SMED30020573

Overview
NameSMED30020573
Smed IDSMED30020573
Length (bp)1777
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30020573 (SMED30020573) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30020573 (SMED30020573) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020573

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30020573SMESG000042830.1 SmedASXL_009420SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30020573SMESG000042830.1 dd_Smed_v4_30727_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020573SMESG000042830.1 dd_Smed_v4_30727_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30020573SMESG000042830.1 dd_Smed_v4_30727_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30020573SMESG000042830.1 dd_Smed_v4_30727_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30020573SMESG000042830.1 dd_Smed_v4_30727_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30020573SMESG000042830.1 dd_Smed_v6_30727_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30020573SMESG000042830.1 dd_Smed_v6_30727_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30020573SMESG000042830.1 dd_Smed_v6_30727_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30020573SMESG000042830.1 OX_Smed_1.0.12118ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30020573 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.006731:13837..19925 +8863
Homology
BLAST of SMED30020573 vs. TrEMBL
Match: A0A267EP27 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015385g2 PE=3 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 3.207e-6
Identity = 56/222 (25.23%), Postives = 90/222 (40.54%), Query Frame = 1
Query:   79 NCVKVITMKSESCQKNLSYYIRLFSQRTSIRGIPKVENSKLLSIRWFWVIFIFCAHVLMISLCVLLIMRYFRFDTTMKISNSRVTFREFPEITICSK-----RFFDIGTTELP---NPFVYLDDYSMKILARVADLIE----NNNIERAIQIIKNQYTTSSFFHDYFSFIQQRTISMVDSLVSSCNISSLDGRFSKNKVLPCKIKAVYNPLYLNCLAYSMPQ 708
            N  K I   S    K+L   +  F QRT+I G+  +  SK    + FW+       V  I       M++    T + + +    F EFP++TICS+     RF++ GT + P   N F  +D     +  +  D +        I    ++I++QY +    H  F+         +D LV  C+    D R         +   + NP YLNC  +  P+
Sbjct:    3 NDRKQIKANSRGKDKDLYCQMSGFCQRTTIHGLSHMYQSKTSKRKIFWLTVFVLGLVATIVHLTFHAMQFLESPTIITLDHEGSEF-EFPDVTICSQTPTTSRFYERGTEKFPNIQNGFTAMDLLLYPVYNQTYDSVHLLPYKEEILLHKRLIQHQYASMPTKHKGFA---------LDELVIKCSFHKSDCRL--------QFTLLQNPYYLNCYTFQPPE 206          
BLAST of SMED30020573 vs. TrEMBL
Match: W6UN59 (FMRFamide-activated amiloride-sensitive sodium channel OS=Echinococcus granulosus OX=6210 GN=EGR_05521 PE=3 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 5.926e-6
Identity = 44/196 (22.45%), Postives = 85/196 (43.37%), Query Frame = 1
Query:  148 FSQRTSIRGIPKVENSKLLSIRWFWVIFIFCAHVLMISLCVLLIMRYFRFDTTMKISNSRVTFREFPEITICSKRFFDIGTTELPNPFVYLD--DYSMKILARVADLIENNNIERAIQIIKNQYTTSSFFHDYFSFIQQRTISMVDSLVSSCNISSLDGRFSKNKVLPC----KIKAVYNPLYLNCLAYSMPQSLS 717
            F Q T+IRG+ ++ NS+   IR  W+ F+ C ++ + +  +LL  +YF +D        R T   FP +T+C+ R       +      + D  D++  +    A L    N     +++ +  +   +              + +  V  C +  L+G  S   + PC    + +  ++ LYLNC ++ +  S+S
Sbjct:   20 FCQTTTIRGVSRIVNSRNKGIRSLWLTFVICLYIGLFTCMILLASQYFDYDVIHPPRVLRDTPSPFPSLTLCNLRPLSPPGMKRIRQLQFRDPRDFAKNLNEFAAGLYFYRNRSHDYELVSSAISMGGYLESLPKGSSYSLGHLQNETVIQCMVLYLEG--SSRIIEPCEKVGRWRHFFHALYLNCHSFDIDPSIS 213          
BLAST of SMED30020573 vs. Planmine SMEST
Match: SMESG000042830.1 (SMESG000042830.1)

HSP 1 Score: 1043.49 bits (2697), Expect = 0.000e+0
Identity = 548/548 (100.00%), Postives = 548/548 (100.00%), Query Frame = 1
Query:  100 MKSESCQKNLSYYIRLFSQRTSIRGIPKVENSKLLSIRWFWVIFIFCAHVLMISLCVLLIMRYFRFDTTMKISNSRVTFREFPEITICSKRFFDIGTTELPNPFVYLDDYSMKILARVADLIENNNIERAIQIIKNQYTTSSFFHDYFSFIQQRTISMVDSLVSSCNISSLDGRFSKNKVLPCKIKAVYNPLYLNCLAYSMPQSLSINKSSKFQMEITLNLAQKPKGSVTETFKMDEYVSDNADDDGFSENRIYITXXXXXXXXXXXXXXXXCQYFNHYVVERSQEQFYFTSSPTATCRNNELTANSFGVSFTYSRESLCNSLMIQRYVYERCQCYMDSLPNNETLYMVSNLCISNDTLYQCAEDVINSSQDLMTTLCLPSCTKTEYSVIYKFKPFYSSKFSEVMDELLYQAEDCKEIPECMNNAYCILRQLFQTFSNASCIAENPVRRKRSVADLVTESVQNXXXXXXXXXXXXXXXXCDKISLKVELRPKMQIQKESLVVEVNTLLSQTGGLCAFITGLTFTFIAEVMETLIFWISDILTKRKISE 1743
            MKSESCQKNLSYYIRLFSQRTSIRGIPKVENSKLLSIRWFWVIFIFCAHVLMISLCVLLIMRYFRFDTTMKISNSRVTFREFPEITICSKRFFDIGTTELPNPFVYLDDYSMKILARVADLIENNNIERAIQIIKNQYTTSSFFHDYFSFIQQRTISMVDSLVSSCNISSLDGRFSKNKVLPCKIKAVYNPLYLNCLAYSMPQSLSINKSSKFQMEITLNLAQKPKGSVTETFKMDEYVSDNADDDGFSENRIYITSVSDYPFDFDFDVPFSCQYFNHYVVERSQEQFYFTSSPTATCRNNELTANSFGVSFTYSRESLCNSLMIQRYVYERCQCYMDSLPNNETLYMVSNLCISNDTLYQCAEDVINSSQDLMTTLCLPSCTKTEYSVIYKFKPFYSSKFSEVMDELLYQAEDCKEIPECMNNAYCILRQLFQTFSNASCIAENPVRRKRSVADLVTESVQNTPSSTSTLTSVPVEESCDKISLKVELRPKMQIQKESLVVEVNTLLSQTGGLCAFITGLTFTFIAEVMETLIFWISDILTKRKISE
Sbjct:    1 MKSESCQKNLSYYIRLFSQRTSIRGIPKVENSKLLSIRWFWVIFIFCAHVLMISLCVLLIMRYFRFDTTMKISNSRVTFREFPEITICSKRFFDIGTTELPNPFVYLDDYSMKILARVADLIENNNIERAIQIIKNQYTTSSFFHDYFSFIQQRTISMVDSLVSSCNISSLDGRFSKNKVLPCKIKAVYNPLYLNCLAYSMPQSLSINKSSKFQMEITLNLAQKPKGSVTETFKMDEYVSDNADDDGFSENRIYITSVSDYPFDFDFDVPFSCQYFNHYVVERSQEQFYFTSSPTATCRNNELTANSFGVSFTYSRESLCNSLMIQRYVYERCQCYMDSLPNNETLYMVSNLCISNDTLYQCAEDVINSSQDLMTTLCLPSCTKTEYSVIYKFKPFYSSKFSEVMDELLYQAEDCKEIPECMNNAYCILRQLFQTFSNASCIAENPVRRKRSVADLVTESVQNTPSSTSTLTSVPVEESCDKISLKVELRPKMQIQKESLVVEVNTLLSQTGGLCAFITGLTFTFIAEVMETLIFWISDILTKRKISE 548          
BLAST of SMED30020573 vs. Planmine SMEST
Match: SMESG000013147.1 (SMESG000013147.1)

HSP 1 Score: 63.5438 bits (153), Expect = 3.204e-10
Identity = 52/207 (25.12%), Postives = 94/207 (45.41%), Query Frame = 1
Query:  133 YYIRLFSQRTSIRGIPKVENSKLLSIRWFWVIFIFCAHVLMISLCVLLIMRYFRFDTTMKISNSRVTFREFPEITICSKRFFDIGTTELPNPFVYLDDYSMKILARVAD-----LIENNNIERAIQIIKNQYTTSSFFHDYF------SFIQQRTISMVDSLVSSCNISSLDGRFSKNKVLPCKIKAVY----NPLYLNCLAYSMPQ 708
            ++ + F + TS+RG+PK+ +S+    R  WVIF+    +  ++  +LLI +Y  +D   +   S      FP +T C+ R F   T EL      L   ++K L          ++ N++I   +     Q  TS+ F + F      S  ++      +S++  C+I   +G  S+     C++   +    N L+LNC  Y+M +
Sbjct:  146 FHFKKFCETTSLRGVPKIVHSQKKQFRMLWVIFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTVEL------LKRSNIKSLVDFLHGFGRSVVMNSSIMLNLTSEDKQLLTSTLFLELFLMNLPLSISKESIGHSQNSMIIDCSIQYANG--SEISSTKCELGGKWILTKNELFLNCYTYTMDE 344          
BLAST of SMED30020573 vs. Planmine SMEST
Match: SMESG000013147.1 (SMESG000013147.1)

HSP 1 Score: 63.1586 bits (152), Expect = 3.395e-10
Identity = 52/207 (25.12%), Postives = 94/207 (45.41%), Query Frame = 1
Query:  133 YYIRLFSQRTSIRGIPKVENSKLLSIRWFWVIFIFCAHVLMISLCVLLIMRYFRFDTTMKISNSRVTFREFPEITICSKRFFDIGTTELPNPFVYLDDYSMKILARVAD-----LIENNNIERAIQIIKNQYTTSSFFHDYF------SFIQQRTISMVDSLVSSCNISSLDGRFSKNKVLPCKIKAVY----NPLYLNCLAYSMPQ 708
            ++ + F + TS+RG+PK+ +S+    R  WVIF+    +  ++  +LLI +Y  +D   +   S      FP +T C+ R F   T EL      L   ++K L          ++ N++I   +     Q  TS+ F + F      S  ++      +S++  C+I   +G  S+     C++   +    N L+LNC  Y+M +
Sbjct:  143 FHFKKFCETTSLRGVPKIVHSQKKQFRMLWVIFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTVEL------LKRSNIKSLVDFLHGFGRSVVMNSSIMLNLTSEDKQLLTSTLFLELFLMNLPLSISKESIGHSQNSMIIDCSIQYANG--SEISSTKCELGGKWILTKNELFLNCYTYTMDE 341          
BLAST of SMED30020573 vs. Planmine SMEST
Match: SMESG000004049.1 (SMESG000004049.1)

HSP 1 Score: 57.3806 bits (137), Expect = 2.025e-8
Identity = 118/582 (20.27%), Postives = 228/582 (39.18%), Query Frame = 1
Query:   97 TMKSESCQKNLSYYIRLFSQRTSIRGIPKVENSKLLSIRWFWVIFIFCAHVLMISLCVLLIMRYFRFDTTMKISNSRVTFREFPEITICSKRFFDIGTTELPNPFVYLDDYSMKILARVADLIENNNIER--AIQIIKNQYTTSSFFHDYFSFIQQRTISMVDSLVSSCNISSLDGRFSKNKVLPCK--IKAVYNPLYLNCLAYSMPQSLSINKSSKFQM----EITLNLAQKPKGSVTETFKMDE------YVSDNADD---DGFSENRIYITXXXXXXXXXXXXXXXXCQYFNHYVVERSQEQFYFTSSPTATCRNNELTAN---SFGVSFTYSRESLCNSLMIQRYVYERCQCYMDSLP-------NNETLYMVSNLCISNDTLYQCA-----EDVINSSQDLMTTLCLPSCT--------KTEYSVIYKFKPFYSSKFSEVMDELLYQAEDCKEIPECMNNAYCILRQLFQTFSNASCIAENPVRRKRSVADLVTESVQNXXXXXXXXXXXXXXXXCDKISLKVELRPKMQIQK-ESLVVEVNTLLSQTGGLCAFITGLTFTFIAEVMETLIFWISDI 1719
            T+ ++  QK  S  I+ F   +SIRG+ ++  ++  S++  W+IF+    VL+    + L   Y  ++T +    +      FP IT+C+   F +   +L      L    +K  + +  ++++N ++     +++    T +S+F    SF  Q  IS   S +  C +   + +        C   IK V N  +L C    +  + S N  +   +    +++ +L     G V + FK         +  D   D   DGF+      T                        V+ S  ++   ++P   C + E+  +    F  +F+Y+ ++ C +  I + +Y++C CY    P       NN T     NL  S + + + +     E +    Q +    C+  CT         T +  +  +K ++    ++ ++ L           E +N+A  I +Q          I+++     ++V +L+  S                    D + L +  +  M ++K E   +  + LLS+ GGL +   G+TFT I E+ E LI +   I
Sbjct:   31 TVHAKKLQKRESLIIK-FCSNSSIRGLSRISANQNFSLKSIWLIFLLSMSVLLTVGSLSLTFEYLEYNTLINSRENHEMITIFPGITLCNHYPFHMDANKLWQSAEVLS--PLKFNSIIRQMVKDNYLKNFSLAKLLFTSDTITSYFETIGSFKAQ-MISHNSSQIMYCLLLLKNSKIRVGHHNECGIIIKTVPNSQFLTCQNIRIHSNYSTNAVALGLIIHMDDLSKHLNTLELGLVQDVFKQAHGLRILLHEPDTLADFSLDGFNVEPGKFTD-----------------------VKFSAVKWIKINTPKEPCWSQEIIKSKDKKFNNNFSYTYDT-CKNEEIGKLIYKQCNCYSSKYPLPFDIDENNVTFCSKINLSDSLEVIKRLSCLDQLESLEPIKQIMSENKCIRRCTYMTYECHLSTAHWALSNWKLYWLMTMNDALNALESNNH------ESINSAKSIFQQY---------ISQSETNLSKNVTNLIKTS--------------------DDLFLVINRQSFMTLEKVEVFSLTRSALLSRLGGLSSITLGITFTTIFEIAEFLITFFQGI 549          
BLAST of SMED30020573 vs. Planmine SMEST
Match: SMESG000053390.1 (SMESG000053390.1)

HSP 1 Score: 54.299 bits (129), Expect = 2.013e-7
Identity = 35/128 (27.34%), Postives = 60/128 (46.88%), Query Frame = 1
Query:  121 KNLSYYIRLFSQRTSIRGIPKVENSKLLSIRWFWVIFIFCAHVLMISLCVLLIMRYFRFDTTMKISNSRVTFREFPEITICSKR-FFDIGTTELPNPFVYLDDYSMKILARVADLIENNNIERAIQII 501
            KN   ++  F    S+RG+ K   S+ L I+  W+IFI    +LM+   + ++  Y  ++TTM+         +FP ITIC  + FF        N  +   D+S+K+       +E    ++A  I+
Sbjct:    6 KNRESHLGTFFTNCSVRGVSKAYKSRSLIIKLLWLIFITVMMILMLYSIIKILKEYMEYNTTMQNVLQFEDASDFPAITICPHQPFFQRSIKFFKNKGMSPKDFSLKLRKVAKAFLEKQAPDKAENIL 133          
The following BLAST results are available for this feature:
BLAST of SMED30020573 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020573 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020573 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020573 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020573 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020573 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020573 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020573 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 2
Match NameE-valueIdentityDescription
A0A267EP273.207e-625.23Uncharacterized protein OS=Macrostomum lignano OX=... [more]
W6UN595.926e-622.45FMRFamide-activated amiloride-sensitive sodium cha... [more]
back to top
BLAST of SMED30020573 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020573 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020573 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020573 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020573 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020573 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042830.10.000e+0100.00SMESG000042830.1[more]
SMESG000013147.13.204e-1025.12SMESG000013147.1[more]
SMESG000013147.13.395e-1025.12SMESG000013147.1[more]
SMESG000004049.12.025e-820.27SMESG000004049.1[more]
SMESG000053390.12.013e-727.34SMESG000053390.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020573 ID=SMED30020573|Name=SMED30020573|organism=Schmidtea mediterranea sexual|type=transcript|length=1777bp
GTTTAGAAATGCTATTTTCTAATTCTAATAATTATGTGTTTTCCATTAAT
TATTTCATAAATCCTATTATTTTGTTTTAATTGCGTAAAAGTTATAACAA
TGAAAAGTGAGTCTTGCCAGAAAAATCTTTCTTACTATATTCGACTGTTC
TCTCAGCGGACTTCAATCCGAGGAATTCCAAAAGTTGAAAATTCTAAATT
ACTTTCAATCCGATGGTTTTGGGTAATCTTCATATTTTGTGCCCATGTTT
TAATGATATCTCTCTGTGTTTTATTAATTATGAGATATTTCCGGTTCGAC
ACAACAATGAAAATTAGTAATTCCAGAGTGACCTTTCGAGAGTTTCCGGA
AATCACAATTTGCTCGAAAAGGTTTTTTGATATCGGAACGACAGAATTAC
CCAATCCGTTTGTTTATTTGGATGATTATAGCATGAAAATCTTGGCTCGT
GTGGCAGATCTAATTGAAAACAACAACATTGAACGAGCTATACAAATAAT
TAAGAACCAATATACGACATCGTCATTTTTTCACGATTATTTCAGTTTCA
TCCAGCAAAGAACAATTTCTATGGTAGATTCTTTAGTAAGCAGTTGCAAT
ATCTCTTCGTTGGATGGGAGATTTAGTAAAAATAAAGTTTTACCATGCAA
AATCAAGGCGGTCTACAATCCACTGTATTTAAACTGTTTGGCATATAGTA
TGCCTCAATCACTTAGCATAAATAAATCTTCAAAGTTTCAAATGGAAATA
ACTCTTAATCTGGCTCAAAAACCGAAAGGCTCCGTCACCGAAACATTCAA
AATGGATGAGTATGTATCCGACAATGCCGACGATGACGGATTTTCAGAAA
ATCGAATCTACATAACATCAGTTTCCGATTACCCATTTGACTTTGATTTT
GACGTACCCTTCAGTTGCCAATATTTCAACCATTATGTAGTTGAAAGGTC
GCAAGAACAGTTTTATTTCACTTCTAGCCCAACAGCGACTTGTAGAAACA
ACGAGCTGACTGCTAACAGTTTTGGGGTCAGTTTTACTTATTCCAGAGAA
TCTCTTTGCAACTCATTAATGATACAAAGATATGTTTATGAAAGATGCCA
GTGCTACATGGATTCTTTACCAAATAATGAAACGCTATACATGGTATCCA
ATTTGTGTATCTCCAATGATACACTGTATCAATGTGCCGAAGATGTTATA
AATTCTTCACAAGATTTAATGACTACCTTATGTTTGCCATCATGCACAAA
GACTGAATATTCTGTTATTTATAAATTCAAGCCTTTTTATTCATCAAAGT
TTAGTGAGGTAATGGATGAATTATTGTATCAAGCAGAGGATTGCAAAGAA
ATTCCCGAATGCATGAACAACGCCTATTGCATCTTGCGACAGTTATTTCA
GACATTTTCTAACGCATCATGCATTGCGGAAAATCCTGTTAGAAGAAAAC
GATCAGTAGCCGATTTGGTAACAGAGTCCGTTCAGAATACTCCCAGTTCC
ACATCAACACTAACATCTGTGCCAGTTGAAGAGTCATGCGACAAAATTAG
CTTAAAGGTAGAATTGAGACCGAAAATGCAAATTCAAAAAGAGAGTCTTG
TAGTGGAAGTAAATACGTTGCTAAGTCAAACGGGAGGATTGTGTGCCTTC
ATTACAGGTTTAACATTTACATTTATTGCAGAAGTTATGGAGACCTTGAT
TTTTTGGATTTCTGACATTCTCACTAAAAGAAAAATATCTGAGTGAATTT
AAATTTAACACAACAATTTGACTGCAC
back to top

protein sequence of SMED30020573-orf-1

>SMED30020573-orf-1 ID=SMED30020573-orf-1|Name=SMED30020573-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=549bp
MKSESCQKNLSYYIRLFSQRTSIRGIPKVENSKLLSIRWFWVIFIFCAHV
LMISLCVLLIMRYFRFDTTMKISNSRVTFREFPEITICSKRFFDIGTTEL
PNPFVYLDDYSMKILARVADLIENNNIERAIQIIKNQYTTSSFFHDYFSF
IQQRTISMVDSLVSSCNISSLDGRFSKNKVLPCKIKAVYNPLYLNCLAYS
MPQSLSINKSSKFQMEITLNLAQKPKGSVTETFKMDEYVSDNADDDGFSE
NRIYITSVSDYPFDFDFDVPFSCQYFNHYVVERSQEQFYFTSSPTATCRN
NELTANSFGVSFTYSRESLCNSLMIQRYVYERCQCYMDSLPNNETLYMVS
NLCISNDTLYQCAEDVINSSQDLMTTLCLPSCTKTEYSVIYKFKPFYSSK
FSEVMDELLYQAEDCKEIPECMNNAYCILRQLFQTFSNASCIAENPVRRK
RSVADLVTESVQNTPSSTSTLTSVPVEESCDKISLKVELRPKMQIQKESL
VVEVNTLLSQTGGLCAFITGLTFTFIAEVMETLIFWISDILTKRKISE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.287.770coord: 38..67
e-value: 5.6E-21
score: 76.9
NoneNo IPR availableGENE3DG3DSA:1.10.3590.10coord: 91..247
e-value: 5.6E-21
score: 76.9
NoneNo IPR availableGENE3DG3DSA:2.60.470.10coord: 68..411
e-value: 5.6E-21
score: 76.9
NoneNo IPR availableGENE3DG3DSA:1.10.287.820coord: 290..382
e-value: 5.6E-21
score: 76.9
NoneNo IPR availableTMHMMTMhelixcoord: 39..61
NoneNo IPR availableTMHMMTMhelixcoord: 516..538
IPR001873Epithelial sodium channelPFAMPF00858ASCcoord: 17..531
e-value: 2.0E-28
score: 99.6
IPR001873Epithelial sodium channelPANTHERPTHR11690AMILORIDE-SENSITIVE SODIUM CHANNEL-RELATEDcoord: 13..538