVAADEAVANEAAGVAQGIKEECEGDLAEALPALEAALKALDTLKPSDISMVKSMKNPPGAVKLVMEAVCIMKSVKPERKPDPSGSGRMIEDYWGSSQKILGD-MKFLDSLKAYDKDNIPVPVMKKIREKYVTNPEFNPDNIRTVSSACEGLCKWVRAMEVYDRVAKVVAPKKEKLAAAEAELAIQMEKLNLKRAELKEVADKLQALNDEFDAMTTKKKELEANIDLCEKKLDRAEKLIGGLGGEKERWTETARLLEDRFFKVTGDVLLSSGEVAYLGPFTVDFRNECIDGWVKECTTRKIPCSESFSLNA--TLGDAVKIRAWNICGLPVDAFSVDNGIIVDNARRWPLMIDPQGQANKWIKNMEKENKLSVIKLSDANYVRTLENSITFGTPVLLENIGEDLDPILEPLLLKQTFKQGGVEYLKLGENSIEYSRDFKFYMTTRLRNPHYLPEISVKVTLLNFMITPLGLEDQLLGIVAAKEKPELEEKKNELILESAHNKKQLKEIEDKILEVLSSSEGNILEDETAIKVLSSSKVLSEEISAKQEIATATEKEIDETRNGYKPVATHSSVLFFCISDLASIEPMYQYSLTWFINLYLQSILNSERSPELSERIEFLNDHFTQSIYSNVCRSLFEKDKLLFSFILTIGILKGRNKVDDQVWRFLLTGGVALDNPYPNPCPEWLGDKNWSEIVRASDLPNLKGLKDDLANP---GWKKFYDSSTPQSESMPDPW-DLLSGLDRMVVLRCLRPDKIVPAVQDFIVENMGRSYIEPPTFNLQLSYDDSHCCAPLIFVLSPGADPMAGLLKFANDKGFGGNRIQTISLGQGQGPIAAGMIDQALKKGTWVVLQNCHLATSWMPKLEKICEEVINPDDTHQDFRLWLTSYPSPDFPVSILQNGVKMTNEPPKGLRSNILRSYLNDPISDSEFFTACNKPAAWEKLLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISMRQLQMFLNDYDEIPLDALTYLIGQCNYGGRVTDDKDRRLLVCLLS--------------------------------ICVCRDIVDNEK------HKN------------LFDCILLTLPRQSGGGGKSPAEMIEELAADILSKFPPLFDLEMVIKKYPVIYTDSMNTVLRQELIRFNRLTAVVISTLRNLQKAIKGLVVMSGELEDVFNNMLLGKVPAVWAAKSYPSLKPLGSYVTDLLDRLKFFQDWIDHGPPNVFWMSGFYFTQSFLTGARQNFARKYTIPIDHVGFEFNVM-KEERDMDHKPEDGVYVNGLFLEGARWDRETMLVAESLPKILFDTLPVMWIIPGEKSKFKSKPNYPCPVYKTSARRGTLSTTGHSTNFVMFVDLPSDKTERHWVNRGVA 3969          
BLAST of Dynein heavy chain axonemal vs. Ensembl Nematostella
Match: EDO31800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWW2])

HSP 1 Score: 2598.93 bits (6735), Expect = 0.000e+0
Identity = 1448/3505 (41.31%), Postives = 2105/3505 (60.06%), Query Frame = 2
Query: 2480 LDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQV----EQNLLEDE---ERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNT-GTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLE-------------------------ITAMFSGEGEKIVFEKSTYPTGNVE------EWMLEIENM---MRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEE--NLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPH-RERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTL---SISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQ-KYEDVVKIEPLLYGDFMSVAIE--NKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGL-QATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRG-LMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTL-SIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAG-GSVKAQDLPNPAPEWISDRVWNEILTLAS-LPAFSKFPEEFIHK----YLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQI--DKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKM-STAGGKSREEIVEEVSKEILQGMPEIFNIE---------DISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMV------------------KAWP--EITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            LDE QE ID    +   I+E Y  + N         +     +R ++  V    +++L E +   ++F      D+    + +  +          +  +K+  +   ++ +  ++      A  + + ++ F   VT +E+L ++  +    ++LW ++ +W +            ++ E +  +V ++ KT+   +++   LP    V   +K  +E  +  +P+I  LRNP ++ RHW+ +          +  LT     ++   +H E I +++  A  E ++E  L K+   W++ +F VL ++++   +IL   D+I  +LDD ++   ++  S +  P   R+ +W+  L    + +DEW+ CQR WLYLE IFS+ DI RQLP E K + T+D+ W++IM+     P+ +       LL   +  N LL+Q+QK L  YLE+K   FPRFYFLS+DELLEILSQT++P AVQPHL+KCF+ IAKL+F   ++                         I  M S EGEK+   K +Y + ++E       W+ ++ N    + + + +      + + + P          Q +I    T       +AL       L +     L+ L A+VRG + K+ R  L ALI I+VHARD+V  M+   + + N+FEWI QLRYYW  +  N  +R  N+ + YGYEYLG ++RLVITPLTDRCYL L GAL L  GGAPAGPAGTGKTETTKDL KA A QCVVFNCS+ LDF  MG+FF GLA +GAW CFDEFNRIDIEVLSV+AQQ+ TI+ A+  +  RFMFEG E+ L PSCA FITMNPGYAGRTELPDNLKALFRP+AMMVP+YALIAE+ L+S GF  ++ L++K+   ++L SEQLS QDHYDFGMRAVKSV+  AG LKR N  ++E+++ +RA++D N+PKFL  D  LF  I++DLFP  +    DYG L  +I+     KGL+ +   V K IQL+ET +VRHG+MLVGPTGSGKT  Y +LQ  L+SL +Q + D   +  V T++LNPKS+TMG+LYGE + +T EW DG+++  +RQ V    PD +W + DGPVDA+WIENMNTVLDDNK LCL++ E IKL   + M+FEV DLAVASPATVSRCGMVY++P+ LG  PFV  W++   D +    RE +  LFD Y++  + F      + +   +      M  L DSF +P                      K   +    L P K+                    + + FLF  +WS G +      + FDT+  R +      +  P  G +Y Y  D                        +   W   +P +    ++ Y D++VPT+D VR   + ++LL   K V+  G TG GK++   +I D +++     Y++  + FSA+T++ +TQ++I++KL+K+RK + G P GK ++ F+DDLNMP L+ +GSQPPIEL+RQ+ DF+G+YDR+ +  ++ + D+    +  PPGGGRNP+T R +RHF++       E ++  +F +I+  +++   AE+    + +V A +++Y  + + +LPTPAKSHY FNLRDLSK  QG+L  +P  +    Q+ RL+ HE+ RVFQDRL+N +D+ +F  ++    +  F Q +  +  +  P+L+GDFM +  +  +K Y E  +  K+  ++ + L+D+N  ++ +M LV FMDA+ H+ RIAR++RQP GNALL+G+GG+G+QSLT+LA HM+ Y CFQIEL++ Y  + +R+DLK++   AG++ +  VFLF+DTQI  E FLED+NNILNSG+VPNL+  ++ E +    +P+ ++ G+ +  +  +F  +  RVR NLH V+ MSP+G+ FR R R FP+LVNCCTIDWF++WP+EAL SV+  F     E+++  E ++  +  MC EIH SVS  ++++  EL R  Y TPTSYLEL+ ++  +   K+++L  ARDR KNGL KLL T ++V  +Q EL  ++PQL+Q   + +   E+++ D E A + + VV  EEAVA +KA E   I  +AQ+DLDEALPAL+ + ++L  L+K+DI+E+R   +PPE V  V+E++CI+  VKP               W + K +L D G FL  L +YDKD I DS ++K++ YI +  F    +EKVS+AC S+  WVRAM  Y  V + V PKR  L  +  ELE     L+E +A L  VE +I  LQ   +     ++ L        ARL RA KL   L +E+ RW ++V   E  I N+VGNV ++A  VAY G FT  YR+ + + W    K  GVP +D    +L++   DP +IR W  DGLP+D+L +IE+ ++   + R  LF+    +ANRWI+  + +NGL +IKL+D +FLR+LEN IR G P L+E VGE LDPALEPILLKQTF Q G ++I+LGD+ I Y  +FRFY+TTKL NPHY PEV  KVTI+NFT++ SGLEDQLL  VV  ERPDLED +NQLIV     + +LK IED+IL  L  +EG+ +DD  LI TL  SK+ S  I  ++  AE+TE  I   R +Y PVA R  +++F VA LA++DPMYQYSL++F  +F   I ++ K D L  R++ + N  T S+Y NV R LFEK KL+FSF+L   I++ +  I   EW F L G G +  +    P   W++D +WN    L   L +F  F  +F+       + + ++     +   EK P  W D    F+ L+ ++  + +KV  A  DFV   LG+ F+E  + DL +++++ S   PLIF+LS G+DP +   +FA DM +++++ AISLGQGQGP AE+LI NA + G WVF QNCHLA SWM ++E  ++ +  ++ +VH DFRL+L+SMP+  FPV +LQN  K+T EPP+G++AN  +++     D   S      WR L+  +C FH ++ ERKKFGPLG+NI YEF D D    +  L MFL +  ++P+  L +  G I YGGRVTD+WD+RC+  +L  F++P+++ ++Y +S+SGIY      + H  Y  Y+ +LP+ D PE+FG+H+NANI F   ET+ L+  +L++QP++ S+ GGK+ +EIV E++  IL  + ++ ++E         D   RY      S+ TVL QEV R+N LL +IK+SL  L KAI+GLVVMS  L+ +  S  +N+VPD WA+ +YPSLKPL SWV DL  R +F++ WI +G P  FWISGFFFPQ FLTGTLQN ARK  + ID ++F + V+                   +A P  E  + P DG  + GL+L+GARWD   M L ++R  E+   +P++ + P  N    PS+ Y  P+YKT  RAG LSTTGHSTNFV S+ +PTD  Q  WI++G A
Sbjct:  503 LDEIQEKIDDIEAESMTIKELYDLIDNYKVPTPPEDLAVYQTLRPTVTAVRNVIDKSLAERDSNIDKFCTCMDKDIVQLGKDVKEVKQKAQDPKILDSSSKSESIIAYLKELQGKMDRLHDTAFTYKSYQKNFKVEVTKFEELEEVHAELRLKQSLWNSLVEWDQSQQDWTETLFEELNPETLSNNVMKYAKTV---MQLEKGLPP-NSVVPILKEKLENMRHKLPVITNLRNPALKQRHWDQIQQIFNYHFKDEEPLTLGLLDKIEAFEHTESIEEVSGQASSEASLEGILKKVEDAWKSTEFIVLPHRDSKDVFILGGVDDIQAVLDDSMINVSTIAGSRHVGPIRPRVEEWQRQLYLFSETMDEWMTCQRNWLYLESIFSAPDIQRQLPAEAKMFMTVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKCVIFPRFYFLSNDELLEILSQTRNPHAVQPHLQKCFDAIAKLEFGSTVQAPSTPQDQPVTPTGERRKMRYATNDILGMISPEGEKVSLGKVSY-SHSIETLTLCFSWLKDMSNHPLNLHKKISLFSSLMYITWSRSP----------QYIITSSTTI------NALFPSHY-SLCIVFPMNLNNLAALVRGVLPKLTRNILGALITIDVHARDIVTGMVNAKVDSENNFEWIKQLRYYWDPDLDNCVVRMSNSMYIYGYEYLGASARLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAKQCVVFNCSEGLDFKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLLTIRNAKVAKASRFMFEGREIKLVPSCAAFITMNPGYAGRTELPDNLKALFRPMAMMVPNYALIAEVILYSEGFESSKNLARKMTQMYRLCSEQLSQQDHYDFGMRAVKSVLVMAGALKRSNPDLEEDVVLIRALRDSNLPKFLAADAILFRAILTDLFPGKEIPDHDYGKLQSTIEDCMVAKGLQAIPALVKKVIQLYETMIVRHGVMLVGPTGSGKTTNYMMLQDTLTSLHEQ-AEDSPYYLPVQTHILNPKSVTMGELYGEVNKLTMEWRDGLMALKVRQCVQETTPDHKWIVCDGPVDALWIENMNTVLDDNKMLCLANSERIKLNNTIHMLFEVQDLAVASPATVSRCGMVYMDPNELGWRPFVRSWMQKHSDKMKEETREYLWNLFDHYVDAGLKFASKKCTQAMQQVDISKVTTMCCLFDSFFFP---------------------AKGGPDFN--LDPTKLHPL-----------------ICTAFLFVFLWSIGGNLVETCNESFDTF-TRDLFADTHDVRIPGSGDLYSYYVDFD--------------------TRRMEPWEKIIPAFKYSSEVPYFDLLVPTVDTVRFGFLMDKLLSVNKSVLYTGTTGVGKSVIAKAILDDISQ--KSNYMAIMMNFSAQTSSQRTQEMIETKLEKKRKNILGAPAGKRMVIFVDDLNMPKLDTYGSQPPIELLRQYQDFRGFYDREKLF-WKEIHDMTICSACAPPGGGRNPVTPRFLRHFSMFCIPSSAEHTLGHIFKSIVSGFLLDFPAEVRECADAIVGASVEIYARMSTDLLPTPAKSHYVFNLRDLSKCIQGVLQADPGVIRDKGQIFRLFCHEASRVFQDRLINKEDKTFFNTIMSEMAHKHFQQARSPEKFESNPILFGDFMKMGADPADKLYEELTDLKKVKNLLTDYLDDYNMNSSKEMKLVFFMDAIEHISRIARMVRQPRGNALLVGVGGTGKQSLTRLACHMSAYKCFQIELTRGYDYSAFREDLKKLYDVAGVKGENTVFLFTDTQIVVEEFLEDINNILNSGEVPNLFEPEEYEAVLNGTRPLAKEAGIPEGDRDGVFDYFISRVRNNLHIVLCMSPVGDAFRTRCRMFPSLVNCCTIDWFTEWPREALLSVSSNFFE---EVDLGAEGVKDKVAEMCVEIHTSVSTMADRFYAELRRRYYTTPTSYLELITLYLSMLDEKRKQLIGARDRVKNGLKKLLETNDLVDTMQVELVALEPQLKQKSLDVEKLMEKLQVDQEEADKVRNVVQAEEAVAKEKADETSAIAAEAQKDLDEALPALEAAQKALDSLDKSDISELRVFTKPPELVMTVMESICILLGVKPD--------------WPSAKTMLGDAG-FLKKLMDYDKDKIPDSTLRKLKKYIDNPKFVVEVVEKVSKACRSMVMWVRAMDLYARVYRTVEPKRAKLAAAQAELEVVMSTLREKQASLAEVESKIAELQAAYDHSIAEKETLTKNIAQTAARLKRASKLTTALGDEQGRWTENVAAFELEIGNVVGNVFVAAACVAYFGAFTSLYRHELINSWIEQCKELGVPVSDD--FSLINVLADPYEIRQWNSDGLPRDSLKAIEDRILKLLNMRSTLFL----KANRWIRTKEAKNGLKIIKLTDNNFLRTLENCIRIGMPVLLEEVGESLDPALEPILLKQTFVQGGRLLIRLGDSDIDYDKNFRFYMTTKLANPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLERPDLEDQRNQLIVRINSDKNQLKAIEDRILKLLFHSEGNILDDEVLINTLNESKVTSGVISTRLKEAERTEEKITIAREKYRPVATRGSVMYFVVASLAEVDPMYQYSLKYFKQLFNACIESSEKTDDLDRRLEILLNNCTESVYVNVARGLFEKDKLVFSFMLCGDIMRQQEIITDEEWNFFLRGTGGLDKERPAKPDVPWLTDFMWNTCCDLEDVLHSFKGFKGDFVKAPITISMGNLQQSEVGDDDQAEK-PRSWQDRLTSFERLIFIKAFKEEKVVFAAVDFVCENLGKTFVESPSIDLPVLFENVSNMIPLIFILSTGSDPMNAFLRFARDMNYTERIQAISLGQGQGPVAEKLIANASKNGDWVFLQNCHLAASWMLAMETTIKDLTNNEAEVHEDFRLFLSSMPTKAFPVTVLQNSVKVTNEPPKGLRANTKRAFGELMADPFESHVLGVRWRKLVFGICFFHAIIQERKKFGPLGWNIKYEFNDSDRMCALENLKMFLVD-ENIPWDALTFITGQITYGGRVTDEWDQRCLTTILGRFFSPKILEDNYKFSESGIYFPPGFESLH-DYREYVDNLPLTDEPEVFGMHENANIAFQTQETHQLIYTVLEVQPRLASSGGGKTNDEIVYELADSILGKLMDVLDMEKAEKSLFETDAKGRY-----NSLTTVLGQEVDRFNNLLKVIKNSLTQLQKAIKGLVVMSLELDKVYTSFLNNQVPDMWANSSYPSLKPLGSWVKDLVLRTMFVEQWIIHGPPKSFWISGFFFPQGFLTGTLQNHARKYNLPIDQLTFSYNVLPQYRNQEEVAEETAKLEYGQALPLDEELDCPDDGVLVHGLYLDGARWDDDSMMLGDARYGEMNPPLPILHMEPQMNLVPDPSQ-YMSPLYKTSARAGVLSTTGHSTNFVVSVYLPTDLPQAFWIEKGTA 3887          
BLAST of Dynein heavy chain axonemal vs. Ensembl Nematostella
Match: EDO42618 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0X9])

HSP 1 Score: 2442.92 bits (6330), Expect = 0.000e+0
Identity = 1217/2019 (60.28%), Postives = 1539/2019 (76.23%), Query Frame = 2
Query:  122 YPEVKQRGYYSEILSDGAIEQLENVTHGPPEVQNLLSQTIHYENTPKVGTFEIPDQLNSNIDV-----HGESTKIDIIIDFPEKSFEPKLQLMYFVAPGMIPRRVRLEREKRAYXXXXXXXXXXXXGNITSDYLIPKYHPPNGKKF----DGSWAPY---LFLETFDNEEYEIRNPDEWLAMGLEDGVRKPVPGRALLPVTDDKHDVDIRDPSIDWTWQSVGVLDYDTDTKLWFVQKTDKSGR----VIDDI---GRPVIDGGLLPTGH--FLEMSNQYWIPRIQLMFLAENPIKFSNRVIEAYQSRELHEALLRYHLYLDCMPMDGLGELDQSSLKRMIRLSKDETPILKKQKGLEDAVQSLEKEVMVDYWRSMNTIILHKLVGENPQKFNYITLPKPELPKVPMKGTIP-MPKYDWDTKFEEFAFYSLLTKPEVVQAMCKSQYECLEARNKQLFHVPLAKHMRLEEFEQTQSQATQQVSLFLKDTWIDNLQKFIRTSLRDSKKGWFNIYETDFYVYTKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSI 6112
            YP +KQRGYYS+IL++GA   + NV  GP   Q+ L +    ++TPKV TF+ PD   + I+V     HG ++    + DFP +++ PK+QL Y    G +PR++ +ER KR YA+  + +LL   G  T D L+P+             +G  AP+   L L  FD+ EY+ R  +EW+ +G+ DGVRKPVPG+ALLP  +D           ++ W  VG L YD  ++L+ VQ     G     V ++I    R   +    PT     L   +Q+ +PRI+++F AE+P+ F+ RV +A+  R   EALLRY+LY+DCMPMDG+  LD SS+ RM+  ++D T  L+K   LE+ V+ L KEV +D+ RSMN I   ++V  +P ++ Y+T+ + E   VP +G  P +P Y +D KF+ FAF SLLT+ E + AM K   EC +     +F VP+ K M+LEEFEQTQSQ + QV +FL+D+W++ L+  IR+SL D  KGWFN+ E ++ VY  SKL KFMELVK+ MQDS+RYL  DSL  F NMI DAC + + + +  +W  D+L S   PKKN +F++DL +D     Y+T LD F    + LFDK I A +NVPQLE+ +++ + W+  PLLESVG  EP+V +LRE +R  +  +LIP+++YA +Y K+L LQN DI    N++L  Y++Q HTA E+K E+E+HL +KE+LE  +P  I+IGP+++ TE++R+ LAKKRKA+A+A++ LLA++LRK AD+ CE FK I R+LY++PN+IEELAE RE++  IP++L + QE+IDK + DYELIEEF YN+S +DF+AKWT + WP+KI+  +   EQ L  DEERF+K  ++D   F ++LD+L M+VA   ++ DI+KAHEVANEVRR+ KQL E Q  A  +NNRERLFN PVT+YEKL +L+K+FEPF+N+W+  SDW K HDS MNDPL  +D+E +E++V   +KT+ K  K F E+P+ Q+VA +++  IE FKP+IPLIQGLRNPGMR+RHWE LS EL   +V  + LTF+KCLEM LQDH +II+KI E+AGKEY+IEQAL+KM  EW+ L  ++L+YK TGT+I+KVSD+ +QLLDDHIVMTQSM FSPYKKPFE+RIT WE  L  TQDV+DEWLQCQR WLYLEPIFSSEDINRQLPVE KRY TM+R+WRK+M  A  NP VI+LCPDARLL +L+ECNKLLEQVQKGLSEYLETKR +FPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKL+FE+DL I++MFSGEGE + F    YPTGNVE+W+LE+EN MR SLR  + K L  Y  +PRTEWVL+WPGQVVIAGCQT+WT+EV++AL+   L  L   L  QL+ L  +VRGD++K+ R+ L ALIVIEVHA DV   M+ E +Q+ NDFEWISQLRYYW E+N+ IRAVNA+F YGYEYLGNT RLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKA A+QCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRID+EVLSVVAQQI+TIQ+A + R++RFMFEG+EL LKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVP+YALIAEISLFSFGFS+A+ L+KKI TTFKLSSEQLSSQDHYDFGMRAVK+VISAAGNLKR+   M EELI LRAI+DVNVPKFL DDLKLF GIVSDLFP++KE+PIDYG L  SI+    K GL+DV GFV KCIQL+ETTVVRHGLMLVGPTGSGKT+CYEVL+ A+++LK Q SP G+ F+ VHT+VLNPKSITMGQLYGEFDL+THEWTDGILS++IR G +++ PD +WY+FDGPVDAVWIENMNTVLDDNKKLCL+SGEIIKL E MTMMFEV DLAVASPATVSRCGMVYLEPSILGL+P+V C+++ LPDAI+ +++++Q LFD +LE ++ F+R N++E  PT +  LT ++ +L+D F  PFVP ++++
Sbjct:    1 YPNIKQRGYYSDILAEGAGNDVTNVAIGPSASQSTLWKAAKVKHTPKVNTFKGPDNEEAFINVLKEQQHGPTSAPVTVSDFPTQAWAPKVQLPYKAEMGQVPRKIEIERRKRIYAKQDINNLLEEFGVNTGD-LMPREDYNMSVNLTGMTNGDVAPFPSFLPLHIFDDTEYDTRTSEEWINLGMTDGVRKPVPGKALLPTVNDGIK--------EYEWLEVGALSYDKGSELFLVQIVGTDGLQHNVVPEEIKVRARMTSNDEKPPTKKKKRLNTESQFSVPRIRVLFNAEDPMVFAERVAKAFALRRETEALLRYNLYIDCMPMDGVPRLDSSSIDRMVNWARD-TRTLRKDDNLEENVRLLCKEVQIDFARSMNRITFDRVVSSSPDQYPYVTIQEVEPEVVPERGFFPDVPAYPFDEKFDNFAFNSLLTRKEAILAMGKVITECNKVSQMSVFQVPVTKSMKLEEFEQTQSQVSSQVQIFLRDSWLNTLRTAIRSSLMDVGKGWFNMDERNWEVYKISKLSKFMELVKFAMQDSLRYLVQDSLAAFTNMILDACCSVIDIPEELDWGTDILNSPYKPKKNALFMLDLTIDKGMVAYNTELDAFGRTVITLFDKGIIATKNVPQLEKMVLEGLFWSGTPLLESVGENEPEVVRLREKVRHAITMSLIPLKAYAKQYEKYLELQNLDI----NQYLEEYDSQEHTAAEVKQEIERHLKDKEVLENTLPSSIVIGPYWVLTESIRKNLAKKRKALADAVIALLAKKLRKQADEVCEEFKLIARRLYDKPNSIEELAEQREYMKGIPELLKKNQELIDKAMVDYELIEEFNYNISAEDFSAKWTCISWPYKIQQQMDATEQALDADEERFQKNLLSDQNTFQDRLDSLNMAVAGFAAHTDISKAHEVANEVRRLVKQLKECQTLAHTYNNRERLFNMPVTSYEKLGRLIKEFEPFKNMWLTASDWQKWHDSWMNDPLTTIDAEQLEQNVNNSFKTIFKCYKHFKEIPACQQVAYEVREKIEAFKPYIPLIQGLRNPGMRSRHWEQLSKELCFPVVANAQLTFTKCLEMGLQDHTDIIAKIGEIAGKEYSIEQALDKMESEWKPLLLDILAYKETGTFIMKVSDDCSQLLDDHIVMTQSMSFSPYKKPFEDRITSWEGKLVMTQDVMDEWLQCQRNWLYLEPIFSSEDINRQLPVESKRYQTMERIWRKVMNAAKSNPQVISLCPDARLLESLRECNKLLEQVQKGLSEYLETKRTAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLKFEEDLRISSMFSGEGENVDFSTDLYPTGNVEDWLLEVENTMRNSLRDTLRKALELYPTVPRTEWVLQWPGQVVIAGCQTFWTREVTEALQENSLGELNTALRNQLNDLVTLVRGDLSKLARLILGALIVIEVHACDVAGKMVEEGVQSANDFEWISQLRYYWEEDNMVIRAVNAQFDYGYEYLGNTGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKAMAVQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDVEVLSVVAQQISTIQQALEARVERFMFEGVELNLKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPNYALIAEISLFSFGFSEAKGLAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKREAPDMSEELIVLRAIRDVNVPKFLQDDLKLFRGIVSDLFPHVKEQPIDYGVLEDSIRKTCLKTGLQDVDGFVTKCIQLYETTVVRHGLMLVGPTGSGKTQCYEVLKKAMTALKGQKSPAGNEFEEVHTFVLNPKSITMGQLYGEFDLLTHEWTDGILSSMIRGGSSSSTPDLKWYVFDGPVDAVWIENMNTVLDDNKKLCLTSGEIIKLSEVMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLSPYVVCYLKRLPDAIFNYKDKLQALFDGFLESSLKFIRDNVKEYAPTVDSNLTCSLTRLLDCFFQPFVPREIAM 2005          
BLAST of Dynein heavy chain axonemal vs. Ensembl Nematostella
Match: EDO34077 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQG6])

HSP 1 Score: 2350.09 bits (6089), Expect = 0.000e+0
Identity = 1314/3327 (39.50%), Postives = 1945/3327 (58.46%), Query Frame = 2
Query: 1802 NPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNE-FLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYI--NTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSN------DDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISI-VPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEK------DLEITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQI--PRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKG-------LYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEE--NLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSP-FQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPE-YIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVV--KIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFN-QINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMC-HEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSV--KAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDY 11677
            NP+  V +VL+     +S  L +   +  N+       LQ   +L   + +  S  + P+   +  +E + KK++ +++  +      ++SY   ++ +     ++I E   + F+R Y+  +        ++ ++    EI      +  ++   ++  +   ++  L        N    LL     +   +     K   +KL   P T++EL +    +  + + L   +         + ++E++   +        D  + +W +       +  +I  +  L + +E+F+   +     F + ++ L     S   ++      E   +V + H+Q+   ++          +F       + L  L KD E    +W    +W +L D+      + + +  +E      +K ++K ++   +     E+   IK  IE+FK  +PLIQ L+N  MR RHW  +  E+           T  K +E+ L    E I +I+  A KE +IEQA++ ++  W+ +  ++  YK+ G + LK +DE+ Q L+D+ V   +M  S Y K FE  + KWE TL    +V++  L  QRQW+YLE IF  EDI +QLP E   +  ++  W+ IM+    +P+ +       LL  L + N  LE++QK L  YLETKRQ FPRFYFLS+D+LLEIL Q+K+P AVQPHL+KCF+NI  L+  +        E   M+S EGE + F  S    G VE W+ ++E  MR +L+ ++    +  K+    R +WV +WPGQ+ I   Q  WT + + AL +   +G       L  K +  L+    ++RG +TK+ R+ + AL+ IEVH RDV+  +I     ++  FEW+SQLR YW ++  +  +R  N +F YGYEYLGN+ RLVITPLTDRCY+TLT ALHL  GG+P GPAGTGKTET KDLGKA     +V NCS+ LDF +MG+ + GLA  GAW CFDEFNRI+IEVLSVVAQQI +I  A      RF+FEG E+ L  SC +FITMNPGYAGRTELPDNLK++FRP++M VPD  +IAEI LF+ GF++ + L+KK+ T + L+ +QLS QDHYDFG+RA+ SV+  AG  KR N  M +E I L +++D+NV K    D  LFNGIVSDLFP I+   IDYG L  +I    +  G +     + K IQL+ET   RH  ++VG TGSGK+  + VLQSA++ LK     DG P F  V  + +NPK++++G+LYGEFDL T+EWTDG+LS+++RQ  +   P+++W +FD PVD +WIE+MN+V+DDNK L L +GE I + + ++++FEV DLAVASPATVSRCGMVY +   LG  P+V+ W+    D      E +Q+LF+ ++ + ++F +H+ +E VPT+      ++  L D+         L+ E        E  ++ +N    A +                         +E WFLF LIWS  AS D DSRKK D +LR ++  Q     FP +  VY+Y  D                     ++  W  W   +   +   P + +  I++PT+D VR   +   L+ +K+PV+  GP GTGKT      L K  P  Y    I  SA+T++N  Q++I+SK++KR KGV+ P  GK +I F+DD NMPA + FGSQPP+ELIR W D+  WYDR      + + D++ + SMGPPGGGR  I++RL   FNL+     QE  +K +FGT++   +     ++ PL + + +A I++Y  I ++MLPTP + HY FNLRD+SK+FQG+L    +   +   + RLW HE  RVF DRL+++ DRE F  LL  KL S F+  + ++   K  P+ +G+FM    ++  Y + V++  + + +E+ +ED+N +     +NLVLF DA+ HV RI R+I QP GN LL+G+GGSGRQSLT+LA+++ EY  FQIE++K+Y   E+RDDLKR+   AG++NKP VFLF+DTQ  +E FLED+NNIL+SG+VPNLY  D+ E +   +  I     +Q T  ++F  + +RVR NLH V+ MSP+G+ FR R+R +PA VNC TIDWFS+WP +AL  VA ++L +I EL   EE    +  +   +H+SV + S +   EL R+NYVTPT+YLEL+  +  + A KK+EL  A  + +NGLDK+  T   V+ +  ELE    ++ +  ++ +     I +    A E Q +V       A +  +C ++ ++AQ DLDEA+PALQE++++L+ LNK D+TE+++  RPP  V  V+E V I++  +P               W   K  L D G F+  L NYDKDN++D +++KI  Y A   F P  I +VS A  S+C WVRAM  Y  + + V PK++ L +++ +LE+ + IL EA+AKLK V DR+  L+ + +  + +++EL  K++L E +L RA KL+ GL+ E+ RW+ SV  LE  I  +VG+ LI+A +++Y G F   YR+ +    W A ++  GV     P  +       P  +R W I GLP D  S EN V+V    RWPL IDPQGQA +WIKN++ ++GL +I L   D+LR+LENA++FG P L++NV EELDP+L PIL K   K  G  +IKLGD  + Y  DFRFYITTKL NPHYTPE+STK TIVNF +   GLE QLLG+VV  ERP+LE+ K+ L+++ A  +++L+E+ED+IL  L  A+GS +DD  L+ TL +SK  S E+  ++ ++EQTE  ID  R  Y P A R  ILFF + D+ +IDPMYQ+SL+ ++++F N I  + ++  L  RI N+N Y T+++Y   CR LFE+HKLLFSF + ++IL+  GK+++ E+ F L GG V  +   + NP  +W++D  W+ +  L  LP F      F  +Y  D+ + + S EP    LPGEW + C+  Q +LV+R LR D+V+     F+ + LG +F+EP   D++ V  DSS  TPLIFVLSPG DP S L + A++   S +  A+SLGQGQ P A  +IK  ++ G WVF  NCHL+ SWMP L++LVEQ+  +  H DFRLWL+S P P+FP+ ILQ G KMT EPP+G+KAN+ + Y   ++   +   K  +++ LL  LC FH VL+ER+KF  LG+NI Y F D D  +  N L ++L EY + P+  L+Y    +NYGG VTDD+DRR + + ++  +N Q +   Y
Sbjct:  686 NPLLRVKVVLEGDKVEFSPTLTKLASMMDNIASTLTTCLQIFKRLPDLLTRKKSIKE-PVHLVIERDE-ETKKIQTSIKAGMSANASHLQSYLSTWDGY-----REIWEIQKDAFIRRYQRLNPPVSSFDADIARY---TEIANNFQKEETVLNIDFVLLDCSPLKFALLSHCNEWQNKFTTLLREMASQKLTELNNFLKGNAKKLSAPPETLDELGDSLSLLEQLQNDLPNIEAKFAPLHQQFAILEKYEVAIPEEVQGMLDALSGEWLL------FQQCLIDSDVMLKKSKEKFKTGLIHSSEEFKKTVNGLFDDFQSKGPFSSSIGVKEALEQVTQYHEQVVNLKSQETSLRRGLNIFKIEQALSKDLQNLEKDLEHLEQVWTVTKEWEELWDTWKVGKFVELVTTDMETQAQLLFKRLNKIIREVKD--KNWEICDSIKSRIEQFKRTMPLIQDLKNSAMRDRHWSQIKTEVQKPFDHTGDDFTLEKIIELGLDQFGEQICEISGAASKELSIEQAISGIASIWDQVSLDIGPYKDRGHFRLKQTDEVFQQLEDNQVTLSTMKASRYVKAFEAEVDKWERTLSLILEVVEMILTVQRQWMYLENIFLGEDIRKQLPRESAEFDDVNANWKIIMQRLNKDPNALRGTHYPGLLETLNDMNTKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSKNPEAVQPHLKKCFDNIKTLKMARVGLTFDKTEAVGMYSAEGEYVEFGHSVLLEGPVEAWLCDVERSMRWTLKELLKHCRLGLKKSLSKRDKWVKEWPGQLTITSSQMQWTSDCNKALSSSKERGDKKALKSLKKKQVSMLNKFSEMIRGSLTKMQRLKIVALVTIEVHGRDVIEKLIKAGCNDVTAFEWLSQLRLYWDKDIDDCVVRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGNYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGATRFVFEGREINLVWSCGIFITMNPGYAGRTELPDNLKSMFRPISMCVPDSGMIAEIILFAEGFNNTKVLAKKVHTLYTLAVQQLSKQDHYDFGLRALTSVLRYAGRKKRANPDMSDEEILLLSMKDMNVAKLTTQDAPLFNGIVSDLFPGIEAPVIDYGKLRNAIVAELKDGGYQPTPNTILKIIQLYETKNSRHSTIVVGQTGSGKSVTWRVLQSAMTRLKR----DGEPGFNVVREFPINPKAVSLGELYGEFDLNTNEWTDGVLSSVMRQTCSDEKPEEKWILFDAPVDTLWIESMNSVMDDNKVLTLINGERISMPDMVSLLFEVEDLAVASPATVSRCGMVYTDFRDLGWQPYVDSWLDRRVDK--QSVEHLQRLFEKFVPKVLEFRKHHCKEPVPTSELNSVVSLCVLFDA---------LATE--------ENGVRMSNGESYARM-------------------------LELWFLFCLIWSVCASVDEDSRKKMDNFLR-ELEGQ-----FPAKDTVYEYHVD--------------------IKQKTWASWEDKLRSGWRYNPSVPFYKIMIPTVDTVRYDFLVYNLIQAKRPVLLTGPVGTGKTSVAQKVLQKLDPKTYGLLVINMSAQTSSNDVQEIIESKVEKRTKGVYVPIGGKQMITFMDDFNMPAKDTFGSQPPLELIRLWIDYGFWYDRMK-QTVKYVKDMHLLASMGPPGGGRMVISKRLQSRFNLINMTFPQESQIKRIFGTMINQKLQDFEEDVKPLGDIMTQATIEIYNTIVAKMLPTPTRIHYLFNLRDISKIFQGLLRANKDLHDTKTAISRLWVHECFRVFSDRLIDNTDRESFVTLLSDKLGSMFDLTFHNLCPNKQSPI-FGNFMK---DDTMYEDLVDFKAIKRYMEDQMEDYNMEPGVIAINLVLFRDAIEHVTRIVRVIGQPRGNMLLVGIGGSGRQSLTRLASYIIEYKVFQIEVTKHYRRQEFRDDLKRLYYQAGVDNKPTVFLFNDTQALEEGFLEDVNNILSSGEVPNLYKPDEFEEVRTALSDIAAKEDVQDTPESMFHFFIERVRSNLHIVLCMSPVGDPFRNRIRMYPAFVNCTTIDWFSEWPGDALLEVAERYLENI-ELG-DEETKANVAQIFVTVHRSVVDMSARMLLELKRHNYVTPTNYLELVSGYQSLLAEKKKELGDAASKLRNGLDKIDDTRAKVEVMSVELEDATLKVAEFQKQCEEYLVVIVQQKREADEQQKMVQARSEKIAIEEDKCRVMAENAQHDLDEAIPALQEAMKALESLNKKDMTEIKSYGRPPALVEKVMEAVMILRQSEPT--------------WAEAKRQLGD-GNFIKQLVNYDKDNMTDRILKKIGTYCAQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKKQRLHQATAQLEEKQAILAEAKAKLKEVTDRMEELKRQYDEKSAQKEELRAKAELLEIKLDRAGKLVSGLAGERDRWEASVTILEENIGYLVGDCLIAAAFMSYAGPFLSNYRDELVLKTWLAQVRQLGVACN--PNFSFSGFLAKPTTVREWNIQGLPSDAFSTENGVMVTRGNRWPLMIDPQGQALKWIKNMEGKSGLKIIDLQQSDYLRTLENAVQFGSPVLLQNVQEELDPSLAPILNKSVVKVGGRYLIKLGDKEVEYSPDFRFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDALVINIAAGKKKLEELEDEILRLLQTAQGSLLDDEQLVNTLNSSKTTSQEVAEQLTVSEQTEIKIDAAREGYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNNSIEKSQRSPNLDNRIQNLNEYHTYAVYKYTCRGLFERHKLLFSFQMCSKILEAAGKLNMDEYNFFLRGGVVLDREGQMDNPCTQWLTDTSWDNVTELDKLPNFHGIVTSF-EQYPRDWNQWYTSSEPENTPLPGEWENACNELQRMLVVRSLRPDRVSFTATSFIVNNLGSKFVEPPVLDMSSVVDDSSTRTPLIFVLSPGVDPTSALLQLAENCGMSNRFHALSLGQGQAPIATRMIKEGVKDGNWVFLANCHLSLSWMPQLDKLVEQLQVEDPHPDFRLWLSSSPHPEFPISILQVGIKMTTEPPKGLKANMKRLYQLITEQQFSRCHKQDKYKKLLFGLCFFHSVLLERRKFLMLGWNIVYGFNDSDFEVSENLLSIYLDEYEETPWDALKYLVAGVNYGGHVTDDFDRRLLHSYINEMFNDQAIQTPY 3895          
BLAST of Dynein heavy chain axonemal vs. Ensembl Medaka
Match: dnah12 (dynein axonemal heavy chain 12 [Source:NCBI gene;Acc:101164478])

HSP 1 Score: 2824.65 bits (7321), Expect = 0.000e+0
Identity = 1593/3641 (43.75%), Postives = 2240/3641 (61.52%), Query Frame = 2
Query: 2087 YNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWI-----LTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDW-------IKLHDSV---MNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPS--VQEVA-------GQ-------------------IKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEK---STYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYP--HRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESW----FLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPE-----------EGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEY-IIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPE-YISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAV--AELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVV------------KIEPLLYGDFMSVAIENKK--YVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLA-AGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQ--DLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNK-NDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDK-PGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIE-PYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAK--VIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKF-SKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTS--FSD-DFLNSIA-KNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVM-TEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKS-REEIVEEVSKEIL-QGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            Y+ +  L N      V+ FL+    + H+  E   +VE   N  + +  L P+ +      ++ E ++QGL  K K                     C  F+ I +K+ + P   EE+A++ ++I       +P++ +E +E     +   E      +   ++D     T+  WPH I ++  Q E+ L    ++  K  +A       +L+ L  ++ +   Y+++    E   +VR   K+L EA+ N V  N  E  +   +T Y ++  + +  EP++ ++  +  W       +  H  +   M+   + ++ E +E  V EFY+ ++K +K F +  S   QEVA       GQ                   +   I++FK +IP++  L NPG+R RHWE +S   G  + P    +  K L+++L+  +E    I+  A KE+++E+A+  M+  W+ + F    +K+TG  I    D+I  +LDD IV TQ+M  SP+ KPF+  + +WE  L   Q+ IDEWL+ Q QWLYLEPIFSS+DI +Q+P EG+ + T+DR WR+IM     +  V+       LL  L++ N LLE++ KGL+ YLE KR  FP                                               M+S EGE++   +   ++   G VE+W+L++E+ M  S+R II +    Y++  R +WV +WPGQVV+   Q +WT EV  AL    LK  Y +L  QL+ +  +VRG++ K  R TL AL+ I+VHARDVV ++I E + +  DFEW++QLRYYW+ +N+++  +N +  Y YEYLGN+ RLVITPLTDRCY TL GA HL  GGAP GPAGTGKTETTKDL KA A+QCVVFNCSD LD++AMGKFFKGLAS+GAWACFDEFNRI++EVLSVVAQQ+  IQ+A   +L+ F FEG  L L P+C V ITMNPGYAGR+ELPDNLK LFR VAMMVP+YALIAEISL+S+GF +A+ LS KIV T++L SEQLSSQ HYD+GMRAVK+V+ AAGNLK +    +E+++ LR+I+DVN PKFL  D+ LFNGI SDLFP +     DY   L + +   +   ++    F DK IQ +E  +VRH  MLVG + +GKTK   VL   LS + ++   +    + V    LNPKSITMGQL+G+FDL++HEWTDG+++   R+   A  PD++W +FDGP+D +WIE+MNTVLDDNKKLCL SGEII++  +M+++FE  DL+ ASPATVSRCGM+Y+EPS LG  P V  WI +LPD +    +R  +  LF   +  ++  +R + RE+VPTTN      + +L    +                                   P+K          PD+      E++ +W    F  SL+WS G  CDTDSR+KF+ ++R+ +S +    P PE           +GLVYDY ++                    + K +W+HW   +    + + + K  +IIVPTID VR   + + L IS+ P++ VGPTGTGK++ + DKL   +  + Y+  FI FSA T+ANQTQ++I SK+DKRRKGVFGPP+GK  + F+DDLNMPA E FG+QPP+EL+RQ+ D  G YD K   +  SLVD+ FI +MGPPGGGRN +T R +RH N++  N   +D+M  +F +I+ F + + +   E   +   +V A ++VY    + +LPTPAKSHYTFNLRD S+V QG L+L+  SL     ++RL+ HE  RV+ DRLV+D+DR W   L+   +   FN  ++ V              ++ LL+GD+M+  +E  +  Y E    +   +V++  LE++NQ++  +MNLV+F   + H+ RI+R+++QP GNALL+G+GGSGRQS+T+LA  MA    FQ E+SKNYG+ EWRDDLK+++L  AG++ +  VFL +DTQIKDE+FLED++++LN+G+VPNL++ D+ + I   ++PI Q     ++ +   LF+ +  R + NLH V+  SPIG+ FR RLRQFP+L+NCCTIDWF  WP+EALE VA  FL     LE+SE   + ++ +CK  H S +  S+ ++ EL RYNY+TPTSYLEL+  F ++ ++K++ +  A+ R  NGLD+L + E  V K+++EL  ++P+LEQA  ++    E IE +S   +    VV  +E  AA KA E + ++ + + DL EALPAL+ +L +L  L + +DI+ V+AM  PP GV+LV+  VC+MK+VKP +I      G KI DYW   K LL D   FL  L  YDKDNI   V+Q I   ++ +  F P+ +   S A   +C+W+ AM  Y  VAK VAPK+  L  + + L  TK +L + RA+LK VEDR+  LQ+  E     +  LE + + C  +L RA+KLIGGLS EKI W  +  +L+   +N+ G+VLISAG +AYLG FT  +R +    W+   ++  +P +D    +L  T G+P++IR W I GLP D+ SI+N VIV  SRR PL IDPQGQAN+W+KNL+K+N L+VIKL+D D++R+LEN I+FG P L+ENVGEELDP+LEP+LLKQTFKQ G   IKLG+ +I Y  DFRFY+TT+L NPHY PEV+TKV+++NF ++P GLEDQLLG+VVA+E P+LE+ +  LI+ +A  +++LKEIED IL  L  ++G+ ++D   IQ L+++K+ SNEI  K  + IAE+TE  I E+R  Y  VA  + ILFF +ADL  IDPMYQYSL WF+N++ N I +  K+  L +R++ + ++FT++LY NVCRSLFEK KLLFSFLL   +L  + +I+ ++  FLL GG      + NP P W+ D+ W+EI   + LP F    E FI K   DFK I+DS EP    LP  WC+     Q +++ RCLR D V  A+  FV   LG++F++P   DLT  + DS+ T PL+FVLSPG DP + L KFA D K    +  +ISLGQGQGP A ++I  AM+ G WV  QNCHLA SWM +LE++ E       H+DFRLWLTS PSPKFPV ILQNG KMT E P G++ NLL+SY +   SD +F N    K   W  LL  LC FH ++ ERKKFGPLG+NIPY F + DL I + QL  F+ EY  VPF+ + Y  G  NYGGRVTDDWDRR +M  L+ FY   ++ T  Y  S SG Y    P + +  Y+ +I +LPI+  PE+FGLH+N +I+  + +T  L D LL  Q   +  G  S  +  + +++  IL Q +P  F+ E +  +YPV+YE+SMNTVL+QE+ RYN L + I  SL++LLKA++GLVVM   LE+++ +L   KVP+ WA  +YPSLKPL S++ D   R+ F+Q W +NG P VFW+SGFFF QAFLTG +QNFARK  I ID ++F F+V+     E    P DG Y+ GLFL+GARWD   + LTE  P+ LF  MP+IW+ P     I    +Y CP+YKT  R GTLSTTGHSTNFV ++ + T K  +HWIKRGVA
Sbjct:  213 YDSYSWLVNGTAQTQVDTFLK----EEHSFEEYTKKVETFHNLAKEISSLPPK-VYFTMVQLDCEELKQGLTNKAKI--------------------CSEFEAIKQKVLDIPKNTEEIAQMEKYIDFTKKNIVPELNNEVKEANSHIIYLLET-----HVAKSEDIKLNSTVYLWPHNILLAFEQSEEVLQSSRQKEEKELIARRERLTVQLEKLEHNIKTFPLYSELGLIQEYIADVRTTGKRLQEAEENIVGINKEEAFYKWEITCYPEVKAMKEQMEPYQKVFECILKWQHTESINLTFHTLLKRWMDGSFLDLNGETMETQVDEFYREIYKMLKFFQQKQSKAAQEVAKTYGKAEGQPDEKNSSKQECPTVNLCSIVIEQIQKFKDYIPVVSILCNPGLRGRHWEKMSQIAGFDLTPNFGTSLRKLLQLKLEPFLEEFETISVAASKEFSLEKAMQTMTQVWDGVSFHHQPHKDTGVSIFTALDDIQMMLDDQIVKTQTMMGSPFVKPFQSEMKQWEERLLHIQESIDEWLKLQAQWLYLEPIFSSQDIMQQIPEEGRLFQTVDRNWREIMGHCVKDSKVLQATSLPGLLERLQDSNALLEKIMKGLNAYLEKKRLFFP-----------------------------------------------MYSSEGERVELIQNISTSEANGAVEKWLLQLEDGMISSVRDIIDRSRA-YEKTARNQWVKEWPGQVVLCTSQIFWTLEVHKAL---GLKKYYQQLQNQLNEIVELVRGELPKQTRTTLGALVTIDVHARDVVKDLI-EKVSDETDFEWLAQLRYYWMNDNVRVHIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFHLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQVLCIQRAIMHKLEYFDFEGTMLKLNPNCFVSITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSAKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLLAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGVSLPVADYKLFLEAAEECCKIHNVQPTKVFTDKLIQTYEMMIVRH-FMLVGESFAGKTKVLHVLADTLSLMNERGHGEE---EKVIFRTLNPKSITMGQLFGQFDLVSHEWTDGVVANTFREFALAETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSNQMSLIFEANDLSQASPATVSRCGMIYMEPSQLGWKPLVISWINTLPDPLQSPDNRSLILDLFHWLIPPSLQMLRRHCREVVPTTNSHTVVALCRLFKMILD---------------------------------EPVKTG--------PDD------ESIRTWIMAAFASSLVWSVGGCCDTDSREKFNDFIRQTVSGKNKEHPIPETIERWECPINEKGLVYDYFYEF-------------------KEKGRWIHWNDTIENINLGEINTKGQEIIVPTIDTVRYTYLMD-LCISQGPLLFVGPTGTGKSVYVKDKLLNNLDKDCYLPFFINFSAHTSANQTQNIIMSKMDKRRKGVFGPPLGKRYVLFVDDLNMPAREQFGAQPPVELLRQFLD-HGHYDLKDTSKI-SLVDVQFIAAMGPPGGGRNAVTSRFLRHLNIISINPFSDDTMVHIFSSIVAFSMKKNLFSPEFVIVGNQIVTAMMEVYKKAMANLLPTPAKSHYTFNLRDFSRVIQGCLLLKKGSLEGKQTLIRLFVHEVYRVYHDRLVDDEDRTWLYQLMNSIVKDHFNVPFDQVFGQLKQGDKLEEKDMQNLLFGDYMNPDLEGDERLYTEVPSIETFAEVVKSCLEEYNQMHKNRMNLVIFY-LLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATSMAHMTLFQPEISKNYGMTEWRDDLKQMLLRNAGVKGQKTVFLITDTQIKDEAFLEDIDSVLNTGEVPNLFAVDEKQEIIETIRPIAQAGKKSVELSPLTLFAFFVARCKENLHVVVAFSPIGKAFRKRLRQFPSLINCCTIDWFQPWPEEALERVANSFLES---LEMSENERQEVITICKTFHTSANQLSD-FQAELGRYNYITPTSYLELIATFQQLISQKRETIMNAKQRYINGLDQLAFAESEVAKMKKELVDLQPKLEQAKIDNTKMMEVIEVESIEVEAKSRVVHVDEEAAAMKANEAQALKSECENDLAEALPALEAALTALDTLKQPSDISIVKAMKNPPSGVKLVMAAVCVMKNVKPDRIPDPAGTGKKILDYWGPSKKLLGD-MNFLRDLKEYDKDNIPVPVMQTIRNEFMTNPDFDPSKVANASSAAEGLCKWITAMEVYDKVAKVVAPKKAKLAEAQESLAATKAVLDQKRAELKEVEDRLTALQKTFEEKTEEKARLEMQVESCARKLERAEKLIGGLSGEKI-WSKAADDLQNTYDNLTGDVLISAGVIAYLGPFTSGFRQNCTKLWTTLCQSKNIPSSDD--FSLSKTLGNPIEIRAWNIAGLPNDSFSIDNGVIVRNSRR-PLMIDPQGQANKWVKNLEKDNNLNVIKLTDGDYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQTFKQ-GVESIKLGERVIEYSADFRFYVTTRLKNPHYLPEVATKVSLLNFMITPEGLEDQLLGIVVAKE-PELEEERTALILQSANNKRQLKEIEDSILETLQSSKGNILEDESAIQILDSAKIMSNEITKKQQIQIAEKTELKIAESREGYREVAKHSSILFFSIADLTNIDPMYQYSLIWFVNLYINSIQDI-KSKVLKQRLEYLKDHFTYNLYCNVCRSLFEKDKLLFSFLLCCNLLARK-EIEHSDLMFLLTGGIGLQNTVANPDPSWLQDKSWDEICRASELPGFQGL-EAFI-KNPEDFKLIYDSREPCSIDLPAPWCEKLTDLQKMIIFRCLRPDMVP-AVTKFVTRNLGKKFVQPPAFDLTKSFLDSNSTIPLVFVLSPGADPMA-LLKFASDKKMDGSRFQSISLGQGQGPIAAKMIFTAMQNGSWVCLQNCHLAVSWMSNLEKICEDFSLTTCHQDFRLWLTSYPSPKFPVGILQNGVKMTNEQPTGLRLNLLQSYLTDPVSDPNFFNGCPDKKPVWEKLLFGLCFFHALVQERKKFGPLGWNIPYGFNESDLHISMRQLQQFVNEYDKVPFEAITYLTGECNYGGRVTDDWDRRLLMTTLADFYCEDIIKTFRYPLSPSGKYFA-PPKSSYEDYIQFIENLPISQQPEVFGLHENVDISKDLQQTKLLFDSLLLTQGGGAMGGVSSGGDNTLYDIANNILTQQLPPTFDREAVLLKYPVLYEESMNTVLVQEMERYN-LCSTICVSLQNLLKALKGLVVMDSELEAVAGNLIVGKVPEKWAKFSYPSLKPLGSYITDFLARLKFLQVWYENGQPKVFWLSGFFFTQAFLTGVMQNFARKYQIPIDLLTFDFEVLPIDKSETP--PEDGVYVNGLFLDGARWDKEGV-LTEQHPRILFDSMPIIWVKPEKKNMIQTDSLYVCPLYKTSERKGTLSTTGHSTNFVIAMMLSTKKRPQHWIKRGVA 3675          
BLAST of Dynein heavy chain axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 1870.9 bits (4845), Expect = 0.000e+0
Identity = 1197/3596 (33.29%), Postives = 1891/3596 (52.59%), Query Frame = 2
Query: 2132 VNEFLRNYEAQ--HHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEV---IDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISI-VPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILK--VSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLC-PDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDL--EITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGL--VNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDL-KGLYVK----LLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEEN--LKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMF-EGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWI--RSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRK--MSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDM--KYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILK--FWIMRA-VAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLY-GDFMSVAIE-NKKYVEFVEYDKMLKVIE-----ENLEDF---------NQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQ--ATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLN--DIP-ELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIM--KDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGG-SVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTD-------VPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDY-IYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPK-MSTAGGKSREEIVEEVSKEILQGMPE---IFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFAR-KKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
             N  L  +E+Q  ++  LE K+  E             P YI +G   + T +++  L  +     N       ++ ++  +Q         +KL  RP  I++L ++R  +  I  +  +Q  +   I      Y ++ ++ + +  ++     T+  +  K+     +V+  L   + +F+K   +++    E+  N                  +V++ +     Q          + +  +LF   VT + +L K+  +    + L+   ++ I+  +   +     ++ E +   + +F     K  +   E  +  +    +K  I+EF    PL++ + +  M ARHW+ +++  G ++ V          +E     + E I  I   A KE  IEQ L ++  EW+   F    +KN G  +L+   + E+   L+D +++  S+  + Y  PF+ +I KW   L  T D+I+ W+  Q  W+YLE +F   DI +QLP E K ++++D+ W KIM  A + P+V+  C  D  +   L    + L+  QK L+ YLE KR  FPRF+F+SD  LLEIL Q  D   +Q HL   F+NI  +QF + +   I A+ S E E +  ++     GNVE W+  +    + SL ++I +    +  +     +++  +  QV + G Q  WT++  +AL      +G+  K     L  L+ L  +   D+  + R     LI I VH RD+ +++   +I N +DFEW+ Q R+Y+ E++  + I   +  F Y  E+LG T RLVITPLTDRCY+TL  AL +  GGAPAGPAGTGKTET KD+G+      VVFNCSDQ+DF  +G+ FKGLA +G+W CFDEFNRI++ VLSV AQQIA +   ++ R   F+F +G  + + P   +F+TMNPGYAGR ELP+NLK  FR V+MMVPD  +I  + L S GF D   L+ K  T +KL  EQLS Q HYDFG+R + SV+   G  KR N +  E  I  R ++D+N+ K + +D +LF  ++ DLFP I+     Y +L  +I    ++ GL +   +  K IQ++ET  VRHG+M +GP+GSGKT C ++L  A++         G P + +    +NPK+IT  Q++G  D+ T++WTDGI STL R+ + A   +  W + DGPVDA+WIEN+N+VLDDN+ L L++G+ I +     ++FE  ++  ASPATVSR GMV++  S+LG +P +E W+  RS  +A     E +++LF     E   F   +L            F M  ++++F+                      MQ    N+   L PLK     +  ++P E        +E  ++F+L+WS GA  + + RKK + + R    +   L  +P   E  ++DY     G                      WVHW   V EYI  PD+  KYS I+VP +DNVR   + + +    K V+ +G  GT KT+ +   ++KY P   + + + FS+ TT    Q  ++S +DKR    +GPP GK +   IDD+NMP +  +G Q   E++RQ  + KG+Y+ +  GEF ++VD+ F+ +M  PGGGRN I QRL R F++         S+  +FG I +  F   R  + E+      LV     ++   + +MLPTPAK HY FNLRDLS+++QGML    E + SV  +L LW HE  RV  DR     D EWF   L   +     ++++ VV      Y  DF+    E   +  E  ++D M KV E     E+L+D          + I    M++V F DA+ H+ +++RIIR P GNALL+G+GGSG+QSLT+LA+ +A Y  FQI L++ Y      +DLK +   AG + K I F+++D +IK+ESFLE +NN+L+SG+V NL++ ++++ I  D+ P+++    +   T  NL+  +  RVR NLH V+  SP+GE FR R  +FPAL++ CT+DWFS+WP++AL  V+  FL+  DI    +V  EV++ +      + +   +Y  +YR    R  +VTP SYL  +  +  IY  K+ E+         GL KL    E V  L +ELE+ + +L+ A E++    +E+   +E ++  ++ V + +  A          +  A+  L+ A PAL+E+  +L+ +  +DI  VR + RPP  +   ++ V ++  + V P +I  +     I   W     L+   G FL  L  + KD I++  ++ ++PY    ++        S     +  W +AM  +  + K V P +  L      L      L++A+A+L A +  +  ++ + E     +  L   +  C  ++  A  LI GL+ EK RW +           +VG+VL++  +++Y G F  E+R+ + +EW   LK   +P  +    ++ +   D   +  W + GLP D LSI N +IV  + R+PL IDPQ Q   WIKN + +N L +  L+ K F   LE ++  G+P L+E+VGEELDP L+ +L K   K      +K+GD  +     F+ Y+TTKLPNP YTPE+S + +I++FT++  GLEDQLLG V+  E+ ++E  +  L+      ++++KE+ED +LYRL+  +GS VDD  LI  L  +K  + E+  K+ IA  T+  I+  R  Y PVA R  IL+F + +++ ++ MYQ SL  FL +F   +  ++K+   +ERI +I  Y TF +Y    R L+E+HK LF+ LL  +I      +   E+  L+ GG S+  +  P    EWI D  W  ++ L+ L  FS+  ++  H +   +K  FD   P  E LP  +  + D F+ LL++RC   D+     + ++   +GE++ E    D+   +++S+P TPLI  LS G+DP   +      +K   +   +S+GQGQ   A +L++  M  G W   QNCHL  ++M  L   V  I+ + ++  FRLW+T+     FP+ +LQ   K T EPP+G+KA L ++Y   + D L+ ++   +W+ +L  +   H  + ER+KFGPLG+NIPYEF   D    +     F+  + D       V +  +QY  G I YGGRVTDD+D+R +      ++N  +   D+  Y   GI +     +    Y+AYI+ LP  DTPE+FGLH NA+ITF   +  ++LD +L +QPK  S+ GG++RE  V  ++ ++L+ +P     F ++ + K  P+   + MN  L QE+ R  R++ +++S+L DL  AI G ++MSE L    + +YD ++P  W  K++ S   L  W  +L +R    QTW+  G P  FW++GFF PQ FLT   Q  AR  K  ++D +    +V      +I   P+ G Y+ GL+LEGA WD    +LTES+PK LF  MPVIW+    N  +    +Y CP+YK  TR           N + S+ + T +  +HW+ RGVA
Sbjct:  659 TNPLLSKFESQIVYYQDLETKINSE-------------PDYINVGALALFTASLKTSLTVETMQWMNDYQMCCNKKYQQELEQILAIIDEAGKKL-NRP--IKDLDDIRIAMAAIDKIRKDQISIELQIGPIEESYAMLNKYKFPVQKEEGEKVETLRLYWDKLMFRSTEVQSELETLQPKFKKELESNMIVLQEECQNFYQDYDKDGPMGVGLAPQDVSDRLIMFQNQFDNLFLKYTTYCDGAKLFGITVTQHPQLMKIRTELTLLQKLYGLYNNVIETVNGYYDILWTNINIEKINNELLDFQTRCRKLPQALKEWQAFLD----LKRTIDEFSECCPLLELMTSKAMMARHWKRITEVTGHNLDVESENFKLRNIMEADPLKYKEEIEDICISAVKERDIEQKLKEVITEWDNKTFTFAGFKNRGELLLRGDSTSELIASLEDSLMVLGSLMSNRYNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQLDSCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEKIYDRILAVSSREKETMELDRPITAEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGFELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDRGIMSKTNQHFLNLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTDRCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTEC-------GQPHREMR---MNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEA-----EVLRQLFSSSFSELYRFSVQSLE-----------FKM-DMLEAFVI---------------------MQ--CINMLQGLIPLK----EQCGELPRE-------HLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDYYVTAEG---------------------HWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFVDFLRDPPEATGEEPEESDFD-MPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRLYNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFLRYR----RSTHVTPKSYLSFIQGYKTIYVEKRAEV------MNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNF--ITSSWQESLNLMTS-GSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNN--LDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGGASLDLKTCPQKPAEWILDMSWLNLVELSKLWQFSEILDQISH-HEKLWKSWFDKEAPEEEVLPNSYQSL-DCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIETRY--VSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTV--IETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGGINQDLLD-VSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQ----FIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKGYGIPK----CSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEVKRLQKMGPL---KPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWM-KSWAS-STLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMY-AENNVVKDPRLYSCPIYKKPTRT--------DINCIASVGLKTTQPPEHWVLRGVA 4107          
BLAST of Dynein heavy chain axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 1644.02 bits (4256), Expect = 0.000e+0
Identity = 1092/3352 (32.58%), Postives = 1701/3352 (50.75%), Query Frame = 2
Query: 2849 RLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILK--VSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLC-PDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQF-EKDLEITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGL--VNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDL-KGLYVK----LLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEEN--LKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMF-EGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWI--RSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRK--MSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDM--KYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVF----GTILKFWIMRA-VAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLY-GDFMSVAIENKKYVEFVEYDKMLKVIE-----ENLEDF---------NQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQ--ATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKN-GLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIM--KDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDK-VTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTD-------VPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDY-IYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPK-MSTAGGKSREEIVEEVSKEILQGMP------EIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFAR-KKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            +LF   VT + +L K+  +    + L+   ++ I+  +   +     ++ E +   + +F +T  K  +   E  +  +    +K  I+EF    PL++ + +  M ARHW+ +++++ IS V                              KE  IEQ L ++  EW+   F    +KN G  +L+   + E+   L+D +++  S+  S Y  PF+ +I KW   L  T D+I+ W+  Q  W+YLE +F   DI +QLP E K ++++D+ W KIM  A + P+V+  C  D  +   L    + L+  QK L+ YLE KR  FPRF+F+SD  LLEIL Q  D   +Q HL   F+NI  +QF EK   I A+ S E E +  ++     GNVE W+  +    + SL ++I +    +  +     +++  +  QV + G Q  WT++  +AL      +G+  K     L  L+ L  +   D+  + R     LI I VH RD+ +++   +I N +DFEW+ Q R+Y+ E++  + I   +  F Y  E+LG T RLVITPLTD                            T KD+G+      VVFNCSDQ+DF  +G+ FK LA +G+W CFDEFNRI++ VLSV AQQIA +   ++ R   F+F +G  + + P   +F+TMNPGYAGR ELP+NLK  FR V+MMVPD  +I  + L S GF D   L+ K  T +KL  EQLS Q HYDFG+R + SV+   G  KR N +  E  I  R ++D+N+ K + +D +LF  ++ DLFP I+     Y +L  +I    ++ GL +   +  K IQ++ET  VRHG+M +GP+GSGKT C ++L  A++         G P + +    +NPK+IT  Q++G  D+ T++WTDGI STL R+ + A   +  W + DGPVDA+WIEN+N+VLDDN+ L L++G+ I +     ++FE  ++  ASPATVSR GMV++  S+LG +P +E W+  RS  +A     E +++LF     E   F   +L            F M  ++++F+                      MQ    N+   L PLK     +  ++P E        +E  ++F+L+WS GA  + + RKK + + R    +   L  +P   E  ++DY                            WVHW   V EYI  PD+  KYS I+VP +DNVR   + + +    K V+ +G  GT KT+ +   ++KY P   + + + FS+ TT    Q  ++S +DKR    +GPP GK +   IDD+NMP +  +G Q   E++RQ  + KG+Y+ +  GEF ++VD+ F+ +M  PGGGRN I QRL R F++         S+  +F    G    F   R  + E+      LV     ++   + +MLPTPAK HY FNLRDLS+++QGML    E + SV  +L LW HE  RV  DR     D EWF   L   +     ++++ VV      Y  DF+    E  +  E  ++D M KV E     E+L+D          + I    M++V F DA+ H+ +++RIIR P GNALL+G+GGSG+QSLT+LA+ +A Y  FQI L+  Y      +DLK +   AG + K I F+++D +IK+ESFLE +NN+L+SG+V NL++ ++++ I  D+ P+++    +   T  NL+  +  RVR NLH V+  SP+GE FR R  +FPAL++ CT+DWFS+WP++AL                             E H  +S +      ++        +  ++ +G F    A K        D   N GL KL    E V  L +ELE+ + +L+ A E++    +E+   +E ++  ++ V + +  A          +  A+  L+ A PAL+E+  +L+ +  +DI  VR + RPP  +   ++ V ++  + V P +I  +     I   W     L+   G FL  L  + KD I++  ++ ++PY    ++        S     +  W +AM  +  + K V P +  L      L      L++A+A+L A +  +  ++ + E     +  L   +  C  ++  A  LI GL+ EK RW +           +V +VL++  +++Y G F  E+R+ + +EW   LK   +P            FG+ + I    ID                               + W  NLQ      +  L+ K F   LE ++  G+P L+E+VGEELDP L+ +L K   K      +K+GD  +     F+ Y+TTKLPNP YTPE+S + +I++FT++  GLEDQLLG V+  E+  L                                    VDD  LI  L  +K  + E+  K+ IA  T+  I+  R  Y P A R  IL+F + +++ ++ MYQ SL  FL +F   + ++  ++T +ERI +I  Y TF +Y    R L+E+HK LF+ LL  +I      +   E+  L+ G S+  +  P    EWI D  W  ++ L+ L  FS+  ++ I  +   +K  FD   P  E LP  +  + D F+ LL++RC   D+ +    + ++   +GE++ E    D+   +++S+P TPLI  LS G+DP   +      +K   +   +S+GQGQ   A +L++  M  G W   QNCHL  ++M  L   V  I+ + ++  FRLW+T+     FP+ +LQ   K T EPP+G+KA L ++Y   + D L+ ++   +W+ +L  +   H  + ER+KFGPLG+NIPYEF   D    +     F+  + D       V +  +QY  G I YGGRVTDD+D+R +      ++N  +   D+  Y   GI +     +    Y+AYI+ LP  DTPE+FGLH NA+ITF   +  ++LD +L +QPK  S+ GG++RE  V  ++ ++L+ +P      EI   E + K  P+   + MN  L QE+ R  R++ +++S+L DL  AI G ++MSE L    + +YD ++P  W  +   +   L  W  +L +R    QTW+  G P  FW++GFF PQ FLT   Q  AR  K  ++D +    +V      +I   P+ G Y+ GL+LEGA WD    +LTES+PK LF  MPVIW+   A  ++    +Y CP+YK  TR           N + S+ + T +  +HW+ RGVA
Sbjct: 1115 KLFGITVTQHPQLMKIRTELTLLQKLYGLYNNVIETVNGYYDILWTNINIEKINNELLDF-QTCRKLPQALKEWQAFLD----LKRTIDEFSECCPLLELMTSKAMMARHWKRITEDICISAV------------------------------KERDIEQKLKEVITEWDNKTFTFAGFKNRGELLLRGDSTSELIASLEDSLMVLGSL-MSNYNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQLDSCQKSLT-YLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEKYDRILAVSSREKETMELDRPITAEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGFELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDRGIMSKTNQHFLNLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTDE---------------------------TIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFK-LAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTC--------GQPHREMR---MNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAK-KEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEA-----EVLRQLFSSSFSELYRFSVQSLE-----------FKM-DMLEAFVI---------------------MQ--CINMLQGLIPLK----EQCGELPRE-------HLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDY----------------------YVTAEHWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFVIGEG---HFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFVDFLRDPPEATEEPEESDFD-MPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTL-YNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDAL----------------------------VESHHFLSAFDIDCSPQVK-------SEVVQCMGSFQDCVAEK------CVDYFMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNF--ITSSWQESLNLMTS-GSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLV-DVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIP------------FGNNLDITELLIDA---------------------------STVSEW--NLQ------ITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKRSL------------------------------------VDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRP-ATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLASSKSSNT-SERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGASLDLKTCPQKPAEWILDMSWLNLVELSKLWQFSEILDQQISHHEKLWKSWFDKEAPEEEVLPNSYQSL-DCFRRLLLIRCWCPDRTIAQQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIETRY--VSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTV--IETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTY-GINQDLLD-VSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQ----FIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKGYGIPK----CSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEIQVRERLQKMGPL---KPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKQESWASSTLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMY--AENNVKDPRLYSCPIYKKPTRT--------DINCIASVGLKTTQPPEHWVLRGVA 4153          
BLAST of Dynein heavy chain axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 1600.88 bits (4144), Expect = 0.000e+0
Identity = 987/2790 (35.38%), Postives = 1519/2790 (54.44%), Query Frame = 2
Query: 4514 TPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMF-EGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWI--RSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRK--MSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDM--KYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILK--FWIMRA-VAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVL-RLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLY-GDFMSVAIE-NKKYVEFVEYDKMLKVIE-----ENLEDF---------NQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQ--ATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLN--DIP-ELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIM--KDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGG-SVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTD-------VPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDY-IYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPK-MSTAGGKSREEIVEEVSKEILQGMPE---IFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFAR-KKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRS-------IPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            T L   CY+TL  AL +  GGAPAGPAGTGKTET KD+G+      VVFNCSDQ+DF  +G+ FKGLA +G+W CFDEFNRI++ VLSV AQQIA +   ++ R   F+F +G  + + P   +F+TMNPGYAGR ELP+NLK  FR V+MMVPD  +I  + L S GF D   L+ K  T +KL  EQLS Q HYDFG+R + SV+   G  KR N +  E  I  R ++D+N+ K + +D +LF  ++ DLFP I+     Y +L  +I    ++ GL +   +  K IQ++ET  VRHG+M +GP+GSGKT C ++L  A++         G P + +    +NPK+IT  Q++G  D+ T++WTDGI STL R+ + A   +  W + DGPVDA+WIEN+N+VLDDN+ L L++G+ I +     ++FE  ++  ASPATVSR GMV++  S+LG +P +E W+  RS  +A     E +++LF     E   F   +L            F M  ++++F+                      MQ    N+   L PLK++              K+ + +E  ++F+L+WS GA  + + RKK + + R    +   L  +P   E  ++DY     G                      WVHW   V EYI  PD+  KYS I+VP +DNVR   + + +    K V+ +G  GT KT+ +   ++KY P   + + + FS+ TT    Q  ++S +DKR    +GPP GK +   IDD+NMP +  +G Q   E++RQ  + KG+Y+ +  GEF ++VD+ F+ +M  PGGGRN I QRL R F++         S+  +FG I +  F   R  + E+      LV     ++   + +MLPTPAK HY FNLRDLS+++QGML     S   + QVL  LW HE  RV  DR     D EWF   L   +     ++++ VV      Y  DF+    E   +  E  ++D M KV E     E+L+D          + I    M++V F DA+ H+ +++RIIR P GNALL+G+GGSG+QSLT+LA+ +A Y  FQI L+++  +      LK +   AG + K I F+++D +IK+ESFLE +NN+L+SG+V NL++ ++++ I  D+ P+++    +   T  NL+  +  RVR NLH V+  SP+GE FR R  +FPAL++ CT+DWFS+WP++AL  V+  FL+  DI    +V  EV++ +      + +   +Y  +YR    R  +VTP SYL  +  +  IY  K+ E++   +R   GL KL    E V  L +ELE+ + +L+ A E++    +E+   +E ++  ++ V + +  A          +  A+  L+ A PAL+E+  +L+ +  +DI  VR + RPP  +   ++ V ++  + V P +I  +     I   W     L+   G FL  L  + KD I++  ++ ++PY    ++        S     +  W +AM  +  + K V P +  L      L      L++A+A+L A +  +  ++ + E     +  L   +  C  ++  A  LI GL+ EK RW +           +VG+VL++  +++Y G F  E+R+ + +EW   LK   +P  +    ++ +   D   +  W + GLP D LSI N +IV  + R+PL IDPQ Q   WIKN + +N L +  L+ K F   LE ++  G+P L+E+VGEELDP L+ +L K   K      +K+GD  +     F+ Y+TTKLPNP YTPE+S + +I++FT++  GLEDQLLG V+  E+ ++E  +  L+      ++++KE+ED +LYRL+  +GS VDD  LI  L  +K  + E+  K+ IA  T+  I+  R  Y PVA R  IL+F + +++ ++ MYQ SL  FL +F   +  ++K+   +ERI +I  Y TF +Y    R L+E+HK LF+ LL  +I      +   E+  L+ GG S+  +  P    EWI D  W  ++ L+ L  FS+  ++ +H +   +K  FD   P  E LP  +  + D F+ LL++RC   D+     + ++   +GE++ E    D+   +++S+P TPLI  LS G+DP   +      +K   +   +S+GQGQ   A +L++  M  G W   QNCHL  ++M  L   V  I+ + ++  FRLW+T+     FP+ +LQ   K T EPP+G+KA L ++Y   + D L+ ++   +W+ +L  +   H  + ER+KFGPLG+NIPYEF   D    +     F+  + D       V +  +QY  G I YGGRVTDD+D+R +      ++N  +   D+  Y   GI +  S   D   Y+AYI+ LP  DTPE+FGLH NA+ITF   +  ++LD +L +QPK  S+ GG++RE  V  ++ ++L+ +P     F ++ + K  P+   + MN  L QE+ R  R++ +++S+L DL  AI G ++MSE L    + +YD ++P  W  +++ S   L  W  +L +R    QTW+  G P  FW++GFF PQ FLT   Q  AR  K  ++D +    +V      +I   P+ G Y+ GL+LEGA WD    +LTES+PK LF  MPVIW+    N S       +    +Y CP+YK  TR           N + S+ + T +  +HW+ RGVA
Sbjct:   13 TYLMTWCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTEC-------GQPHREMR---MNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEA-----EVLRQLFSSSFSELYRFSVQSLE-----------FKM-DMLEAFVI---------------------MQ--CINMLQGLIPLKVRL-------------KLNQHLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDYYVTAEG---------------------HWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNHSSRNIIFQVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFVDFLRDPPEATGEEPEESDFD-MPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRSGLLEGLIAYLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFLRYR----RSTHVTPKSYLSFIQGYKTIYVEKRAEVQMLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNF--ITSSWQESLNLMTS-GSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNN--LDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGGASLDLKTCPQKPAEWILDMSWLNLVELSKLWQFSEILDQ-VHHHEKLWKSWFDKEAPEEEVLPNSYQSL-DCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIETRY--VSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTV--IETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGGINQDLLD-VSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQ----FIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKGYGIPKCSS--VDQ--YLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEVKRLQKMGPL---KPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKESWAS-STLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYAENNGSSEKKKKIVKDPRLYSCPIYKKPTRT--------DINCIASVGLKTTQPPEHWVLRGVA 2681          
BLAST of Dynein heavy chain axonemal vs. Ensembl Medaka
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:101170214])

HSP 1 Score: 999.579 bits (2583), Expect = 0.000e+0
Identity = 695/2266 (30.67%), Postives = 1149/2266 (50.71%), Query Frame = 2
Query: 2219 EILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQAC----EAFKTITRKLYERPNTIEELAELREWILTIPDM-LDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVG--WPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVA--NEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISI-VPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEV---LSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLE----ITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRD------LKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEEN--LKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVL-QSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLR--RKMST-----------QLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPE-SLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLND--IPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMA-----KETQIV-----VTRXXX-----XXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVC----IMKDVKPKKIQ 8833
            E L Q + Q ++    +I   N+   L    + +A + +  L   L K A +      + F  +  K+++RP+T E+L  +   I  I DM LD +  V D        I+E Y  ++  D       +G  W +    S  QV+Q+L +  E F K+++ ++ AF +   +L++   S  ++   T  +++   N + +  K+L++  A         +L +  +  Y ++  + K       ++       +          +  D ++++  +  F +++ +  K    LP    VA  +   ++EF+  + L+  L+N  +R  HW  L +  G S  +     T      + L  +   I +I   A KE +IE         W+  KF +   L       ++L   D I   LD+ ++  Q M  S +  PF + I +WE  L    + I+ WLQ Q +W+ LE IF  EDI  QLP E K+   + + + +IMK+  + P++   C     L++L      LE++QK L+ +L++KR  FPRF+ +SDDELL +L    DP  +Q H+ K ++NI  L+   D      + AM S EGE + F K       VE+W++ +   M+ + R+I  + + +Y      +W+  +   +V+A  + +WT EV +A++  +      LK    ++  Q+D L   +     +  R+ +S ++V +VHARD+V+N +  +I+ ++DFEW SQLR+YW++E+  L +R  N    YGYEY+G   RL ITPLT R YLTLT AL +  GGA AGPAG GKTET KDL KA  + CVV +C++ +D + +GK   GLA  G W CFDEFNRI   VLSVV+ QI  I+ A       F FEG ++ L     ++ITMNP Y  R ELP+++K  FRPV ++ PD   I EI LFS GF  A+ L+KK+   +K +  QLS Q HYDFG+ + KSV+  AG +KR +  + E+++ +RA++D+N+PK + +D+ +F G++SD+FP +    + +     +++   +K     +   VDK +Q++E  + +   M+VG T  GK+     L Q+    L  ++ P            LNPK+ ++ +LYG FD  T +WTDGI S L R+   +    +R+ +FDG VD+ W+ENMN+VLDDNK L L++G+ I+L     ++FEV DL  ASPATVSRC +V+++P  L   P+ + W+++          R+ +LF+ Y+   +D +  N   IVP T+  +   +  ++D  +                                                  E  N   E +E +FL +L  S GA+     R KFD  ++    +ST           ++ +LP      +YD+ FD                      + KWV W + VPEYI  P MK++DI+ PT+D  R   I EQ++  K+PV+ VG  GT KT  I + L        IS  I FS+KTT+   Q  +++ ++KR K  +GPP+GK ++ F DD+NMP ++ FG+Q P+ L+R   D  G YDRK    F+++ D+ +I +M   GGGRN +  R +  F++        +S+  ++ +I+K       A +  + +T+ +  + ++  I + + PTP+K HYTF+ R+LS+++ G+ + +P+ S  +V+Q +R+W +E  R F DRL ++ D+       + KL  ++ +   + V  +P+L+GD+ +   E ++ V                ED    + +K    LF DAV H+ R+ RI+R   G+ALL+G  GS  Q+LTKLAA  A+ + F+I L + Y    +R+DLK + L  G+EN+  VFLF+D  I +E FLE +NN+L S  VP L++ D+ E I   +       G  ++K +++  + ++   NLH V+ +S  G+  + R R FP + N   IDW+  W  +AL +VA   L +  IP+      +    M     +H S+ ++S++   +  R NY T  S+L+ +  +S +   K + + Q +   +  L++L    E + +L  +L   K  L +      A  EEI+++  ++     K+ Q+V     V R +       A K   E   +    Q D D    +   +++ LK L +  + E++++ +   G+   +E+      I K+V+PKK Q
Sbjct:  868 ENLNQEVKQEVLCKTEHIIHVNM-MPLVSSLRNIAESRISTLCSFLNKPAKEELFILRDKFMQLQEKMHQRPDTFEDLKSILGTISDIRDMSLDVEIRVAD--------IKERYRMMAMYDELELVANIGQIWSNLFAESR-QVDQSLKDVRETFSKIKMEEMEAFKQ---DLSIFAESFNTHGPGTVGNDLEKLNIIGKFEKELSKIMAKQEHLTKTAKLLDLQLAEYPEIISIQKYLSGLSQIYNIYKAHKEAKTKWSQTLWVNFDIKLLQDGIDGFIESLMQLSKDVQTLP----VAFFLDSHLKEFRVSLSLLLDLKNTALR-DHWNKLMERTGKSFDMNLQRFTLETLFSLELHKYANDIDEIVTSALKELSIEMT-------WKRTKFNMQPQLKVNQERVFLLGAVDNILVNLDNDVMKLQCMAGSRFGGPFLDAIQQWEKNLTLFSETIEIWLQVQHKWMNLENIFCGEDICSQLPEEAKKLKKITKKFTEIMKSTENEPNIKKCCTVPGRLSSLWVLRNDLERIQKNLANHLDSKRNEFPRFFLISDDELLNVLGSV-DPACIQEHVIKMYDNIESLRLGVDSSGQTVVGAMVSNEGEVMEFRKPVPLEARVEDWIMAVLQEMKRTSRLITKEAVYHY-----VDWIRSYQCMMVLAANRVWWTWEVENAIKNVNKGDKYALKKYAEQIHRQIDELVTCLGRPTKESDRLKISNVLVTDVHARDIVDNFVGRSIKEVHDFEWESQLRFYWVKEHDSLFVRQCNTSLSYGYEYMGLNGRLAITPLTSRIYLTLTQALSMYLGGALAGPAGAGKTETVKDLAKALGLFCVVTHCTEDMDTITLGKIISGLAKCGFWGCFDEFNRIGASVLSVVSSQIQAIRNALTSHFKMFQFEGQQISLDDHMGIYITMNPSYERRPELPESVKVFFRPVVVVTPDVQQICEIMLFSQGFLQAKELAKKMTVLYKTAGIQLSKQPHYDFGLHSQKSVLKMAGKMKRDSLELSEDVVLMRALRDINLPKLVSEDVPVFLGLISDIFPGLDSSRVGFPSFRETVEEILQKSNYTILPDQVDKVVQIYEIMLTQQATMIVGQTCGGKSVVINTLCQAQTLGLCTKLYP------------LNPKATSVDELYGSFDPETRDWTDGIFSKLFREINQSTDKKERYILFDGDVDSQWLENMNSVLDDNKLLTLANGDRIRLQSHCALLFEVGDLQHASPATVSRCAVVFIDPKHLSYTPYWQRWMKN----------RLNRLFEKYVPSCID-VTLNSETIVPRTDVNMVSQLCLMLDVLL--------------------------------------------------ESKNSSAEVLECYFLEALYCSLGATLVESGRLKFDKLVKSLSCLSTVDDEKAAAGPGEIPYLP-----TLYDFHFDE--------------------TQEKWVPWSSLVPEYIHNPAMKFADIL-PTVDTTRTHWILEQMVKIKRPVLLVGECGTSKTAIIQNLLKNTSTDSSISLTINFSSKTTSLDLQRNLEANIEKRTKDTYGPPIGKKLLVFFDDINMPKVDDFGTQQPVALLRLLLDQGGLYDRKQKLSFKTIKDLGYIAAMRKTGGGRNEVDPRFLSLFSVFNIPPPATESLHLIYASIIKGHTRPFKAAIQEVCQTITECTLKLFTTIITDLPPTPSKFHYTFSQRELSRIYCGLTLTKPDFSCLTVEQFVRVWRNECLRNFHDRLTDETDKALVHG-HIKKLVEEYFETDSEAVLADPILFGDYRAAREECEQRV---------------YEDIGDYDVSKAIFQLFEDAVEHLTRVHRILRSDRGHALLIGADGSWTQALTKLAAFTADCEVFEIILRRGYNELNFRNDLKTLYLKLGIENRRTVFLFTDAHIVEEGFLEQINNMLISM-VPTLFADDEKESIIKQINSEALQEGAGSSKESVWQYFLRKSANNLHIVLCLSATGDALKTRCRNFPLMSN-TVIDWYLPWSAQALHAVAQCVLENPTIPKAHFGAVIDHICM-----VHASLCDFSKQLLLKHQRCNYATSKSFLDFISSYSTLLEEKNEHVLQCK-CLEGSLNRLREAREQIDELNLKLADQKVVLAKKTATCTAFLEEIDKNQTISFAKPPKQVQVVCECILVLRGKKELNWLTAKKMMSEAGFLHSLMQMDCDSISNSHISTIKFLKNL-QTSVEEMQSISKAGSGILKFVESFMSYWDIAKEVQPKKDQ 2978          

HSP 2 Score: 678.707 bits (1750), Expect = 0.000e+0
Identity = 423/1363 (31.03%), Postives = 711/1363 (52.16%), Query Frame = 2
Query: 8711 LKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELE-NKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHE-WSAALKTYGVPHTDKPATNLVDTFGDPVKIRN---------WQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGL-DVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEF------IHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTD-----VPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMT---EDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTW-IDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            L++++KN   +  +  +PP+ V++V E + +++  K                W   K ++ + G FL SL   D D+IS+S I  I+ ++ +   +   ++ +S+A + I ++V +   Y  +AK V PK++ ++R  KE  Q+K  L+  +  L  ++     L+EK E  A  +KEL+ +++ L E RLT ADKL+ GL++E+  W   +  L+     ++G+ LI+A +++Y G F  ++RN+M ++ W+  +K  G+P               P KI N         W  +GLP D  S++N ++     R+PL IDPQ QA  WIKN +K+N L  V  L+D DFL+ LE +I++G P L+++V E++DP +  +L +     +G  VI LGD  + Y  +F+ ++ T L NP Y+P V  K  ++N++ +  GLEDQLL +         +     L+   ++ +  LK + D +L  L  + G+ +D+ +LIQTLE +K +++E   K+ +A+    +    R  Y PVA R  +LFF ++D+A ++ MYQYSL  +L++F+  +  +     L +R++NI N  T+    NV   LF KHKLLFS  +  +I Q EG +   E  FL+   S     +  P  EWI D+ W +I  LA L     FPE+F      I +   ++K  +D   P +   P ++ +    FQ LL+LRCLR D++  AM D+V   +G   + P   + T +Y+ S+  +P++F++S G+DP +DL KFA+  K   K + I++GQGQ     +L++ A+  G W+  QNCHL   W+  LE+ +E+I    +  +FR+W+T+     FP+ ILQ   K+  EPP  IK N+  +Y+  S   L+S  ++  +  L+  L  FH V+ ER K+G  G+++P  F D D    +  L  +LT+  +     +P++ LQY  G + YGGR  D +DRR +   +  ++   + +     + +    +  +I P      Y   I  +P+  TPE+ GL     I +       +   L  LQP+     G   +E +  ++++I + +PE+F+I  + +        + + VL+QE+ R+N+L+  ++ S+ +LL+A+ G V MS+  + ++++  ++ VP  W   A  +LK L  W+  L +R      W +  G P V W+SG   P+++L   +Q   RKK   +D  +F  +V      +  +     CY+ GLFLEGA WDM    L  S+PK L  E+P++ +IP    S+        PVY T     +L         VF  ++ T     HW+  GV 
Sbjct: 2864 LEEIDKN---QTISFAKPPKQVQVVCECILVLRGKKELN-------------WLTAKKMMSEAG-FLHSLMQMDCDSISNSHISTIK-FLKNLQTSVEEMQSISKAGSGILKFVESFMSYWDIAKEVQPKKDQVKRLEKEFLQSKAELECIKNDLNNMQKEASSLKEKYED-ANLEKELQLDEAKLMERRLTAADKLVLGLTSER-EWTKDLEELKQQHECLLGDCLIAAAFLSYAGAFNWDFRNNMVYDKWTQDVKQKGIP------------LSQPFKIENFLTNQLEISWGSEGLPPDEQSVQNGILTTKGSRFPLCIDPQQQALNWIKNKEKDNNLKQVSSLNDPDFLKQLELSIKYGYPFLLQDVNEDIDPIIINVLERNVVVSEGRTVIVLGDKEVNYDPNFKLFLHTTLANPQYSPSVFEKALVINYS-TLRGLEDQLLSVTTGFLEKVFQQQHLLLVEEISENKTLLKSLGDSLLMELGTSTGNMLDNTELIQTLEKTKTEASETIKKLSVAQSKTVEFANLREGYRPVAKRGAVLFFALSDMALVNRMYQYSLTSYLSLFELSLQESLAHPNLQQRLENIINTLTY----NVHNYLFGKHKLLFSMNMTVKIEQTEGGVPQKELDFLIKNLSGDGTKVQKPH-EWIPDQAWQDITKLAEL-----FPEQFSSLPSDIEQNSTNWKSWWDLRAPEQAPFPLQYSESLSAFQKLLLLRCLRADRLHRAMADYVTVTMG-NCVHPPLINFTTIYERSTAFSPIVFIMSSGSDPTTDLIKFAE--KSGTKFTLIAVGQGQEQVVLKLLEKAVSIGSWLILQNCHLLVKWLKDLEKALEKITNPNI--NFRMWITTNAIDDFPIGILQKSQKVVAEPPEDIKLNMKATYSKISQQTLSS-CQHPAFCSLVYVLAFFHAVVQERSKYGKTGWSVPCNFNDSDFSASLEVLSTYLTKCHEQGDSFIPWESLQYLIGEVVYGGRAIDSFDRRILKVYMDEYFGDFLFSPFQHFHFFRNKDVGYKIPPPGRKHVYTE-IEKMPLITTPEVAGLPSTVEIGYYTQAVEEMWTHLRVLQPETQVGRGIGGDEHISHIAQDIQKQLPELFDINLVGEELGTDLSPT-SVVLLQELRRFNKLVLCMQQSVVELLRALTGEVGMSKESDDLAHAFCNDLVPAMWKRLAPETLKSLDDWMSHLRRRYEQYSNWQVREGEPKVMWLSGLHVPESYLAAVVQAACRKKGWPLDQSTFHTEVTRYRTEDDIDDRLKQCYLSGLFLEGADWDMENGCLARSKPKVLVVELPILKVIPVQKNSLRLRNTLRTPVYTT-----SLRRNASGAGLVFEADLFTTMHTSHWVLSGVC 4170          
BLAST of Dynein heavy chain axonemal vs. Planmine SMEST
Match: SMESG000017294.1 (SMESG000017294.1)

HSP 1 Score: 8534.47 bits (22144), Expect = 0.000e+0
Identity = 4202/4207 (99.88%), Postives = 4203/4207 (99.90%), Query Frame = 2
Query:   98 MSDREVDKYPEVKQRGYYSEILSDGAIEQLENVTHGPPEVQNLLSQTIHYENTPKVGTFEIPDQLNSNIDVHGESTKIDIIIDFPEKSFEPKLQLMYFVAPGMIPRRVRLEREKRAYXXXXXXXXXXXXGNITSDYLIPKYHPPNGKKFDGSWAPYLFLETFDNEEYEIRNPDEWLAMGLEDGVRKPVPGRALLPVTDDKHDVDIRDPSIDWTWQSVGVLDYDTDTKLWFVQKTDKSGRVIDDIGRPVIDGGLLPTGHFLEMSNQYWIPRIQLMFLAENPIKFSNRVIEAYQSRELHEALLRYHLYLDCMPMDGLGELDQSSLKRMIRLSKDETPILKKQKGLEDAVQSLEKEVMVDYWRSMNTIILHKLVGENPQKFNYITLPKPELPKVPMKGTIPMPKYDWDTKFEEFAFYSLLTKPEVVQAMCKSQYECLEARNKQLFHVPLAKHMRLEEFEQTQSQATQQVSLFLKDTWIDNLQKFIRTSLRDSKKGWFNIYETDFYVYTKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            MSDREVDKYPEVKQRGYYSEILSDGAIEQLENVTHGPPEVQNLLSQTIHYENTPKVGTFEIPDQLNSNIDVHGESTKIDIIIDFPEKSFEPKLQLMYFVAPGMIPRRVRLEREKRAYAELSLEHLLASEGNITSDYLIPKYHPPNGKKFDGSWAPYLFLETFDNEEYEIRNPDEWLAMGLEDGVRKPVPGRALLPVTDDKHDVDIRDPSIDWTWQSVGVLDYDTDTKLWFVQKTDKSGRVIDDIGRPVIDGGLLPTGHFLEMSNQYWIPRIQLMFLAENPIKFSNRVIEAYQSRELHEALLRYHLYLDCMPMDGLGELDQSSLKRMIRLSKDETPILKKQKGLEDAVQSLEKEVMVDYWRSMNTIILHKLVGENPQKFNYITLPKPELPKVPMKGTIPMPKYDWDTKFEEFAFYSLLTKPEVVQAMCKSQYECLEARNKQLFHVPLAKHMRLEEFEQTQSQATQQVSLFLKDTWIDNLQKFIRTSLRDSKKGWFNIYETDFYVYTKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYV    +NYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQIATIQKAQQQRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLNREEEENEEEIIKERKIKWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTREEAVAAKKAKECEIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA
Sbjct:    1 MSDREVDKYPEVKQRGYYSEILSDGAIEQLENVTHGPPEVQNLLSQTIHYENTPKVGTFEIPDQLNSNIDVHGESTKIDIIIDFPEKSFEPKLQLMYFVAPGMIPRRVRLEREKRAYAELSLEHLLASEGNITSDYLIPKYHPPNGKKFDGSWAPYLFLETFDNEEYEIRNPDEWLAMGLEDGVRKPVPGRALLPVTDDKHDVDIRDPSIDWTWQSVGVLDYDTDTKLWFVQKTDKSGRVIDDIGRPVIDGGLLPTGHFLEMSNQYWIPRIQLMFLAENPIKFSNRVIEAYQSRELHEALLRYHLYLDCMPMDGLGELDQSSLKRMIRLSKDETPILKKQKGLEDAVQSLEKEVMVDYWRSMNTIILHKLVGENPQKFNYITLPKPELPKVPMKGTIPMPKYDWDTKFEEFAFYSLLTKPEVVQAMCKSQYECLEARNKQLFHVPLAKHMRLEEFEQTQSQATQQVSLFLKDTWIDNLQKFIRTSLRDSKKGWFNIYETDFYVYTKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYV----KNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQIATIQKAQQQRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLNREEEENEEEIIKERKIKWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTREEAVAAKKAKECEIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 4203          
BLAST of Dynein heavy chain axonemal vs. Planmine SMEST
Match: SMESG000017294.1 (SMESG000017294.1)

HSP 1 Score: 8468.21 bits (21972), Expect = 0.000e+0
Identity = 4181/4207 (99.38%), Postives = 4182/4207 (99.41%), Query Frame = 2
Query:   98 MSDREVDKYPEVKQRGYYSEILSDGAIEQLENVTHGPPEVQNLLSQTIHYENTPKVGTFEIPDQLNSNIDVHGESTKIDIIIDFPEKSFEPKLQLMYFVAPGMIPRRVRLEREKRAYXXXXXXXXXXXXGNITSDYLIPKYHPPNGKKFDGSWAPYLFLETFDNEEYEIRNPDEWLAMGLEDGVRKPVPGRALLPVTDDKHDVDIRDPSIDWTWQSVGVLDYDTDTKLWFVQKTDKSGRVIDDIGRPVIDGGLLPTGHFLEMSNQYWIPRIQLMFLAENPIKFSNRVIEAYQSRELHEALLRYHLYLDCMPMDGLGELDQSSLKRMIRLSKDETPILKKQKGLEDAVQSLEKEVMVDYWRSMNTIILHKLVGENPQKFNYITLPKPELPKVPMKGTIPMPKYDWDTKFEEFAFYSLLTKPEVVQAMCKSQYECLEARNKQLFHVPLAKHMRLEEFEQTQSQATQQVSLFLKDTWIDNLQKFIRTSLRDSKKGWFNIYETDFYVYTKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            MSDREVDKYPEVKQRGYYSEILSDGAIEQLENVTHGPPEVQNLLSQTIHYENTPKVGTFEIPDQLNSNIDVHGESTKIDIIIDFPEKSFEPKLQLMYFVAPGMIPRRVRLEREKRAYAELSLEHLLASEGNITSDYLIPKYHPPNGKKFDGSWAPYLFLETFDNEEYEIRNPDEWLAMGLEDGVRKPVPGRALLPVTDDKHDVDIRDPSIDWTWQSVGVLDYDTDTKLWFVQKTDKSGRVIDDIGRPVIDGGLLPTGHFLEMSNQYWIPRIQLMFLAENPIKFSNRVIEAYQSRELHEALLRYHLYLDCMPMDGLGELDQSSLKRMIRLSKDETPILKKQKGLEDAVQSLEKEVMVDYWRSMNTIILHKLVGENPQKFNYITLPKPELPKVPMKGTIPMPKYDWDTKFEEFAFYSLLTKPEVVQAMCKSQYECLEARNKQLFHVPLAKHMRLEEFEQTQSQATQQVSLFLKDTWIDNLQKFIRTSLRDSKKGWFNIYETDFYVYTKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYV    +NYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQIATIQKAQQQRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQM                     ADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLNREEEENEEEIIKERKIKWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTREEAVAAKKAKECEIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA
Sbjct:    1 MSDREVDKYPEVKQRGYYSEILSDGAIEQLENVTHGPPEVQNLLSQTIHYENTPKVGTFEIPDQLNSNIDVHGESTKIDIIIDFPEKSFEPKLQLMYFVAPGMIPRRVRLEREKRAYAELSLEHLLASEGNITSDYLIPKYHPPNGKKFDGSWAPYLFLETFDNEEYEIRNPDEWLAMGLEDGVRKPVPGRALLPVTDDKHDVDIRDPSIDWTWQSVGVLDYDTDTKLWFVQKTDKSGRVIDDIGRPVIDGGLLPTGHFLEMSNQYWIPRIQLMFLAENPIKFSNRVIEAYQSRELHEALLRYHLYLDCMPMDGLGELDQSSLKRMIRLSKDETPILKKQKGLEDAVQSLEKEVMVDYWRSMNTIILHKLVGENPQKFNYITLPKPELPKVPMKGTIPMPKYDWDTKFEEFAFYSLLTKPEVVQAMCKSQYECLEARNKQLFHVPLAKHMRLEEFEQTQSQATQQVSLFLKDTWIDNLQKFIRTSLRDSKKGWFNIYETDFYVYTKSKLKKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYV----KNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKGLYVKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQIATIQKAQQQRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHRERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQM---------------------ADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLNREEEENEEEIIKERKIKWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVKIEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTREEAVAAKKAKECEIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 4182          
BLAST of Dynein heavy chain axonemal vs. Planmine SMEST
Match: SMESG000012956.1 (SMESG000012956.1)

HSP 1 Score: 3117.41 bits (8081), Expect = 0.000e+0
Identity = 1749/3984 (43.90%), Postives = 2476/3984 (62.15%), Query Frame = 2
Query:  995 LLRYHLYL-DCMPMDGLGELDQSSLKRMIRLSKDETPILKKQKGLEDAVQSLEKEVMVDYWRSMNTIILHKLVGENPQKFNYITLPKPELPKVPMKGTIPMPKYDWDTKFEEFAFYSLLTKPEVVQAMCKSQYECLEARNKQLFHVPLAKHMRLEEFEQTQSQATQQVSLFLKDTWIDNLQKFIRTSLRDSKKGWFNIYETDFYVYTKSKL----------KKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQGYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNP---LLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIP----QYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDM-LDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFE---KSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDAL-ETRDLKGLYVKLL-EQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYP-HRERVQKLFDVYLEETVDFMRHNL-REIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLI-----------FLP---------FPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVP-EYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPE-YISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRA--VAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVK--------------IEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLG----LQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQG-DKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKI-EPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCD-ICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKF-SKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTS--FSD-DFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTE-DYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            +LRY+ Y+ + +  + + +++   +  M  L  ++   LK +    + ++ LE E+  DY  S+   I+  ++ E P++      P PE  K      +P P   W   F     Y    K   V   C +Q   LE     L+ +   K++RL + E+ + + T   ++ L+D +     + I  +     K W N  +  +Y   K KL          ++F       M  S++ L LDS+ ++ N++ +              P+DL   +    ++P F++ L+L++    +   ++ F  + +N++D+ ++ + +V ++E  +  D  WA +     L  + + E  ++K +  +R  L    +    +  E++K+ +L N+++ + ++  L   E +H        E  K+L +   L + I     + I +G F +  + + + L+K+ + +   +LD +    R+S  +  + ++ I RK    P   E++ EL +++     + + E ++ +DK       + + Y N +  D N   ++    +++     + ++N+ + +E F+         F E+LD+    V    +  D+ + ++   + + +  +L  A      FN  E  F   VT Y    ++     P+  L+    ++   +   M   +  V+ + V+  V  +Y+T+ K  K F   P  +++A ++K  +EEFK  +PLIQ L  PG+R RHW+ +SD +G ++  +  +  SK ++M L+  I     I+E AGKE+ +E+A+ KM  EW  ++F V++Y+ TGT+IL   D+I  +LDDHIV TQ+M  SP+ KPFE  I  WE+ L   QD++DEWL+ Q  WLYLEPIFSS DI  Q+P EG+++ ++D+ W++IMK    +  V+T+    ++L  LK+ N+LLE + KGL++YLE KR  FPRF+FLS+DELLEILS+TKDPT VQPHL+KCFE IA L F + L+IT M S E E +  +    ++   G VE+W+LE+E  M  S+R+ I +GLV+YK  PR EWV KW GQ V+A    YWT  V DA+ E  +    Y+K+   Q+D + A+VRG ++K  R TL ALIV++VHARDV+ N+I E + N NDF W+ QLRYYW+E N+  + +N+   YGYEYLGNT RLVITPLTDRCY TL GALHL  GGAP GPAGTGKTETTKDL KA A QCVVFNCSD LD++A+GKFFKGLAS GAW+CFDEFNRID+EVLSVVAQQI TIQ+A   + D  MFEG EL L P+CAVFITMNPGYAGR+ELPDNLKALFR VAMMVPDYALIAEISL+S GF +AR L+ KIV T++L SEQLSSQ HYD+GMRAVKSV++AAGNLK +    DE+++ LR+I DVN+PKFL  DL LFNGI SDLFP +     DY  L   I+    K  L+  + F++K  Q++E  +VRHG M+VG    GKT  Y+VL +AL  + +Q   + +  Q     +LNPK+ITMGQLYG+FD ++HEW+DG+L+   R   T+  PD++W IFDGPVDA+WIENMNTVLDDNKKLCL SGEII+L     ++FE  DL VASPATVSRCGMVY+EP+ LG  P    W++ LP AI   H++    +F+ +++  +  ++    +E+ PT++  +  +++ L+D  I  F     + EAK S      QM + +                            I   +E  F F+  WS GA+ + + RK FD   R  M+  ++            +P         +P +G +YDYRF                 E  +    KW HW   V  +  I  D K+++IIVPT D V+   +   LL   KP + VGPTGTGK+  I D L   M  + Y    I FSA+T+ANQTQ++I SKLD+RRKGVFGPP+GK II F+DDLNMP  E +G+QPPIEL+RQW D   WYD K     + L+D+ FI +MGPPGGGRNPIT R +RH N +  NE  +++M T+F +IL + I+      +  P    L++A +DVY +  + +LPTPAKSHY FNLRD S+V QG+L+  P ++     + RLW HE  RV+ DRLV DQDREWF N +    N   N+ ++ + K              I  L+Y DF      NK+Y+E  + + + K +E  L+++NQ++   MNLVLF  A+ HV RI+RI++QP  +ALL+G+GGSGRQSLT+LAA MA+YD FQ+E+SK+Y   EWR+DLKRI+  +   +   VFLFSD QIK ESFLED+NN+LN+G+VPNLY  D+ + +   M+ I +          +   L++ + +RVR  LH V+ MSPIG+ FR RLR+FP+LVNCCTIDWF  WP++AL +VA +FL D+   E+ + +  G + +CK  H S    SEKY  ELSRYNYVTPTSYLEL+  F  +  +K+ E+++ + R + GL+KL      +  +Q+EL   +P+L +A +E   T   +E+ S  A + + +V  EEA+A  +AK  E I+++   DL EA+P L+ +L++L+ L   DIT VR M+ PP+GVRLV+E VC++K +KP ++      G KI+D+W   K LL +  KFL+ L  +DKDNI   +++ I E Y+ ++ F P  I   S AC  +C+WV A+ KY  VAK VAPK+ ALE++  E       L + RA LK V+D++  L E+LE+  RR+ +LENK DLC  +L RA++LIGGL  EK RW  +  +L     N+ G++L+S+G VAYLG FT  +R     +W   +    +P +DK   +L+ T GDPV+IR+W I GLP D  SIEN +I+  SRRWPL IDPQGQAN+WIKN++K+N L VIKL+D DF+R LEN I+FG P L+EN+GEELDP LEP+LLKQTFKQ G++ IKLGD+II Y  DFRFYITTKL NPHY PE S KVT++NF ++P GL+DQLLG+VV+ ERP+LE+ KN+LI  +A  +++LKE+ED+IL  LS +EG+ ++D   I+ L +SK  SNEI  K    E+TE+ IDE R  Y+P+A+ + ILFF +ADLA IDPMYQYSL WF+N+F   I N+ K++ L +R+ N+ +YFT+SLY NVCRSLFEK KLLFSF+L + IL+H+  I   EWRFLL GG        NP+  W+  + W+E+  L  L  F    + FI +  + +K+I+DS+EPH ++LP EW + + D F  + VLRCLR DK+ +A+Q+FV   +G+++IEP   DL   + DS+ T+PL+F+LSPG DP + L KFADD  F   K  ++SLGQGQGP A ++I+  ++ G WV  QNCHLAPSWM  LE+ VE+++ +  H DFRLWLTS PS  FPV ILQNG KMT EPP+G++ N+ +SY S   SD +F  +    + W+ LL  LC FH ++ ER+KFGP+G+NI YEF + DLRI + QL MF+ +Y  V +  LQY  G  NYGGRVTDDWDRR ++ +L  FY  QV  + DY +  SG Y    P  D+ GY+ YI++LP+N  P +FG+H NA+IT    ET  L D +L  Q + S+ GGKS ++IV+EVS ++L  +P  F+ E + ++YP  YEQSMNTVL+QE++R+N LL+ I+SSL+++ KAI+GLVVMS  LE +  S+  +K+P  W  K+YPSLKPL S+V D   R+ F+  W DNG PP+FWISGF+F QAFLTG  QN+ARK  I ID + F ++++        E P DG Y++GLFL+GARWD     + ES PK L   MPVIWL P     IP    Y  P+YKT  R GTLSTTGHSTNFV ++ +PTDK ++HWI RGVA
Sbjct:  137 ILRYYYYIHNGIDTEHVAKMEDDWMNNMKNLLDND---LKAEH--PELLEDLEDEIKEDYLLSVKKAIVDFVLKE-PREKETDDTPIPEHRK--ELSVVPKP---WCRSF--INAYKFCQKHLYVTNPCMNQ--VLE-----LWDISF-KNLRLVDVEEFRGKKT---AIELQD-FQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRN--------------PSDLANMA----EHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSD--WAGDKTKIYLNPIILPEI-IEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFE-----EFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMD-YANFNTSDMNLNISVFHSHNRMGSIFDENKKNMEQKKEEFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIATKVKTKVEEFKEHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYT---ILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIKKGGGKELSPTSDINVVKSLLNLIDCQIDAF-----NDEAKIS------QMDQRD----------------------------ILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRF---------------IAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIK-LIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMRQIDRQRDKIRQTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDV---ELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGE-MKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDKVAKVVAPKKIALEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDK--FSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGEELDPLLEPLLLKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSANNKKKLKELEDEILNVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSA-WLPPKSWDELCRLDDLSVFHGIRQRFIEQK-DSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYA-PPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDR--NYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVA 3999          
BLAST of Dynein heavy chain axonemal vs. Planmine SMEST
Match: SMESG000012956.1 (SMESG000012956.1)

HSP 1 Score: 3115.09 bits (8075), Expect = 0.000e+0
Identity = 1749/3992 (43.81%), Postives = 2477/3992 (62.05%), Query Frame = 2
Query:  995 LLRYHLYL-DCMPMDGLGELDQSSLKRMIRLSKDETPILKKQKGLEDAVQSLEKEVMVDYWRSMNTIILHKLVGENPQKFNYITLPKPELPKVPMKGTIPMPKYDWDTKFEEFAFYSLLTKPEVVQAMCKSQYECLEARNKQLFHVPLAKHMRLEEFEQTQSQATQQVSLFLKDTWIDNLQKFIRTSLRDSKKGWFNIYETDFYVYTKSKL----------KKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQ--------GYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNP---LLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIP----QYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDM-LDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFE---KSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDAL-ETRDLKGLYVKLL-EQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYP-HRERVQKLFDVYLEETVDFMRHNL-REIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLI-----------FLP---------FPEEGLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVP-EYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPE-YISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRA--VAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVK--------------IEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLG----LQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQG-DKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKI-EPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCD-ICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKF-SKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTS--FSD-DFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTE-DYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            +LRY+ Y+ + +  + + +++   +  M  L  ++   LK +    + ++ LE E+  DY  S+   I+  ++ E P++      P PE  K      +P P   W   F     Y    K   V   C +Q   LE     L+ +   K++RL + E+ + + T   ++ L+D +     + I  +     K W N  +  +Y   K KL          ++F       M  S++ L LDS+ ++ N++ +       +          G+  P   L +     ++P F++ L+L++    +   ++ F  + +N++D+ ++ + +V ++E  +  D  WA +     L  + + E  ++K +  +R  L    +    +  E++K+ +L N+++ + ++  L   E +H        E  K+L +   L + I     + I +G F +  + + + L+K+ + +   +LD +    R+S  +  + ++ I RK    P   E++ EL +++     + + E ++ +DK       + + Y N +  D N   ++    +++     + ++N+ + +E F+         F E+LD+    V    +  D+ + ++   + + +  +L  A      FN  E  F   VT Y    ++     P+  L+    ++   +   M   +  V+ + V+  V  +Y+T+ K  K F   P  +++A ++K  +EEFK  +PLIQ L  PG+R RHW+ +SD +G ++  +  +  SK ++M L+  I     I+E AGKE+ +E+A+ KM  EW  ++F V++Y+ TGT+IL   D+I  +LDDHIV TQ+M  SP+ KPFE  I  WE+ L   QD++DEWL+ Q  WLYLEPIFSS DI  Q+P EG+++ ++D+ W++IMK    +  V+T+    ++L  LK+ N+LLE + KGL++YLE KR  FPRF+FLS+DELLEILS+TKDPT VQPHL+KCFE IA L F + L+IT M S E E +  +    ++   G VE+W+LE+E  M  S+R+ I +GLV+YK  PR EWV KW GQ V+A    YWT  V DA+ E  +    Y+K+   Q+D + A+VRG ++K  R TL ALIV++VHARDV+ N+I E + N NDF W+ QLRYYW+E N+  + +N+   YGYEYLGNT RLVITPLTDRCY TL GALHL  GGAP GPAGTGKTETTKDL KA A QCVVFNCSD LD++A+GKFFKGLAS GAW+CFDEFNRID+EVLSVVAQQI TIQ+A   + D  MFEG EL L P+CAVFITMNPGYAGR+ELPDNLKALFR VAMMVPDYALIAEISL+S GF +AR L+ KIV T++L SEQLSSQ HYD+GMRAVKSV++AAGNLK +    DE+++ LR+I DVN+PKFL  DL LFNGI SDLFP +     DY  L   I+    K  L+  + F++K  Q++E  +VRHG M+VG    GKT  Y+VL +AL  + +Q   + +  Q     +LNPK+ITMGQLYG+FD ++HEW+DG+L+   R   T+  PD++W IFDGPVDA+WIENMNTVLDDNKKLCL SGEII+L     ++FE  DL VASPATVSRCGMVY+EP+ LG  P    W++ LP AI   H++    +F+ +++  +  ++    +E+ PT++  +  +++ L+D  I  F     + EAK S      QM + +                            I   +E  F F+  WS GA+ + + RK FD   R  M+  ++            +P         +P +G +YDYRF                 E  +    KW HW   V  +  I  D K+++IIVPT D V+   +   LL   KP + VGPTGTGK+  I D L   M  + Y    I FSA+T+ANQTQ++I SKLD+RRKGVFGPP+GK II F+DDLNMP  E +G+QPPIEL+RQW D   WYD K     + L+D+ FI +MGPPGGGRNPIT R +RH N +  NE  +++M T+F +IL + I+      +  P    L++A +DVY +  + +LPTPAKSHY FNLRD S+V QG+L+  P ++     + RLW HE  RV+ DRLV DQDREWF N +    N   N+ ++ + K              I  L+Y DF      NK+Y+E  + + + K +E  L+++NQ++   MNLVLF  A+ HV RI+RI++QP  +ALL+G+GGSGRQSLT+LAA MA+YD FQ+E+SK+Y   EWR+DLKRI+  +   +   VFLFSD QIK ESFLED+NN+LN+G+VPNLY  D+ + +   M+ I +          +   L++ + +RVR  LH V+ MSPIG+ FR RLR+FP+LVNCCTIDWF  WP++AL +VA +FL D+   E+ + +  G + +CK  H S    SEKY  ELSRYNYVTPTSYLEL+  F  +  +K+ E+++ + R + GL+KL      +  +Q+EL   +P+L +A +E   T   +E+ S  A + + +V  EEA+A  +AK  E I+++   DL EA+P L+ +L++L+ L   DIT VR M+ PP+GVRLV+E VC++K +KP ++      G KI+D+W   K LL +  KFL+ L  +DKDNI   +++ I E Y+ ++ F P  I   S AC  +C+WV A+ KY  VAK VAPK+ ALE++  E       L + RA LK V+D++  L E+LE+  RR+ +LENK DLC  +L RA++LIGGL  EK RW  +  +L     N+ G++L+S+G VAYLG FT  +R     +W   +    +P +DK   +L+ T GDPV+IR+W I GLP D  SIEN +I+  SRRWPL IDPQGQAN+WIKN++K+N L VIKL+D DF+R LEN I+FG P L+EN+GEELDP LEP+LLKQTFKQ G++ IKLGD+II Y  DFRFYITTKL NPHY PE S KVT++NF ++P GL+DQLLG+VV+ ERP+LE+ KN+LI  +A  +++LKE+ED+IL  LS +EG+ ++D   I+ L +SK  SNEI  K    E+TE+ IDE R  Y+P+A+ + ILFF +ADLA IDPMYQYSL WF+N+F   I N+ K++ L +R+ N+ +YFT+SLY NVCRSLFEK KLLFSF+L + IL+H+  I   EWRFLL GG        NP+  W+  + W+E+  L  L  F    + FI +  + +K+I+DS+EPH ++LP EW + + D F  + VLRCLR DK+ +A+Q+FV   +G+++IEP   DL   + DS+ T+PL+F+LSPG DP + L KFADD  F   K  ++SLGQGQGP A ++I+  ++ G WV  QNCHLAPSWM  LE+ VE+++ +  H DFRLWLTS PS  FPV ILQNG KMT EPP+G++ N+ +SY S   SD +F  +    + W+ LL  LC FH ++ ER+KFGP+G+NI YEF + DLRI + QL MF+ +Y  V +  LQY  G  NYGGRVTDDWDRR ++ +L  FY  QV  + DY +  SG Y    P  D+ GY+ YI++LP+N  P +FG+H NA+IT    ET  L D +L  Q + S+ GGKS ++IV+EVS ++L  +P  F+ E + ++YP  YEQSMNTVL+QE++R+N LL+ I+SSL+++ KAI+GLVVMS  LE +  S+  +K+P  W  K+YPSLKPL S+V D   R+ F+  W DNG PP+FWISGF+F QAFLTG  QN+ARK  I ID + F ++++        E P DG Y++GLFL+GARWD     + ES PK L   MPVIWL P     IP    Y  P+YKT  R GTLSTTGHSTNFV ++ +PTDK ++HWI RGVA
Sbjct:  137 ILRYYYYIHNGIDTEHVAKMEDDWMNNMKNLLDND---LKAEH--PELLEDLEDEIKEDYLLSVKKAIVDFVLKE-PREKETDDTPIPEHRK--ELSVVPKP---WCRSF--INAYKFCQKHLYVTNPCMNQ--VLE-----LWDISF-KNLRLVDVEEFRGKKT---AIELQD-FQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANM---AEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSD--WAGDKTKIYLNPIILPEI-IEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFE-----EFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMD-YANFNTSDMNLNISVFHSHNRMGSIFDENKKNMEQKKEEFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIATKVKTKVEEFKEHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYT---ILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIKKGGGKELSPTSDINVVKSLLNLIDCQIDAF-----NDEAKIS------QMDQRD----------------------------ILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRF---------------IAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIK-LIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMRQIDRQRDKIRQTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDV---ELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGE-MKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDKVAKVVAPKKIALEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDK--FSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGEELDPLLEPLLLKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSANNKKKLKELEDEILNVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSA-WLPPKSWDELCRLDDLSVFHGIRQRFIEQK-DSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYA-PPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDR--NYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVA 4022          
BLAST of Dynein heavy chain axonemal vs. Planmine SMEST
Match: SMESG000065732.1 (SMESG000065732.1)

HSP 1 Score: 2921.34 bits (7572), Expect = 0.000e+0
Identity = 1618/3760 (43.03%), Postives = 2304/3760 (61.28%), Query Frame = 2
Query: 1805 PIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNPLLESVGMEEPQVKKLRENLRETLKKALI-PMES----YALEYNKFLNLQNQ-DITEYVNEFLRNYEAQHHTALEIKLEVEKHLNEKEILEQLIPQYIIIGP-------FYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWI--LTIPDMLDEQQEV-IDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIR------------------MSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFN--------------------------------------ELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFEK---STYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDALETRDLKGLYV---KLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFXXXXXXXXXXXXXXXXXDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVXXXXXXXXXXXXXRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHR--ERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMQKNNQNLKAPLRPLKMKKFNKADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEE-----------GLVYDYRFDHGGTLSLXXXXXXXXXXXXXXXXXXWVHWMANVPEYIIKPDMK-YSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPE-YISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWI--MRAVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVK--------------IEPLLYGDFMS--VAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGLQA--TKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTRXXXXXXXXXXXXXIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQG-DKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKI-EPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKF-SKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTS---FSDDFLNSI-AKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQV-MTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSE-IYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVA 12718
            PI  + L  D+    +    D    +   + +   Q++Q +P ++  I  +      P+     +    +   +E LR +  +    P E     Y + Y+  +N + + +IT+++NE        +H+  E    +EK         Q+I Q I   P         +  E+++ GL K+   ++  +L+ +A++ RK   +  E F+ I +     P T +EL +L  ++       M+   +++   K   DY L     +  S +D      +  W  KI+                    ++Q  + L+ + ++  K++V +   F E      M    M  Y           +VR +  +L EA+      N  E LF  P + + ++ ++    +PF  L+  V  + K     ++     + ++ +E  V E Y+ + K  K FN                                      + P+  E+  +    I EFK  IP+I  L  PG++ RHW+ +S      I P S  + +K L M L  ++E  ++I+  A +E+ +E  + KM  EWE ++F +  Y+ +G  IL   D+I QLLDD IV TQ+M  SP+ KPFE  I  WE  L  T + ID+WL+ Q QWLYLEPIFSSEDI +Q+P EG+ +  +DR W+ IM+    +P+V+     + +L  LKE N LLE++ KGL+ YLE KR  FPRF+FLS+DE+LEILS+TKDP  VQPHL+KCFE IAKL+F+  L+I AMFS E EKI   +   ++   G VE W+L+++++M  S+R +I      Y    R EWV +W GQVV+   Q YWT EV +ALE R ++GL +   K  +Q+  +  +VRG +    R+TL AL+ I+VHARDVV +M  + +++ NDF W+SQLRYYW EEN  +R  NA   Y YEYLGN+ RLVITPLTDRCY TL GA HL   GAP GPAGTGKTETTKDL KA A+QCVVFNCSD LD++AMGKFFKGLAS+GAWACFDEFNRI++EVLSVVAQQI  I +A Q  ++ FMFEG EL L  +C V ITMNPGYAGR+ELPDNLK LFRPVAMMVPDYA+I EISL+S+GF DAR+L+ KIVTT++L SEQLSSQ HYD+GMRAVK+V+SAAGNLK +    +E ++ LR+I DVN+PKFL  D+ LF GI+SDLFP +     DY   L ++     K  L+ V  F +K IQ +E  +VRHG MLVG    GKT+   VL  A+S L ++       F+ V    +NPKSITMGQL+G+FD ++HEWTDGI +   R+  + + PD++W IFDGP+D +WIE+MNTVLDDNKKLCL SGEII++ + M+++FE  DL+ ASPATVSRCGM+YL+PS +G  P    W+ S P+ +      E +  LF+  ++E + F+  N + ++PT +  L  N++ L+D  + P +               E++    N+NLK                             +S +LF++ WS G   D DSR+KFD + R  +  +    P P+E           GLVYDY ++H                   + +  W HW  ++ + + K + K   + +VPT+D  R   I +  +  ++ +M VGPTGTGK++   DKL   +P + Y+  F+ FSA+T+ANQTQ +I SKLD+RRKGVFGPP+GK  + F+DD+NMPA E++G+QPPIEL+RQ+ D   WYD K   +   L DI  + +MGPPGGGRN +T R +RHFN++      +D+M  +F T++  ++      ++   + +T+V+A ++VY    S +LPTPAKSHY FNLRD S+V  G+ +++ E +       RLW HE  RVF DRL+ D DREW   LL   +   F + ++ + +              +  L++GD+M+     E++ Y E    ++   ++E+ ++++N  +  KM+LV+F   + H+ RI RI+  P GNALL+G+GGSGRQSLT+LAA MA    FQ E+SKNYG  EWR+DLK ++  AG E K  VFL +D+QIKDESFLED++N+LN+G+VPNL++ ++   +   ++   Q     A  +   LF+ +  R R  LH V+  SPIG  FR RLRQFPAL+NCCTIDWF  WP++ALE VALK L  +   ++ +++    + + K  H SV N SE++ + L R NYVTPTSYLEL+  F  +   K+ E  + + R  NGLDKL +  E V  +Q +LE ++PQL QA + ++    +I R+S +A++ ++ V  EE +  +KA   + + D+ + DL EA+PAL+ +L +L  L   DIT V+ M  PP GV+LV+E +CIM+++KP+++   + PG K+ DYW   K LL D G FL  L  YDKDNIS  ++ KI + +I +  F P  + + S A   +C+W+ AM  Y  VAK VAPK+  L ++  +L++    L E + +L+ VED++  L++KL+     +  L+ + +LC  +L RA KLIGGL  EK RW  + VNL+ + +N++G+VL+SAG +AYLG FT  YR+    +WS   K+Y +P + K   +L    G+PVKI+ W I GLP+D+ SI+N+VIV  +RRWPL IDPQ QAN+WIKN++KE GL+VIKL+D DF+R+LENAI+FG P L+ENVGEELDP+LEP+LLKQ FKQ G  +++LG++II Y  +FR YITTKL NPHY PE++ KV+++NF ++  GLEDQLLG+VVA+E+P+LEDA+ +LI+++A  R+ LKE ED+IL  LS +EG+ +++   IQ L++SK  S++I  K   AE+T++ ID  R  Y P+A  + ILFF + DL  IDPMYQYSL WF+N++ N I ++ K+  L +R+  ++++FT+SLYSNVCRSLFEK KLLFSFLL ++IL  +G ++  E+ FLL GG        NPA  W+SD+ W+EI  L  L  F  F E F    L  ++  +DS +P   K+P  W    D F+ LLVLRC+R DK+  A+ ++V   LG++FIEP   DL   ++DS    PLIFVLSPG DP   L KFA+D  F   K ++ISLGQGQGP A ++I  A   G WV  QNCHLA SWM ++E++ E++  +  + +FRLWLTS PSPKFPV +LQNG KMT EPP G++ NL +S+ +      +F N    K + +  LL  LC FH ++ ER+KFGP+G+NIPY F D DLRI   QL MF+ EY  VPF  ++Y  G  NYGGRVTDDWDRRC+M +L  FYN  V M   Y +S SG Y  + P  ++T Y+ +I++LP    PE+FG+H+N +IT  + ++  LLD +L    +++++GG S E  + E++ +IL  MP  F++E     YPV Y +SMNTVL+QE+ R+N+L N I+ SL++LLKAI+GLVVMS  LE+M++SL   K+P  W+  +YPSLKPL S++ DL +R+ F+Q W + G P  FW+SGF+F QAFLTG +QNFARK  I ID + F F+V+  +   +   P+DG YI GLFL+GARW+   M+L E +PK L+  +PVIWL P     I  +E  Y CPVYKT  R G LSTTGHSTNFV  + +PT++   HW+KRG A
Sbjct:  312 PILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDAIINSN----PQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNE--------NHSFDEYGEYIEKF--------QVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDN---HEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLIAELQK-HKVRVDEFNEFGE------MDSEMMKQY---------VQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAERDREKKKKTRTDTDEPLPPPEEDDTPKPPAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVDDIQQLLDDQIVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALE-RGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEE---GNDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVDECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHL---------------EKEDVAENRNLKI--------------------------WFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEH-------------------KVRGYWHHW-NDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKI-VLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAV---DMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRADLAEAIPALEAALSALDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMG-FLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSTLCKSYKIPCSVK--FSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGEELDPSLEPLLLKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILKKQETAEETQKKIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPASSWLSDKSWDEICRLNDLKEFKGFKESF-SANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTY-IVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTSSGGGSSENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQ--PNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTA 3956          
The following BLAST results are available for this feature:
BLAST of Dynein heavy chain axonemal vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH10.000e+062.13dynein axonemal heavy chain 1 [Source:HGNC Symbol;... [more]
DNAH70.000e+044.83dynein axonemal heavy chain 7 [Source:HGNC Symbol;... [more]
DNAH120.000e+044.04dynein axonemal heavy chain 12 [Source:HGNC Symbol... [more]
DNAH30.000e+044.31dynein axonemal heavy chain 3 [Source:HGNC Symbol;... [more]
DNAH60.000e+039.54dynein axonemal heavy chain 6 [Source:HGNC Symbol;... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhc-10.000e+028.39Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-10.000e+028.82Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-10.000e+028.82Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
che-34.402e-15835.47Cytoplasmic dynein 2 heavy chain 1 [Source:UniPro... [more]
dhc-33.452e-4325.26Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dhc36C0.000e+041.37gene:FBgn0013810 transcript:FBtr0304742[more]
Dnah30.000e+041.06gene:FBgn0035581 transcript:FBtr0289982[more]
Dhc62B0.000e+038.99gene:FBgn0013811 transcript:FBtr0303106[more]
Dhc16F0.000e+037.76gene:FBgn0283476 transcript:FBtr0074509[more]
kl-20.000e+038.48gene:FBgn0001313 transcript:FBtr0346722[more]
back to top
BLAST of Dynein heavy chain axonemal vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah10.000e+060.67dynein, axonemal, heavy chain 1 [Source:ZFIN;Acc:Z... [more]
dnah10.000e+059.44dynein, axonemal, heavy chain 1 [Source:ZFIN;Acc:Z... [more]
dnah70.000e+042.93dynein, axonemal, heavy chain 7 [Source:ZFIN;Acc:Z... [more]
dnah120.000e+043.91dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:... [more]
CR450723.10.000e+043.90dynein, axonemal, heavy chain 12 [Source:NCBI gene... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plekhg30.000e+061.80pleckstrin homology and RhoGEF domain containing G... [more]
plekhg30.000e+061.75pleckstrin homology and RhoGEF domain containing G... [more]
plekhg34.135e-2260.97pleckstrin homology and RhoGEF domain containing G... [more]
olfm40.000e+044.02olfactomedin 4 [Source:Xenbase;Acc:XB-GENE-5725072... [more]
olfm40.000e+043.70olfactomedin 4 [Source:Xenbase;Acc:XB-GENE-5725072... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnah10.000e+062.65dynein, axonemal, heavy chain 1 [Source:MGI Symbol... [more]
Dnah7b0.000e+044.65dynein, axonemal, heavy chain 7B [Source:MGI Symbo... [more]
Dnah7b0.000e+044.65dynein, axonemal, heavy chain 7B [Source:MGI Symbo... [more]
Dnah7b0.000e+044.65dynein, axonemal, heavy chain 7B [Source:MGI Symbo... [more]
Dnah7a0.000e+045.14dynein, axonemal, heavy chain 7A [Source:MGI Symbo... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|E9Q8T7|DYH1_MOUSE0.000e+062.65Dynein heavy chain 1, axonemal OS=Mus musculus OX=... [more]
sp|Q9P2D7|DYH1_HUMAN0.000e+062.13Dynein heavy chain 1, axonemal OS=Homo sapiens OX=... [more]
sp|Q63164|DYH1_RAT5.091e-2961.09Dynein heavy chain 1, axonemal OS=Rattus norvegicu... [more]
sp|Q8WXX0|DYH7_HUMAN0.000e+044.83Dynein heavy chain 7, axonemal OS=Homo sapiens OX=... [more]
sp|Q63170|DYH7_RAT0.000e+043.32Dynein heavy chain 7, axonemal OS=Rattus norvegicu... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|191505400.000e+069.92tr|A0A4E0R5U1|A0A4E0R5U1_FASHE Dynein heavy chain ... [more]
gnl|BL_ORD_ID|229352280.000e+069.43tr|A0A4S2LQT7|A0A4S2LQT7_OPIFE Uncharacterized pro... [more]
gnl|BL_ORD_ID|214705540.000e+070.18tr|A0A1S8WJX6|A0A1S8WJX6_9TREM ATPase family prote... [more]
gnl|BL_ORD_ID|214886520.000e+070.32tr|A0A074ZNX3|A0A074ZNX3_9TREM Uncharacterized pro... [more]
gnl|BL_ORD_ID|228349960.000e+068.04tr|A0A5K4FAN6|A0A5K4FAN6_SCHMA Uncharacterized pro... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah120.000e+043.54dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:... [more]
dnah20.000e+040.38dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
si:dkeyp-86b9.10.000e+034.35dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
ENSAMXT00000016172.20.000e+035.00pep primary_assembly:Astyanax_mexicanus-2.0:4:1379... [more]
dnah50.000e+032.91dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH60.000e+040.25dynein axonemal heavy chain 6 [Source:HGNC Symbol;... [more]
ENSPMAT00000001140.10.000e+041.16pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 ge... [more]
ENSPMAT00000003955.10.000e+042.56pep scaffold:Pmarinus_7.0:GL495754:4342:49943:-1 g... [more]
ENSPMAT00000009595.16.560e-2633.76pep scaffold:Pmarinus_7.0:GL478108:144315:184457:1... [more]
ENSPMAT00000001372.10.000e+033.52pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 ge... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DYN11.090e-10727.40Cytoplasmic he