slc35b-1

Overview
Nameslc35b-1 (AKN21641.1)
Smed IDSMED30020567
Length (bp)1101
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc35b-1 (SMED30020567) t-SNE clustered cells

Violin plots show distribution of expression levels for slc35b-1 (SMED30020567) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc35b-1 (SMED30020567) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc35b-1 (SMED30020567) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020567

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30020567SMESG000042094.1 SmedASXL_019751SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30020567SMESG000042094.1 dd_Smed_v4_8910_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30020567SMESG000042094.1 dd_Smed_v6_8910_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30020567SMESG000042094.1 OX_Smed_1.0.18089ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30020567SMESG000042094.1 dd_Smed_v4_8910_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc35b-1 vs. Ensembl Human
Match: SLC35B4 (solute carrier family 35 member B4 [Source:HGNC Symbol;Acc:HGNC:20584])

HSP 1 Score: 125.946 bits (315), Expect = 1.389e-32
Identity = 90/308 (29.22%), Postives = 159/308 (51.62%), Query Frame = 2
Query:  152 NLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDAS--FHSSSFSGN--------MIFGVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQI--ASNLTSVKINCFRFGSLFFPIWLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQSVKHT 1039
            N+  L++L ++   C  ++TF Q++ +    F+ +   G + P I ++ Y   V +FF + ++NN  L+ N+++ L  I +S +L+ N+  G   L ++Y   KY ++ LV +G+F  T   A      SS S N         + G+  L+ +L+ S  + + QE  + ++GKH  E +F+ H + L  F F+  DI     +   S L  + +     G     +W   L+N ++Q+  +   F L     SLTV L++T+R+F SL+ S+      F    W+ TLFVFIGTL+Y++V+ ++  T
Sbjct:   17 NVIFLELLARKHPGCGNIVTFAQFLFIAVEGFLFEADLGRKPPAIPIRYYAIMVTMFFTVSVVNNYALNLNIAMPLHMIFRSGSLIANMILGIIILKKRYSIFKYTSIALVSVGIFICTFMSAKQVTSQSSLSENDGFQAFVWWLLGIGALTFALLMSARMGIFQETLYKRFGKHSKEALFYNHALPLPGFVFLASDIYDHAVLFNKSELYEIPV----IGVTLPIMWFYLLMNIITQYVCIRGVFILTTECASLTVTLVVTLRKFVSLIFSILYFQNPFTLWHWLGTLFVFIGTLMYTEVWNNLGTT 320          
BLAST of slc35b-1 vs. Ensembl Human
Match: SLC35B4 (solute carrier family 35 member B4 [Source:HGNC Symbol;Acc:HGNC:20584])

HSP 1 Score: 85.1149 bits (209), Expect = 1.515e-18
Identity = 57/198 (28.79%), Postives = 103/198 (52.02%), Query Frame = 2
Query:  152 NLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDAS--FHSSSFSGNMIF--------GVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDI 715
            N+  L++L ++   C  ++TF Q++ +    F+ +   G + P I ++ Y   V +FF + ++NN  L+ N+++ L  I +S +L+ N+  G   L ++Y   KY ++ LV +G+F  T   A      SS S N  F        G+  L+ +L+ S  + + QE  + ++GKH  E +F+ H + L  F F+  DI
Sbjct:   17 NVIFLELLARKHPGCGNIVTFAQFLFIAVEGFLFEADLGRKPPAIPIRYYAIMVTMFFTVSVVNNYALNLNIAMPLHMIFRSGSLIANMILGIIILKKRYSIFKYTSIALVSVGIFICTFMSAKQVTSQSSLSENDGFQAFVWWLLGIGALTFALLMSARMGIFQETLYKRFGKHSKEALFYNHALPLPGFVFLASDI 214          
BLAST of slc35b-1 vs. Ensembl Celegans
Match: nstp-2 (Nucleotide Sugar TransPorter family [Source:UniProtKB/TrEMBL;Acc:O44166])

HSP 1 Score: 115.161 bits (287), Expect = 3.673e-29
Identity = 91/303 (30.03%), Postives = 155/303 (51.16%), Query Frame = 2
Query:  179 KQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDASFHSSSFS--------GNMIFGVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFRFGSLF--FP-IWLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQSVKHTAIKID 1054
            KQ      L+TF  ++ +  +  +   K    K QI LK YFK V +FFI+ ++NN+ L+++V + L  I +S +LL  +      + + Y   KY++V  + +G+   TL  ++   S  S             G+I+L+ +L+ S +L + Q++ + KYGKH  E +F THLI L  F  +  DI           + K++     S+F   P +W+  + + L Q+G +   ++L     SLTV L++T+R+F SL++S+      F    W+  + VF GTL ++D++ S   TA K D
Sbjct:   27 KQEPSAMNLMTFSTFLFISTVGLVSTSKFFTVKNQIPLKGYFKTVTMFFIVNVVNNQALNFHVPVPLHIIFRSGSLLATLILSVVMVGKSYSARKYISVFAITIGIVICTLATSTQGDSGLSMEEASKHYKEWTIGIIMLTFALLASAVLAIYQQQMYEKYGKHPDEAMFITHLISLPFFLIMGSDIVS--------AATKLSASAPHSVFPWLPSLWVDLIASCLLQYGCIKYVYQLNSRVDSLTVTLVVTLRKFLSLIVSIVYFKNPFTPQHWLGAILVFAGTLAFADIWGS--QTANKQD 319          
BLAST of slc35b-1 vs. Ensembl Celegans
Match: nstp-2 (Nucleotide Sugar TransPorter family [Source:UniProtKB/TrEMBL;Acc:O44166])

HSP 1 Score: 114.39 bits (285), Expect = 4.397e-29
Identity = 85/271 (31.37%), Postives = 143/271 (52.77%), Query Frame = 2
Query:  275 KPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDASFHSSSFS--------GNMIFGVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFRFGSLF--FP-IWLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQSVKHTAIKID 1054
            K QI LK YFK V +FFI+ ++NN+ L+++V + L  I +S +LL  +      + + Y   KY++V  + +G+   TL  ++   S  S             G+I+L+ +L+ S +L + Q++ + KYGKH  E +F THLI L  F  +  DI           + K++     S+F   P +W+  + + L Q+G +   ++L     SLTV L++T+R+F SL++S+      F    W+  + VF GTL ++D++ S   TA K D
Sbjct:   27 KNQIPLKGYFKTVTMFFIVNVVNNQALNFHVPVPLHIIFRSGSLLATLILSVVMVGKSYSARKYISVFAITIGIVICTLATSTQGDSGLSMEEASKHYKEWTIGIIMLTFALLASAVLAIYQQQMYEKYGKHPDEAMFITHLISLPFFLIMGSDIVS--------AATKLSASAPHSVFPWLPSLWVDLIASCLLQYGCIKYVYQLNSRVDSLTVTLVVTLRKFLSLIVSIVYFKNPFTPQHWLGAILVFAGTLAFADIWGS--QTANKQD 287          
BLAST of slc35b-1 vs. Ensembl Celegans
Match: nstp-1 (Nucleotide Sugar TransPorter family [Source:UniProtKB/TrEMBL;Acc:Q18800])

HSP 1 Score: 83.1889 bits (204), Expect = 9.499e-18
Identity = 81/262 (30.92%), Postives = 123/262 (46.95%), Query Frame = 2
Query:  281 QISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDASFHS------SSFSGN--------MIFGVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFRFGSLFFPIWLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQ 1024
            +I +K Y K V +FF + + NN  L + +   L  I KS  LL N+  G    N +Y   +  AV++V  G+   TL  AS+        S    N         + G+ LLS +LI S  L L QE  + K+GKH  E +F+ H + +  FAF+  D+   +  A +  S  I      ++    W+      L QF      + L     SL V +++T+R+FFSL++S  V    F+    I   FVFIGT+++S  F 
Sbjct:   59 RIPIKSYAKIVAIFFTVNMTNNLALKFAIYFPLFIIFKSGTLLTNMTMGWIIRNYQYSLKQISAVVVVTAGIVIFTL--ASYEPGAQNIRSGIDSNSWLIPIPPFVVGLALLSFALILSAYLGLYQETFYQKHGKHNEEMMFYVHFLSIPLFAFVGDDMVPAFHAAYSTPSFVIA--GLDTVVPSAWVYIFAICLFQFACTKGVYMLSAVTTSLNVTMVLTLRKFFSLLISFIVFENVFNMFHIIGAAFVFIGTILFSVSFA 316          
BLAST of slc35b-1 vs. Ensembl Celegans
Match: nstp-1 (Nucleotide Sugar TransPorter family [Source:UniProtKB/TrEMBL;Acc:Q18800])

HSP 1 Score: 58.9214 bits (141), Expect = 6.370e-10
Identity = 41/133 (30.83%), Postives = 66/133 (49.62%), Query Frame = 2
Query:  614 QEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFRFGSLFFPIWLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYS 1012
            QE  + K+GKH  E +F+ H + +  FAF+  D+   +  A +  S  I      ++    W+      L QF      + L     SL V +++T+R+FFSL++S  V    F+    I   FVFIGT+++S
Sbjct:   79 QETFYQKHGKHNEEMMFYVHFLSIPLFAFVGDDMVPAFHAAYSTPSFVIAGLD--TVVPSAWVYIFAICLFQFACTKGVYMLSAVTTSLNVTMVLTLRKFFSLLISFIVFENVFNMFHIIGAAFVFIGTILFS 209          
BLAST of slc35b-1 vs. Ensembl Fly
Match: Efr (gene:FBgn0029849 transcript:FBtr0070875)

HSP 1 Score: 111.309 bits (277), Expect = 2.325e-27
Identity = 92/313 (29.39%), Postives = 165/313 (52.72%), Query Frame = 2
Query:  152 NLFTLDILIKQCSQCTYLLTFIQY--ISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLT------DASFHS----SSFSGNMIF--GVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFRFGSLF--FPIWLLFLI-NGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQSVKHT 1039
            N+  L+++I+       L+TF Q+  I++ G+ F  ++     +P+I+LK Y   V LFF   + NN   ++N+ + L  I +S +L+ N+  G   L ++Y   +Y +V ++  G+   TL       D + HS    +S+S    +  G+ LL+I+L+ +  + + QE  + KYGKH  E +FFTH++ L  F  +  +I Q + IA +   V +       L   FP+ L +L+ N ++Q+  +   + L     SLTV L++T+R+F SL+ S+      F    W+ T+ VF GT+++++V   V+  
Sbjct:   21 NVVFLELIIQIDPGAGNLITFAQFLFIALEGLVFTSKFFT--VRPKIALKDYVILVALFFGANVCNNYAFNFNIPMPLHMIFRSGSLMANMIMGIVLLKKRYNLRQYSSVAMITAGIILCTLVSSGDVKDNTHHSLKVDTSYSDFFWWTVGIGLLTIALLVTAYMGIYQEVIYKKYGKHPSEALFFTHMLPLPGFLIMAGNIVQHFGIAWSSEPVAVPLLGAIGLEWKFPLMLFYLLCNVVTQYVCISAVYVLTTECASLTVTLVVTLRKFVSLLFSIIYFRNPFTLNHWVGTILVFFGTILFANVINQVRDA 331          
BLAST of slc35b-1 vs. Ensembl Fly
Match: Efr (gene:FBgn0029849 transcript:FBtr0070874)

HSP 1 Score: 111.309 bits (277), Expect = 2.325e-27
Identity = 92/313 (29.39%), Postives = 165/313 (52.72%), Query Frame = 2
Query:  152 NLFTLDILIKQCSQCTYLLTFIQY--ISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLT------DASFHS----SSFSGNMIF--GVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFRFGSLF--FPIWLLFLI-NGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQSVKHT 1039
            N+  L+++I+       L+TF Q+  I++ G+ F  ++     +P+I+LK Y   V LFF   + NN   ++N+ + L  I +S +L+ N+  G   L ++Y   +Y +V ++  G+   TL       D + HS    +S+S    +  G+ LL+I+L+ +  + + QE  + KYGKH  E +FFTH++ L  F  +  +I Q + IA +   V +       L   FP+ L +L+ N ++Q+  +   + L     SLTV L++T+R+F SL+ S+      F    W+ T+ VF GT+++++V   V+  
Sbjct:   21 NVVFLELIIQIDPGAGNLITFAQFLFIALEGLVFTSKFFT--VRPKIALKDYVILVALFFGANVCNNYAFNFNIPMPLHMIFRSGSLMANMIMGIVLLKKRYNLRQYSSVAMITAGIILCTLVSSGDVKDNTHHSLKVDTSYSDFFWWTVGIGLLTIALLVTAYMGIYQEVIYKKYGKHPSEALFFTHMLPLPGFLIMAGNIVQHFGIAWSSEPVAVPLLGAIGLEWKFPLMLFYLLCNVVTQYVCISAVYVLTTECASLTVTLVVTLRKFVSLLFSIIYFRNPFTLNHWVGTILVFFGTILFANVINQVRDA 331          
BLAST of slc35b-1 vs. Ensembl Fly
Match: CG14511 (gene:FBgn0039641 transcript:FBtr0085412)

HSP 1 Score: 99.3673 bits (246), Expect = 2.478e-23
Identity = 87/305 (28.52%), Postives = 151/305 (49.51%), Query Frame = 2
Query:  164 LDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDASFHSSSFSGNM--------------IFGVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFRFGSLFFPIWLLFLI-NGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQSVK 1033
            L++L+K       L+T  Q+  +    FI   K G  +  ISL+ Y   V +FF+  + NN    + V + L  II+  +L+ N+      L R Y  ++Y++V+++ +G+F  T     F S    G M              + GV LL ++L  S+ + + QE  + ++GK   E +++THL+ L  F  +H DI   + +A    S ++       +  P+ LL+L+ N L+Q   +   + L     SLTV L++T+R+F SL+ S+      F    W+ T  VF+GTL++++V +  K
Sbjct:   25 LELLVKLDPGAGNLITGAQFAFIALEGFIFTSKFGLAQRVISLRDYALLVAMFFLTSVCNNYVFKFKVPMTLHMIIRGGSLISNMCLCTLILKRSYRLSQYISVLMISVGIFVCTY----FSSPDLVGKMENLDSGAEADTFWWLLGVALLVLALFVSSYMGITQELLYRRHGKCAREALYYTHLLPLPAFLLMHDDIRTHWLLAFTGESYQLPLL---GVAVPLILLYLLGNVLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIVYFRNPFTWWHWLGTALVFVGTLMFANVIRVPK 322          
BLAST of slc35b-1 vs. Ensembl Zebrafish
Match: slc35b4 (solute carrier family 35 member B4 [Source:NCBI gene;Acc:323737])

HSP 1 Score: 133.65 bits (335), Expect = 1.047e-35
Identity = 88/305 (28.85%), Postives = 162/305 (53.11%), Query Frame = 2
Query:  152 NLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDASFHSSSFSG----------NMIFGVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFRFGSLFFPI-WLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQSVK 1033
            N+  L++L++    C  ++TF Q+  +    FI +   G +KPQI L  Y   V +FF + ++NN  L++N+++ L  I +S +L+ N+  G   L ++Y  +KY++++LV +G+F  T+  A   +    G          + + G+ +L+ +L+ S  + + QE  + KYGKH  E +F+ H + L  F  +  +I     + S  + +++       L  P+ W   L+N ++Q+  +   F L     SLTV L++T+R+F SL++S+      F    W+ T  VF+GTL+Y++V  S+ 
Sbjct:   17 NVVFLELLVRDFPGCGNIVTFAQFAFIALEGFIFETNFGRKKPQIPLSNYVIMVTMFFTVSVINNYALNFNIAMPLHMIFRSGSLIANMILGIIILKKRYSMSKYLSIVLVSVGIFICTIMSAKQVNVEKGGTEEDGVYAFMHWLLGIAMLTFALLMSARMGIFQETLYKKYGKHSKEALFYNHCLPLPGFLLLSTNIYNHAVLFSQSSPMEVPVI---GLSMPVMWFYLLMNVITQYVCIRGVFILTTECASLTVTLVVTLRKFLSLIISILYFQNPFTAWHWVGTAVVFLGTLLYTEVLSSIP 318          
BLAST of slc35b-1 vs. Ensembl Xenopus
Match: SLC35B4 (solute carrier family 35 (UDP-xylose/UDP-N-acetylglucosamine transporter), member B4 [Source:NCBI gene;Acc:100488491])

HSP 1 Score: 131.724 bits (330), Expect = 6.894e-35
Identity = 95/308 (30.84%), Postives = 161/308 (52.27%), Query Frame = 2
Query:  152 NLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDAS--------FHSSSFSGNMIFGVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFRFGSLFFPI-WLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQSVKHTAIK 1048
            N+  L++L +    C  ++TF Q++ +    FI Q   G +K  I ++ Y   V +FF + ++NN  L+ N+S+ L  I +S +L+ N+  G   L ++Y  +KY+++ LV +G+F  TL  A           +SSFS     G+  L+ +L+ S  + + QE  + ++GKH  E +F+ H + L  F  +  DI     + S     ++       L  PI W   L+N ++Q+  +   F L     SLTV L++T+R+F SL+ S+      F    WI TLFVF+GTL+Y++V+ ++   A K
Sbjct:   17 NVVFLELLARAFPGCGNIVTFSQFLFIAVEGFIFQANFGRKKSAIPVRYYLIMVAMFFTVSVVNNYALNLNISMPLHMIFRSGSLIANMVLGIIILKKRYSVSKYLSIALVSVGIFICTLMSAKQVLTKCSLIKTSSFS----LGIAALTFALLVSARMGIFQETLYKEFGKHSKEALFYNHALPLPGFLLLAPDIYNHAVMFSQSEPFQLPVL---GLQMPIMWFYLLMNVITQYVCIRGVFILTTECPSLTVTLVVTLRKFLSLIFSILYFHNPFTTWHWIGTLFVFMGTLLYTEVWNTIGSVAGK 317          
BLAST of slc35b-1 vs. Ensembl Xenopus
Match: SLC35B4 (solute carrier family 35 (UDP-xylose/UDP-N-acetylglucosamine transporter), member B4 [Source:NCBI gene;Acc:100488491])

HSP 1 Score: 130.183 bits (326), Expect = 2.813e-34
Identity = 93/310 (30.00%), Postives = 162/310 (52.26%), Query Frame = 2
Query:  152 NLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTD----ASFHSSSFSGN------MIFGVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFRFGSLFFPI-WLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQSVKHTAIK 1048
            N+  L++L +    C  ++TF Q++ +    FI Q   G +K  I ++ Y   V +FF + ++NN  L+ N+S+ L  I +S +L+ N+  G   L ++Y  +KY+++ LV +G+F  TL      AS+ +S+           + G+  L+ +L+ S  + + QE  + ++GKH  E +F+ H + L  F  +  DI     + S     ++       L  PI W   L+N ++Q+  +   F L     SLTV L++T+R+F SL+ S+      F    WI TLFVF+GTL+Y++V+ ++   A K
Sbjct:   17 NVVFLELLARAFPGCGNIVTFSQFLFIAVEGFIFQANFGRKKSAIPVRYYLIMVAMFFTVSVVNNYALNLNISMPLHMIFRSGSLIANMVLGIIILKKRYSVSKYLSIALVSVGIFICTLMSAKQVASYQTSNVDDGFSAFLWWLLGIAALTFALLVSARMGIFQETLYKEFGKHSKEALFYNHALPLPGFLLLAPDIYNHAVMFSQSEPFQLPVL---GLQMPIMWFYLLMNVITQYVCIRGVFILTTECPSLTVTLVVTLRKFLSLIFSILYFHNPFTTWHWIGTLFVFMGTLLYTEVWNTIGSVAGK 323          
BLAST of slc35b-1 vs. Ensembl Xenopus
Match: SLC35B4 (solute carrier family 35 (UDP-xylose/UDP-N-acetylglucosamine transporter), member B4 [Source:NCBI gene;Acc:100488491])

HSP 1 Score: 114.775 bits (286), Expect = 1.107e-28
Identity = 90/310 (29.03%), Postives = 155/310 (50.00%), Query Frame = 2
Query:  152 NLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDA----SFHSSSFSGN------MIFGVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFRFGSLFFPI-WLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQSVKHTAIK 1048
            N+  L++L +    C  ++TF Q++ +    FI Q   G +K  I ++ Y   V +FF + ++NN  L+ N+S+ L  I +S +              KY  +KY+++ LV +G+F  TL  A    S+ +S+           + G+  L+ +L+ S  + + QE  + ++GKH  E +F+ H + L  F  +  DI     + S     ++       L  PI W   L+N ++Q+  +   F L     SLTV L++T+R+F SL+ S+      F    WI TLFVF+GTL+Y++V+ ++   A K
Sbjct:   17 NVVFLELLARAFPGCGNIVTFSQFLFIAVEGFIFQANFGRKKSAIPVRYYLIMVAMFFTVSVVNNYALNLNISMPLHMIFRSVS--------------KYSVSKYLSIALVSVGIFICTLMSAKQVASYQTSNVDDGFSAFLWWLLGIAALTFALLVSARMGIFQETLYKEFGKHSKEALFYNHALPLPGFLLLAPDIYNHAVMFSQSEPFQLPVL---GLQMPIMWFYLLMNVITQYVCIRGVFILTTECPSLTVTLVVTLRKFLSLIFSILYFHNPFTTWHWIGTLFVFMGTLLYTEVWNTIGSVAGK 309          
BLAST of slc35b-1 vs. Ensembl Mouse
Match: Slc35b4 (solute carrier family 35, member B4 [Source:MGI Symbol;Acc:MGI:1931249])

HSP 1 Score: 117.472 bits (293), Expect = 1.087e-29
Identity = 89/308 (28.90%), Postives = 156/308 (50.65%), Query Frame = 2
Query:  152 NLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDASFHS-----SSFSGNMIF-----GVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQI--ASNLTSVKINCFRFGSLFFPIWLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQSVKHT 1039
            N+  L++L +    C  ++TF Q++ +    F+ +   G + P I ++ Y   V +FF + ++NN  L+ N+++ L  I +S +L+ N+  G   L ++Y   KY ++ LV  G+F  T   A   +     S   G   F     G+  L+ +L+ S  + + QE  + ++GKH  E +F+ H + L  F F+  DI     +   S L  V +     G     +W   L+N ++Q+  +   F L     SLTV L++T+R+F SL+ S+      F    W+ T FVFIGTL+Y++V++++  T
Sbjct:   17 NVIFLELLARTHPGCGNIVTFAQFLFIAVEGFLFEANLGRKPPAIPIRYYAIMVTMFFTVSVVNNYALNLNIAMPLHMIFRSGSLIANMILGIIILKKRYSMFKYTSIALVSAGIFICTFMSAKQVTVQTGLSDKDGFQAFAWWLLGIAALTFALLMSARMGIFQETLYRQFGKHSKEALFYNHALPLPGFIFLASDIYDHVVLFNKSELYQVPV----IGVTMPVMWFYLLMNVVTQYVCIRGVFILTTECTSLTVTLVVTLRKFVSLIFSILYFQNQFTMWHWLGTSFVFIGTLMYTEVWKNLGTT 320          
BLAST of slc35b-1 vs. UniProt/SwissProt
Match: sp|Q7ZW46|S35B4_DANRE (UDP-xylose and UDP-N-acetylglucosamine transporter OS=Danio rerio OX=7955 GN=slc35b4 PE=2 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 2.417e-34
Identity = 90/314 (28.66%), Postives = 162/314 (51.59%), Query Frame = 2
Query:  152 NLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDASFHSSSFSG----------NMIFGVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFRFGSLFFPI-WLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQSVKHT--AIKID 1054
            N+  L++L++    C  ++TF Q+  +    FI +   G +KPQI L  Y   V +FF + ++NN  L +N+++ L  I +S +L+ N+  G   L  +Y  +KY++++LV +G+F  T+  A   +    G          + + G+ +L+ +L+ S  + + QE  + KYGKH  E +F+ H + L  F  +  +I     + S    +++       L  P+ W   L+N ++Q+  +   F L     SLTV L++T+R+F SL++S+      F    W+ T  VF+GTL+Y++V  S+       K+D
Sbjct:   17 NVVFLELLVRDFPGCGNIVTFAQFAFIALEGFIFETNFGRKKPQIPLSNYVIMVTMFFTVSVINNYALDFNIAMPLHMIFRSGSLIANMILGIIILKNRYSMSKYLSIVLVSVGIFICTIMSAKQVNVEKGGTEEDGVYAFMHWLLGIAMLTFALLMSARMGIFQETLYKKYGKHSKEALFYNHCLPLPGFLLLSTNIYNHAVLFSQSPPMEVPVI---GLSMPVMWFYLLMNVITQYVCIRGVFILTTECASLTVTLVVTLRKFLSLIISILYFQNPFTAWHWVGTAVVFLGTLLYTEVLSSIPAAFKGYKVD 327          
BLAST of slc35b-1 vs. UniProt/SwissProt
Match: sp|Q969S0|S35B4_HUMAN (UDP-xylose and UDP-N-acetylglucosamine transporter OS=Homo sapiens OX=9606 GN=SLC35B4 PE=1 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 6.671e-32
Identity = 90/308 (29.22%), Postives = 159/308 (51.62%), Query Frame = 2
Query:  152 NLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDAS--FHSSSFSGN--------MIFGVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQI--ASNLTSVKINCFRFGSLFFPIWLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQSVKHT 1039
            N+  L++L ++   C  ++TF Q++ +    F+ +   G + P I ++ Y   V +FF + ++NN  L+ N+++ L  I +S +L+ N+  G   L ++Y   KY ++ LV +G+F  T   A      SS S N         + G+  L+ +L+ S  + + QE  + ++GKH  E +F+ H + L  F F+  DI     +   S L  + +     G     +W   L+N ++Q+  +   F L     SLTV L++T+R+F SL+ S+      F    W+ TLFVFIGTL+Y++V+ ++  T
Sbjct:   17 NVIFLELLARKHPGCGNIVTFAQFLFIAVEGFLFEADLGRKPPAIPIRYYAIMVTMFFTVSVVNNYALNLNIAMPLHMIFRSGSLIANMILGIIILKKRYSIFKYTSIALVSVGIFICTFMSAKQVTSQSSLSENDGFQAFVWWLLGIGALTFALLMSARMGIFQETLYKRFGKHSKEALFYNHALPLPGFVFLASDIYDHAVLFNKSELYEIPV----IGVTLPIMWFYLLMNIITQYVCIRGVFILTTECASLTVTLVVTLRKFVSLIFSILYFQNPFTLWHWLGTLFVFIGTLMYTEVWNNLGTT 320          
BLAST of slc35b-1 vs. UniProt/SwissProt
Match: sp|Q5R8M3|S35B4_PONAB (UDP-xylose and UDP-N-acetylglucosamine transporter OS=Pongo abelii OX=9601 GN=SLC35B4 PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 6.810e-32
Identity = 91/308 (29.55%), Postives = 159/308 (51.62%), Query Frame = 2
Query:  152 NLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDAS--FHSSSFSGN--------MIFGVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQI--ASNLTSVKINCFRFGSLFFPIWLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQSVKHT 1039
            N+  L++L ++   C  ++TF Q++ +    F+ +   G + P I ++ Y   V +FF + ++NN  L+ N+++ L  I +S +L+ N+  G   L ++Y   KY ++ LV +G+F  T   A      SS S N         + G+  L+ +L+ S  + L QE  + ++GKH  E +F+ H + L  F F+  DI     +   S L  + +     G     +W   L+N ++Q+  +   F L     SLTV L++T+R+F SL+ S+      F    W+ TLFVFIGTL+Y++V+ ++  T
Sbjct:   17 NVIFLELLARKHPGCGNIVTFAQFLFIAVEGFLFEADLGRKPPAIPIRYYAIMVTMFFTVSVVNNYALNLNIAMPLHMIFRSGSLIANMILGIIILKKRYSIFKYTSIALVSVGIFICTFMSAKQVTSQSSLSENDGFQAFVWWLLGIGALTFALLMSARMGLFQETLYKRFGKHSKEALFYNHALPLPGFVFLASDIYDHAVLFNKSELYEIPV----IGVTLPIMWFYLLMNIITQYVCIRGVFILTTECASLTVTLVVTLRKFVSLIFSILYFQNPFTLWHWLGTLFVFIGTLMYTEVWNNLGTT 320          
BLAST of slc35b-1 vs. UniProt/SwissProt
Match: sp|Q95KB4|S35B4_MACFA (UDP-xylose and UDP-N-acetylglucosamine transporter OS=Macaca fascicularis OX=9541 GN=SLC35B4 PE=2 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.502e-31
Identity = 91/315 (28.89%), Postives = 161/315 (51.11%), Query Frame = 2
Query:  152 NLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDAS--FHSSSFSGN--------MIFGVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDI---------SQEYQIASNLTSVKINCFRFGSLFFPIWLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQSVKHT 1039
            N+  L++L ++   C  ++TF Q++ +    F+ +   G + P I ++ Y   V +FF + ++NN  L+ N+++ L  I +S +L+ N+  G   L ++Y   KY ++ LV +G+F  T   A      SS S N         + G+  L+ +L+ S  + + QE  + ++GKH  E +F+ H + L  F F+  DI         S+ Y+I     ++ I           +W   L+N ++Q+  +   F L     SLTV L++T+R+F SL+ S+      F    W+ TLFVFIGTL+Y++V+ ++  T
Sbjct:   17 NVIFLELLARKHPGCGNIVTFAQFLFIAVEGFLFEADLGRKPPAIPIRYYAIMVTMFFTVSVVNNYALNLNIAMPLHMIFRSGSLIANMILGIIILKKRYSIFKYTSIALVSVGIFICTFMSAKQVTSQSSLSENDGFQAFVWWLLGIGALTFALLMSARMGIFQETLYKQFGKHSKEALFYNHALPLPGFIFLASDIYDHAVLFNKSELYEIPGIGVTLPI-----------MWFYLLMNIITQYVCIRGVFILTTECASLTVTLVVTLRKFVSLIFSILYFQNPFTLWHWLGTLFVFIGTLMYTEVWNNLGTT 320          
BLAST of slc35b-1 vs. UniProt/SwissProt
Match: sp|Q8CIA5|S35B4_MOUSE (UDP-xylose and UDP-N-acetylglucosamine transporter OS=Mus musculus OX=10090 GN=Slc35b4 PE=2 SV=2)

HSP 1 Score: 117.472 bits (293), Expect = 7.606e-29
Identity = 89/308 (28.90%), Postives = 156/308 (50.65%), Query Frame = 2
Query:  152 NLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDASFHS-----SSFSGNMIF-----GVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQI--ASNLTSVKINCFRFGSLFFPIWLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQSVKHT 1039
            N+  L++L +    C  ++TF Q++ +    F+ +   G + P I ++ Y   V +FF + ++NN  L+ N+++ L  I +S +L+ N+  G   L ++Y   KY ++ LV  G+F  T   A   +     S   G   F     G+  L+ +L+ S  + + QE  + ++GKH  E +F+ H + L  F F+  DI     +   S L  V +     G     +W   L+N ++Q+  +   F L     SLTV L++T+R+F SL+ S+      F    W+ T FVFIGTL+Y++V++++  T
Sbjct:   17 NVIFLELLARTHPGCGNIVTFAQFLFIAVEGFLFEANLGRKPPAIPIRYYAIMVTMFFTVSVVNNYALNLNIAMPLHMIFRSGSLIANMILGIIILKKRYSMFKYTSIALVSAGIFICTFMSAKQVTVQTGLSDKDGFQAFAWWLLGIAALTFALLMSARMGIFQETLYRQFGKHSKEALFYNHALPLPGFIFLASDIYDHVVLFNKSELYQVPV----IGVTMPVMWFYLLMNVVTQYVCIRGVFILTTECTSLTVTLVVTLRKFVSLIFSILYFQNQFTMWHWLGTSFVFIGTLMYTEVWKNLGTT 320          
BLAST of slc35b-1 vs. TrEMBL
Match: A0A0H3YJC5 (Slc35b-1 OS=Schmidtea mediterranea OX=79327 GN=slc35b-1 PE=2 SV=1)

HSP 1 Score: 587.415 bits (1513), Expect = 0.000e+0
Identity = 314/314 (100.00%), Postives = 314/314 (100.00%), Query Frame = 2
Query:  113 MNILICSTVVSFINLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDASFHSSSFSGNMIFGVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFRFGSLFFPIWLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQSVKHTAIKID 1054
            MNILICSTVVSFINLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDASFHSSSFSGNMIFGVILLSISLIFSTILPLLQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFRFGSLFFPIWLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQSVKHTAIKID
Sbjct:    1 MNILICSTVVSFINLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDASFHSSSFSGNMIFGVILLSISLIFSTILPLLQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFRFGSLFFPIWLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQSVKHTAIKID 314          
BLAST of slc35b-1 vs. TrEMBL
Match: A0A553R1G0 (Uncharacterized protein OS=Danionella translucida OX=623744 GN=DNTS_002167 PE=4 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 3.846e-37
Identity = 97/310 (31.29%), Postives = 170/310 (54.84%), Query Frame = 2
Query:  152 NLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDASFHSSSFSG----------NMIFGVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFRFGSLFFPI-WLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQSVKHTAIK 1048
            N+  L++L++    C  ++TF Q+  +    FI +   G +KPQI L  Y   V +FF + ++NN  L++N+++ L  I +S +L+ N+  G   L ++Y  +KY++++LV +G+F  T+  A   S+   G          + + G+ +L+ +L+ S  + + QE  + KYGKH  E +F+ H + L  F  +  DI +   + S  + ++I       L+ PI W   L+N ++Q+  +   F L     SLTV L++T+R+F SL++S+      F    W+ T  VF+GTL+Y++V  SV +TAIK
Sbjct:   17 NVVFLELLVRDFPGCGNIVTFAQFAFIALEGFIFETHFGRKKPQIPLSNYVIMVTMFFTVSVINNYALNFNIAMPLHMIFRSGSLIANMILGIIILKKRYSVSKYLSIVLVSVGIFICTIMSAKQVSAEKGGTEEDGVYAFMHWLLGIAMLTFALLMSARMGIFQETLYKKYGKHSKEALFYNHCLPLPGFLLLSTDIYRHAMLFSESSPMEIPA---TGLYMPIMWFYLLMNVITQYVCIRGVFILTTECASLTVTLVVTLRKFISLIISILYFRNPFTAWHWLGTAVVFLGTLLYTEVLSSV-YTAIK 322          
BLAST of slc35b-1 vs. TrEMBL
Match: A0A0V0RZX4 (UDP-xylose and UDP-N-acetylglucosamine transporter (Fragment) OS=Trichinella nelsoni OX=6336 GN=slc35b4 PE=4 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 2.701e-36
Identity = 101/318 (31.76%), Postives = 178/318 (55.97%), Query Frame = 2
Query:  155 LFTLDILIKQCSQCTYLLTFIQY--ISVIGM----QFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVF--TTTLTDASFHSSS----------FSGNMIFGVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFRFGSLFFPIWLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQSVKHTAIKID 1054
            +  ++ L ++  +C  L+TF  +  ++V G+    QFIIQ      KPQI LK Y K VILFF++ ++NN+ LSYN+ + L  I +S +L+ N+  G + LN++Y   KY++V+++  G+   T+   +AS  SS           ++ +++ GV +L+ +L+FS+ L + QE+ + +YGKH  E +FF H++ L  F   + DI +   + +   S  I+    G     +WLL ++  ++Q+  +   + L  +  +LTV L++TIR+F SL+ S+ + G  F    WI T  VF GTL++ + F+      +K +
Sbjct:   24 MVVVEKLARRDPECMNLMTFSTFLFVTVEGLVSNPQFIIQ------KPQIPLKAYVKIVILFFLVNVINNQALSYNIPVPLHIIFRSGSLMTNLLLGVWILNKRYSWVKYISVLMITAGIMICTSATYNASMMSSPKSLQENETIKYNKHLLIGVCMLTFALVFSSALGIAQEKLYCQYGKHPREAMFFVHMLSLPGFLLFYKDIMKHTNVFNR--SELIHLPWIGLDIPHLWLLLILVDIAQYICIRFVYYLTASCSTLTVTLVITIRKFISLISSILLFGSPFTVQHWIGTALVFGGTLLFIEPFKRSNSDKVKTN 333          
BLAST of slc35b-1 vs. TrEMBL
Match: A0A0P5SV78 (UDP-xylose and UDP-N-acetylglucosamine transporter OS=Daphnia magna OX=35525 GN=APZ42_032526 PE=4 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 3.749e-36
Identity = 100/302 (33.11%), Postives = 167/302 (55.30%), Query Frame = 2
Query:  152 NLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDASFHSSSFSGNM----------IFGVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIA---SNLTSVKINCFRFGSLFFPIWLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDV 1018
            N+F L++LIK+ S    L+TF Q++ +    FI   + G +K ++   +Y K V++FFI+ + NN  LS+N+++ L  I ++ +LL N+  G   L ++Y   KY++VI++ +G+   T+  A   + S S N           I G++LL+ +L  S  + ++QE  + K+GKH  E +FFTH + L  F  +  DIS+  QIA   + L S  I+   F +    IW+  L N  +Q   ++  F L     SL V L++T+R+F SL+ S++     F  + W  T+ VF GTL++SD+
Sbjct:   17 NVFFLELLIKEDSGSGNLITFAQFVVIAVEGFITTMRFGTKKTEVPFTEYLKMVLMFFIVSVTNNYALSFNIALPLHMIFRAGSLLANMILGILILKKRYTTMKYLSVIMISIGISICTIASAKELNHSESENQISSVGDFVWWIVGILLLTFALFMSARMGIMQEVMYSKFGKHPREALFFTHALPLPGFLLLFGDISKHIQIANMSAPLDSTVISVIPFLNTLPRIWIYLLGNVFTQSICINAVFVLTTECSSLAVTLVVTLRKFVSLLFSIWYFQNPFTALHWFGTILVFGGTLVFSDI 318          
BLAST of slc35b-1 vs. TrEMBL
Match: A0A0V1B254 (UDP-xylose and UDP-N-acetylglucosamine transporter (Fragment) OS=Trichinella spiralis OX=6334 GN=slc35b4 PE=4 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 5.847e-36
Identity = 96/312 (30.77%), Postives = 173/312 (55.45%), Query Frame = 2
Query:  155 LFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVF--TTTLTDASFHSSS----------FSGNMIFGVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFRFGSLFFPIWLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQSVKHTAIKID 1054
            +  ++ L ++  +C  L+TF  ++ V     +   +   QKPQI LK Y K VILFF++ ++NN+ LSYN+ + L  I +S +L+ N+  G + LN++Y   KY++V+++  G+   T+   +AS  SS           ++ +++ GV +L+ +L+FS+ L + QE+ + +YGKH  E +FF H++ L  F   + DI +   + +   S  I+    G     +WLL ++  ++Q+  +   + L  +  +LTV L++TIR+F SL+ S+ + G  F    WI T  VF GTL++ + F+      +K +
Sbjct:   24 MVVVEKLARRDPECMNLMTFSTFLFVTMEGLVSNPQFIIQKPQIPLKAYVKIVILFFLVNVINNQALSYNIPVPLHIIFRSGSLMTNLLLGVWILNKRYSWVKYISVLMITAGIMICTSATYNASMMSSPKSLQENETIKYNKHLLIGVCMLTFALVFSSALGIAQEKLYCQYGKHPREAMFFVHMLSLPGFLLFYKDIMKHINVFNR--SELIHLPWIGLDIPHLWLLLILVDIAQYICIRFVYYLTASCSTLTVTLVITIRKFISLISSILLFGSPFTVQHWIGTALVFGGTLLFIEPFKRSNSDKVKTN 333          
BLAST of slc35b-1 vs. Ensembl Cavefish
Match: slc35b4 (solute carrier family 35 member B4 [Source:NCBI gene;Acc:323737])

HSP 1 Score: 124.405 bits (311), Expect = 1.943e-32
Identity = 88/313 (28.12%), Postives = 166/313 (53.04%), Query Frame = 2
Query:  152 NLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDA---SFHSSSFSGNMIF-------GVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFRFGSLFFPIWLLFLINGLSQFGL--LHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQSVKHTAIKID 1054
            N+  L++L+++   C  ++TF Q+  +    F+ Q   G +KP I +  Y   V +FF + ++NN  L++N+++ L  I +S +L+ N+  G   L ++Y  +KY++++LV +G+F  T+  A   S    S   + ++       G+ +L+ +L+ S  + + QE  + +YGKH  E +F+ H + L  F  +  +I       S  T V+I     G     +W+  L+N ++Q G+  +HL+              ++T+R+F SL++S+      F    W+ T  VF+GTL+Y++V+ S++ TA+K D
Sbjct:   17 NVVFLELLVRKFPGCGNIVTFAQFAFIALEGFVFQTNFGRKKPAIPISNYVIMVTMFFTVSVINNYALNFNIAMPLHMIFRSGSLIANMILGIIILKKRYSASKYLSIVLVSIGIFICTIMSAKQVSAQKGSTDEDGVYTFLQWLVGICMLTFALLMSARMGIFQETLYKQYGKHSKEALFYNHCLPLPGFLLLSTNIYNHAVFFSQSTPVEIPL--IGQHVPVMWVYLLMNVITQCGVTFMHLW--------------ILTLRKFLSLIISILYFQNPFTVWHWVGTAVVFLGTLLYTEVWTSIR-TAMKGD 312          
BLAST of slc35b-1 vs. Ensembl Cavefish
Match: slc35b4 (solute carrier family 35 member B4 [Source:NCBI gene;Acc:323737])

HSP 1 Score: 90.5077 bits (223), Expect = 2.492e-19
Identity = 75/269 (27.88%), Postives = 139/269 (51.67%), Query Frame = 2
Query:  152 NLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDA---SFHSSSFSGNMIF-------GVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFRFGSLFFPIWLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTI-----RRF 913
            N+  L++L+++   C  ++TF Q+  +    F+ Q   G +KP I +  Y   V +FF + ++NN  L++N+++ L  I +S +L+ N+  G   L ++Y  +KY++++LV +G+F  T+  A   S    S   + ++       G+ +L+ +L+ S  + + QE  + +YGKH  E +F+ H + L  F  +  +I       S  T V+I     G     +W+  L+N ++Q+  +   F L     SLTV L++T+     RRF
Sbjct:   17 NVVFLELLVRKFPGCGNIVTFAQFAFIALEGFVFQTNFGRKKPAIPISNYVIMVTMFFTVSVINNYALNFNIAMPLHMIFRSGSLIANMILGIIILKKRYSASKYLSIVLVSIGIFICTIMSAKQVSAQKGSTDEDGVYTFLQWLVGICMLTFALLMSARMGIFQETLYKQYGKHSKEALFYNHCLPLPGFLLLSTNIYNHAVFFSQSTPVEIPL--IGQHVPVMWVYLLMNVITQYVCIRGVFILTTECTSLTVTLVVTLQGPADRRF 283          
BLAST of slc35b-1 vs. Ensembl Cavefish
Match: slc35b4 (solute carrier family 35 member B4 [Source:NCBI gene;Acc:323737])

HSP 1 Score: 90.1225 bits (222), Expect = 2.728e-19
Identity = 75/269 (27.88%), Postives = 139/269 (51.67%), Query Frame = 2
Query:  152 NLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDA---SFHSSSFSGNMIF-------GVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFRFGSLFFPIWLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTI-----RRF 913
            N+  L++L+++   C  ++TF Q+  +    F+ Q   G +KP I +  Y   V +FF + ++NN  L++N+++ L  I +S +L+ N+  G   L ++Y  +KY++++LV +G+F  T+  A   S    S   + ++       G+ +L+ +L+ S  + + QE  + +YGKH  E +F+ H + L  F  +  +I       S  T V+I     G     +W+  L+N ++Q+  +   F L     SLTV L++T+     RRF
Sbjct:   17 NVVFLELLVRKFPGCGNIVTFAQFAFIALEGFVFQTNFGRKKPAIPISNYVIMVTMFFTVSVINNYALNFNIAMPLHMIFRSGSLIANMILGIIILKKRYSASKYLSIVLVSIGIFICTIMSAKQVSAQKGSTDEDGVYTFLQWLVGICMLTFALLMSARMGIFQETLYKQYGKHSKEALFYNHCLPLPGFLLLSTNIYNHAVFFSQSTPVEIPL--IGQHVPVMWVYLLMNVITQYVCIRGVFILTTECTSLTVTLVVTLQGPADRRF 283          
BLAST of slc35b-1 vs. Ensembl Cavefish
Match: slc35b4 (solute carrier family 35 member B4 [Source:NCBI gene;Acc:323737])

HSP 1 Score: 90.1225 bits (222), Expect = 2.905e-19
Identity = 75/269 (27.88%), Postives = 139/269 (51.67%), Query Frame = 2
Query:  152 NLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDA---SFHSSSFSGNMIF-------GVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFRFGSLFFPIWLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTI-----RRF 913
            N+  L++L+++   C  ++TF Q+  +    F+ Q   G +KP I +  Y   V +FF + ++NN  L++N+++ L  I +S +L+ N+  G   L ++Y  +KY++++LV +G+F  T+  A   S    S   + ++       G+ +L+ +L+ S  + + QE  + +YGKH  E +F+ H + L  F  +  +I       S  T V+I     G     +W+  L+N ++Q+  +   F L     SLTV L++T+     RRF
Sbjct:   17 NVVFLELLVRKFPGCGNIVTFAQFAFIALEGFVFQTNFGRKKPAIPISNYVIMVTMFFTVSVINNYALNFNIAMPLHMIFRSGSLIANMILGIIILKKRYSASKYLSIVLVSIGIFICTIMSAKQVSAQKGSTDEDGVYTFLQWLVGICMLTFALLMSARMGIFQETLYKQYGKHSKEALFYNHCLPLPGFLLLSTNIYNHAVFFSQSTPVEIPL--IGQHVPVMWVYLLMNVITQYVCIRGVFILTTECTSLTVTLVVTLQGPADRRF 283          
BLAST of slc35b-1 vs. Ensembl Cavefish
Match: slc35b4 (solute carrier family 35 member B4 [Source:NCBI gene;Acc:323737])

HSP 1 Score: 90.1225 bits (222), Expect = 3.060e-19
Identity = 75/269 (27.88%), Postives = 139/269 (51.67%), Query Frame = 2
Query:  152 NLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDA---SFHSSSFSGNMIF-------GVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFRFGSLFFPIWLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTI-----RRF 913
            N+  L++L+++   C  ++TF Q+  +    F+ Q   G +KP I +  Y   V +FF + ++NN  L++N+++ L  I +S +L+ N+  G   L ++Y  +KY++++LV +G+F  T+  A   S    S   + ++       G+ +L+ +L+ S  + + QE  + +YGKH  E +F+ H + L  F  +  +I       S  T V+I     G     +W+  L+N ++Q+  +   F L     SLTV L++T+     RRF
Sbjct:   17 NVVFLELLVRKFPGCGNIVTFAQFAFIALEGFVFQTNFGRKKPAIPISNYVIMVTMFFTVSVINNYALNFNIAMPLHMIFRSGSLIANMILGIIILKKRYSASKYLSIVLVSIGIFICTIMSAKQVSAQKGSTDEDGVYTFLQWLVGICMLTFALLMSARMGIFQETLYKQYGKHSKEALFYNHCLPLPGFLLLSTNIYNHAVFFSQSTPVEIPL--IGQHVPVMWVYLLMNVITQYVCIRGVFILTTECTSLTVTLVVTLQGPADRRF 283          
BLAST of slc35b-1 vs. Ensembl Sea Lamprey
Match: slc35b4 (solute carrier family 35 member B4 [Source:NCBI gene;Acc:323737])

HSP 1 Score: 140.969 bits (354), Expect = 4.450e-39
Identity = 90/297 (30.30%), Postives = 162/297 (54.55%), Query Frame = 2
Query:  152 NLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDASFHSSSFSG----------NMIFGVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFRFGSLFFP-IWLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIY 1009
            N+++L++L ++   C  ++TF Q++ +    FI + K G +KP I ++ Y   VI+FF + +LNN  L++N+++ L  I +S +L+ N+  G   L ++Y   KY++++LV LG+F  T   A   +S ++             + G+ +L+ +L  S  + + QEE + ++GKH  E +F+ H + L  F  +  DI  +  + S    V +       L  P +WL+ L+N ++Q+  +   F L     SLTV L++T+R+F SL+LS+ +    F    W+ T   F+GTL+Y
Sbjct:   37 NVYSLEMLARKYPGCGNIVTFSQFLFIALEGFIFEMKFGKKKPVIPIRHYTVMVIMFFAVSVLNNYALNFNIAMPLHMIFRSGSLIANMVLGIIILKKRYTLPKYLSIVLVSLGIFICTFMSAKQVASDYNAAKDDGVYAIITWLIGIGMLTFALFMSARMGIFQEELYARFGKHPREALFYNHALPLPGFLLLAKDIYNQGVLFSQSAPVALPWL---DLAVPEMWLMLLVNIITQYVCIRAVFVLTTECASLTVTLVVTLRKFISLILSILIFKNAFTTWHWLGTGVTFLGTLLY 330          
BLAST of slc35b-1 vs. Ensembl Yeast
Match: YEA4 (Uridine diphosphate-N-acetylglucosamine (UDP-GlcNAc) transporter; required for cell wall chitin synthesis; localized to the ER [Source:SGD;Acc:S000000730])

HSP 1 Score: 79.7221 bits (195), Expect = 3.467e-17
Identity = 86/316 (27.22%), Postives = 138/316 (43.67%), Query Frame = 2
Query:  128 CSTVVSFINLFTLDILIKQCSQCTYLLTFIQYISVI--GMQFIIQYKNGFQ--KP-QISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTL-TDASFH-------------SSSFSGNMIFGVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFRFGS--LFFPIWLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYS 1012
            CS V++F  L +      +      L+TF Q++ V   G+   +     F   KP +  L  Y   V+LF+I    NN    YN+SI +  + +    ++ +        RKY   + ++ + + +G    +L  DA F                S     IFG+ +L +S   S++L    E T+ KYGKH  E IF++H + L  F F    +  EY++     S +I C  FG   L      L L N L+Q+  +     L     +LT+ + + +R+F SL+LS+ +   N     +I    VF G  IYS
Sbjct:   16 CSNVITFETLMS-----NETGSINNLITFCQFLFVTCQGLPEFLDVHQPFPYFKPLKTPLHVYVITVVLFYISSTTNNNVFKYNISIPIHIVFRCFGTVITMFTCWLLNGRKYTKIQILSTLFLTIGAIIASLFKDADFRYQDLKLQAWKIGSDQSVDLTFIFGICILVLSSFTSSLLSAYNERTYQKYGKHWKENIFYSHFLSLPLFLFSRKQLIHEYRVMRK--SERILCSNFGGKILVPREETLLLFNVLTQYFCVKGVNILASKTNALTLSITLLVRKFISLLLSVRLFDNNLSYTGYIGVYLVFFGAFIYS 324          
BLAST of slc35b-1 vs. Ensembl Nematostella
Match: EDO45391 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT41])

HSP 1 Score: 125.561 bits (314), Expect = 3.928e-33
Identity = 93/318 (29.25%), Postives = 165/318 (51.89%), Query Frame = 2
Query:  128 CSTVVSFINLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDA---SFHSSSFSGNMIF----GVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFRFG-SLFFP-IWLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQSVKHTAIKID 1054
            CS VVS      L+++I++       +T  Q++ +    F+     G ++P I ++ Y   V  FF+  ++NN   ++N+ + L  I ++ +L+ N+  G   LNR Y  +KY++V++V  G+   T+  A     H ++ + +  F    G+ +L  +L+ S  + + QE+ +  YGKH  E +F+ H + L  F  +  D+ + + I  N +   I    FG SLF P +WL  L N ++Q+  +   + L     SLTV L++T+R+F SL++S++     F    WI T  VF GTLI+ ++F  +K   + I 
Sbjct:   15 CSNVVS------LELVIREVPSSGNFITCAQFVFIALEGFVFTTNFGRKQPAIPIRHYITMVAYFFVTSVINNYAFNFNIPVPLHMIFRAGSLVANLILGVIVLNRSYPVSKYLSVLMVTCGISICTIVSAHRVEVHHTADTDHDFFWLCVGIAMLITALLLSARMGIYQEQLYTTYGKHPKEALFYAHALPLPGFLLLAKDLYR-HVIIFNASEPFI---LFGTSLFIPKLWLYTLGNMVTQYVCIRSVYILTSECTSLTVTLVVTLRKFLSLLVSIFYFRNPFTVYHWIGTALVFSGTLIFVEIFSKIKQVFLPIK 322          
BLAST of slc35b-1 vs. Ensembl Medaka
Match: slc35b4 (solute carrier family 35 member B4 [Source:NCBI gene;Acc:101174100])

HSP 1 Score: 129.028 bits (323), Expect = 5.737e-34
Identity = 92/305 (30.16%), Postives = 160/305 (52.46%), Query Frame = 2
Query:  152 NLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDAS----------FHSSSFSGNMIFGVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFRFGSLFFPI-WLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQSVK 1033
            N+ TL++L+++   C  L+TF Q++ +    FI +   G +K  I ++ Y   V +FF + ++NN  L++N+++ L  I +S +L+ N+  G   L ++Y   KY+++ LV  G+F  T+  A             S S   + + G+ +L+ +L+ S  + + QE  + +YGKH  E +F+ H + L  F  +  DI       S  T V +       L  PI W+  LIN ++Q+  +   F L     SLTV L++T+R+F SL+ S+      F    W+ T  VF+GTL+Y++V  S++
Sbjct:   17 NVVTLELLVREFPGCGNLVTFAQFLFIALEGFIFETNFGRKKAVIPIRNYMIMVTMFFTVSVVNNYALNFNIAMPLHMIFRSGSLIANMILGVIILKKRYSTGKYLSIALVSAGIFICTIMSAKQVSASSEGSEEESFSVFVHWLIGIAMLTFALLMSARMGIFQETLYKQYGKHPKEALFYNHCLPLPGFLLLSTDIYNYCNHFSQSTPVLVPVV---GLTVPIMWIYLLINVITQYVCIRGVFVLTTECTSLTVTLVVTLRKFLSLIFSIIYFQNPFTAWHWLGTFVVFVGTLLYTEVLSSIQ 318          
BLAST of slc35b-1 vs. Planmine SMEST
Match: SMESG000042094.1 (SMESG000042094.1)

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 310/314 (98.73%), Postives = 312/314 (99.36%), Query Frame = 2
Query:  113 MNILICSTVVSFINLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDASFHSSSFSGNMIFGVXXXXXXXXXXXXXXXXQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFRFGSLFFPIWLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQSVKHTAIKID 1054
            MNILICSTVVSFINLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKY+AVILVMLGVFTTTLTDASFHSSS SGNMIFGVILL+ISLIFSTILPLLQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCF FGSLFFPIWLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQSVKHTAIKID
Sbjct:    1 MNILICSTVVSFINLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYKNGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLLNIAAGRFCLNRKYGNNKYIAVILVMLGVFTTTLTDASFHSSSLSGNMIFGVILLAISLIFSTILPLLQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHDISQEYQIASNLTSVKINCFPFGSLFFPIWLLFLINGLSQFGLLHLYFRLIVTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYSDVFQSVKHTAIKID 314          
The following BLAST results are available for this feature:
BLAST of slc35b-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SLC35B41.389e-3229.22solute carrier family 35 member B4 [Source:HGNC Sy... [more]
SLC35B41.515e-1828.79solute carrier family 35 member B4 [Source:HGNC Sy... [more]
back to top
BLAST of slc35b-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
nstp-23.673e-2930.03Nucleotide Sugar TransPorter family [Source:UniPr... [more]
nstp-24.397e-2931.37Nucleotide Sugar TransPorter family [Source:UniPr... [more]
nstp-19.499e-1830.92Nucleotide Sugar TransPorter family [Source:UniPr... [more]
nstp-16.370e-1030.83Nucleotide Sugar TransPorter family [Source:UniPr... [more]
back to top
BLAST of slc35b-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Efr2.325e-2729.39gene:FBgn0029849 transcript:FBtr0070875[more]
Efr2.325e-2729.39gene:FBgn0029849 transcript:FBtr0070874[more]
CG145112.478e-2328.52gene:FBgn0039641 transcript:FBtr0085412[more]
back to top
BLAST of slc35b-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc35b41.047e-3528.85solute carrier family 35 member B4 [Source:NCBI ge... [more]
back to top
BLAST of slc35b-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SLC35B46.894e-3530.84solute carrier family 35 (UDP-xylose/UDP-N-acetylg... [more]
SLC35B42.813e-3430.00solute carrier family 35 (UDP-xylose/UDP-N-acetylg... [more]
SLC35B41.107e-2829.03solute carrier family 35 (UDP-xylose/UDP-N-acetylg... [more]
back to top
BLAST of slc35b-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Slc35b41.087e-2928.90solute carrier family 35, member B4 [Source:MGI Sy... [more]
back to top
BLAST of slc35b-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7ZW46|S35B4_DANRE2.417e-3428.66UDP-xylose and UDP-N-acetylglucosamine transporter... [more]
sp|Q969S0|S35B4_HUMAN6.671e-3229.22UDP-xylose and UDP-N-acetylglucosamine transporter... [more]
sp|Q5R8M3|S35B4_PONAB6.810e-3229.55UDP-xylose and UDP-N-acetylglucosamine transporter... [more]
sp|Q95KB4|S35B4_MACFA1.502e-3128.89UDP-xylose and UDP-N-acetylglucosamine transporter... [more]
sp|Q8CIA5|S35B4_MOUSE7.606e-2928.90UDP-xylose and UDP-N-acetylglucosamine transporter... [more]
back to top
BLAST of slc35b-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJC50.000e+0100.00Slc35b-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A553R1G03.846e-3731.29Uncharacterized protein OS=Danionella translucida ... [more]
A0A0V0RZX42.701e-3631.76UDP-xylose and UDP-N-acetylglucosamine transporter... [more]
A0A0P5SV783.749e-3633.11UDP-xylose and UDP-N-acetylglucosamine transporter... [more]
A0A0V1B2545.847e-3630.77UDP-xylose and UDP-N-acetylglucosamine transporter... [more]
back to top
BLAST of slc35b-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc35b41.943e-3228.12solute carrier family 35 member B4 [Source:NCBI ge... [more]
slc35b42.492e-1927.88solute carrier family 35 member B4 [Source:NCBI ge... [more]
slc35b42.728e-1927.88solute carrier family 35 member B4 [Source:NCBI ge... [more]
slc35b42.905e-1927.88solute carrier family 35 member B4 [Source:NCBI ge... [more]
slc35b43.060e-1927.88solute carrier family 35 member B4 [Source:NCBI ge... [more]
back to top
BLAST of slc35b-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc35b44.450e-3930.30solute carrier family 35 member B4 [Source:NCBI ge... [more]
back to top
BLAST of slc35b-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YEA43.467e-1727.22Uridine diphosphate-N-acetylglucosamine (UDP-GlcNA... [more]
back to top
BLAST of slc35b-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO453913.928e-3329.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc35b-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc35b45.737e-3430.16solute carrier family 35 member B4 [Source:NCBI ge... [more]
back to top
BLAST of slc35b-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000042094.10.000e+098.73SMESG000042094.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30020567
GenBankAKN21641.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020567 ID=SMED30020567|Name=slc35b-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1101bp
AAAAGTTATTGTTTGATAATATCTTTACAATGAGAGATATTTGTTGAGTT
AAAAGAGTTAATAATATCTAGTTATAAATATCTACTTACATTTACATGTA
AAATTTCTAGAAATGAATATTTTGATTTGTTCAACAGTTGTCAGTTTCAT
CAATTTGTTCACTCTGGATATTTTAATTAAACAATGTTCTCAGTGCACTT
ATCTTTTGACATTTATTCAGTACATTTCCGTTATTGGAATGCAATTTATT
ATTCAATACAAAAATGGGTTTCAAAAGCCTCAAATCTCACTGAAACAATA
CTTTAAAAATGTCATTTTGTTTTTTATAATTCAAATTCTAAACAATCGAT
GTTTGTCTTACAATGTTTCAATTGCCTTACAAACTATTATTAAATCCAGT
AATTTGCTTTTGAATATTGCTGCGGGGAGGTTTTGTTTAAATCGAAAATA
CGGAAATAACAAATATGTCGCGGTGATTTTGGTAATGCTCGGAGTTTTCA
CAACAACTCTAACCGATGCTTCATTCCATAGCAGCTCTTTTTCAGGAAAT
ATGATTTTTGGAGTTATTTTATTATCCATATCGTTGATATTTTCAACTAT
TTTGCCACTATTACAAGAAGAAACATTTGTTAAATACGGCAAACATGTCG
GAGAATATATATTCTTTACTCATTTGATTGGATTACTGCCGTTTGCCTTT
ATTCATCATGATATTAGCCAGGAATATCAAATAGCTTCGAATTTGACCAG
TGTTAAAATTAATTGTTTTCGATTCGGTTCCCTTTTCTTTCCTATTTGGC
TTTTATTTCTTATCAACGGTTTAAGCCAATTCGGTTTGCTGCATCTTTAT
TTTCGATTGATTGTGACCAATGGGAGCTTGACCGTTGTTTTGTTAATGAC
TATTCGTCGGTTTTTCAGCTTGATGTTGTCTTTGTATGTATCAGGCGTAA
ATTTTCATTGTATTCAATGGATTTCGACATTATTTGTTTTTATTGGGACT
TTAATCTATTCAGATGTCTTTCAGTCTGTGAAACATACGGCCATTAAGAT
AGATTGATGATATGTTTTTACTCCTAGATATTTATTTTATAGTATTTGTT
T
back to top

protein sequence of SMED30020567-orf-1

>SMED30020567-orf-1 ID=SMED30020567-orf-1|Name=SMED30020567-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=315bp
MNILICSTVVSFINLFTLDILIKQCSQCTYLLTFIQYISVIGMQFIIQYK
NGFQKPQISLKQYFKNVILFFIIQILNNRCLSYNVSIALQTIIKSSNLLL
NIAAGRFCLNRKYGNNKYVAVILVMLGVFTTTLTDASFHSSSFSGNMIFG
VILLSISLIFSTILPLLQEETFVKYGKHVGEYIFFTHLIGLLPFAFIHHD
ISQEYQIASNLTSVKINCFRFGSLFFPIWLLFLINGLSQFGLLHLYFRLI
VTNGSLTVVLLMTIRRFFSLMLSLYVSGVNFHCIQWISTLFVFIGTLIYS
DVFQSVKHTAIKID*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR013657UAA
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006810transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013657UAA transporterPFAMPF08449UAAcoord: 7..301
e-value: 5.8E-53
score: 180.0
NoneNo IPR availablePANTHERPTHR10778:SF4UDP-XYLOSE AND UDP-N-ACETYLGLUCOSAMINE TRANSPORTERcoord: 14..307
NoneNo IPR availablePANTHERPTHR10778SOLUTE CARRIER FAMILY 35 MEMBER Bcoord: 14..307
NoneNo IPR availableTMHMMTMhelixcoord: 245..264
NoneNo IPR availableTMHMMTMhelixcoord: 67..89
NoneNo IPR availableTMHMMTMhelixcoord: 216..238
NoneNo IPR availableTMHMMTMhelixcoord: 30..47
NoneNo IPR availableTMHMMTMhelixcoord: 284..303
NoneNo IPR availableTMHMMTMhelixcoord: 119..138
NoneNo IPR availableTMHMMTMhelixcoord: 179..201
NoneNo IPR availableTMHMMTMhelixcoord: 148..167