beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3

Overview
Namebeta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3
Smed IDSMED30020563
Length (bp)1429
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020563

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30020563SMESG000043063.1 dd_Smed_v4_13967_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30020563SMESG000043063.1 dd_Smed_v4_13967_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT1 (glucosaminyl (N-acetyl) transferase 1 [Source:HGNC Symbol;Acc:HGNC:4203])

HSP 1 Score: 179.104 bits (453), Expect = 1.582e-50
Identity = 108/342 (31.58%), Postives = 168/342 (49.12%), Query Frame = 2
Query:  284 IQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG---------TYKNRDE------------NIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSF-------LGDPDELDSGI----FLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIK 1213
            +  +C+ F+ ++KY  +  S EE  FPIA+SI+V      ++RLLR IY P NFYC H+D KS   +  A+  +  C    F+N+ +      V +   S + ADLNCMKDLY    NWKY INL G +FP+KTN E+V+ LK   G NN+E           +K R E             ++P  +TP     F G  + +V+R +V ++ ++   + ++++  +   PDE  ++T+   P+  + GS        L D   +   +    F G       +        RS+CI G  DLN ++   HLFA+KF       A++CL++    K  E +K
Sbjct:   96 MTSDCSSFIKRRKYIVEPLSKEEAEFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDTKSEDSYLAAVMGIASC----FSNVFVASRLESVVYASWSRVQADLNCMKDLYAMSANWKYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPL----FSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDEYLWATIQRIPE--VPGSLPASHKYDLSDMQAVARFVKWQYFEGDVSKGAPYPPCDGVHVRSVCIFGAGDLNWMLRKHHLFANKFDVDVDLFAIQCLDEHLRHKALETLK 427          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT1 (glucosaminyl (N-acetyl) transferase 1 [Source:HGNC Symbol;Acc:HGNC:4203])

HSP 1 Score: 179.104 bits (453), Expect = 1.582e-50
Identity = 108/342 (31.58%), Postives = 168/342 (49.12%), Query Frame = 2
Query:  284 IQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG---------TYKNRDE------------NIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSF-------LGDPDELDSGI----FLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIK 1213
            +  +C+ F+ ++KY  +  S EE  FPIA+SI+V      ++RLLR IY P NFYC H+D KS   +  A+  +  C    F+N+ +      V +   S + ADLNCMKDLY    NWKY INL G +FP+KTN E+V+ LK   G NN+E           +K R E             ++P  +TP     F G  + +V+R +V ++ ++   + ++++  +   PDE  ++T+   P+  + GS        L D   +   +    F G       +        RS+CI G  DLN ++   HLFA+KF       A++CL++    K  E +K
Sbjct:   96 MTSDCSSFIKRRKYIVEPLSKEEAEFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDTKSEDSYLAAVMGIASC----FSNVFVASRLESVVYASWSRVQADLNCMKDLYAMSANWKYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPL----FSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDEYLWATIQRIPE--VPGSLPASHKYDLSDMQAVARFVKWQYFEGDVSKGAPYPPCDGVHVRSVCIFGAGDLNWMLRKHHLFANKFDVDVDLFAIQCLDEHLRHKALETLK 427          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT1 (glucosaminyl (N-acetyl) transferase 1 [Source:HGNC Symbol;Acc:HGNC:4203])

HSP 1 Score: 179.104 bits (453), Expect = 1.582e-50
Identity = 108/342 (31.58%), Postives = 168/342 (49.12%), Query Frame = 2
Query:  284 IQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG---------TYKNRDE------------NIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSF-------LGDPDELDSGI----FLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIK 1213
            +  +C+ F+ ++KY  +  S EE  FPIA+SI+V      ++RLLR IY P NFYC H+D KS   +  A+  +  C    F+N+ +      V +   S + ADLNCMKDLY    NWKY INL G +FP+KTN E+V+ LK   G NN+E           +K R E             ++P  +TP     F G  + +V+R +V ++ ++   + ++++  +   PDE  ++T+   P+  + GS        L D   +   +    F G       +        RS+CI G  DLN ++   HLFA+KF       A++CL++    K  E +K
Sbjct:   96 MTSDCSSFIKRRKYIVEPLSKEEAEFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDTKSEDSYLAAVMGIASC----FSNVFVASRLESVVYASWSRVQADLNCMKDLYAMSANWKYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPL----FSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDEYLWATIQRIPE--VPGSLPASHKYDLSDMQAVARFVKWQYFEGDVSKGAPYPPCDGVHVRSVCIFGAGDLNWMLRKHHLFANKFDVDVDLFAIQCLDEHLRHKALETLK 427          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:HGNC Symbol;Acc:HGNC:4205])

HSP 1 Score: 172.555 bits (436), Expect = 5.014e-48
Identity = 100/346 (28.90%), Postives = 173/346 (50.00%), Query Frame = 2
Query:  251 QTFTDSQITEEIQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENI-----------------IPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNY----------NPQFRIAG--------SFLGDPDELDSGIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKW 1183
            + FTD+     + R+C  F  ++K+     S EE  FPIA+S+++ +     ERLLR +Y P N YC H+D+KS   F+ A++ ++ C    F N+ I    V V +   S + ADLNCM+DL +    WKYF+N  G +FP+K+NAE+V+ LK   G N++E     + +                     K+  P+ +  F G+ +I+ +R+FV+ + ++   + +++++ +   PDE  ++TL            +P++ I+          + G   ++D G           +   S    R+IC+ G  DLN ++ + HL A+KF       AL+CLE++
Sbjct:   96 EPFTDTHYLS-LTRDCEHFKAERKFIQFPLSKEEVEFPIAYSMVIHEKIENFERLLRAVYAPQNIYCVHVDEKSPETFKEAVKAIISC----FPNVFIASKLVRVVYASWSRVQADLNCMEDLLQSSVPWKYFLNTCGTDFPIKSNAEMVQALKMLNGRNSMESEVPPKHKETRWKYHFEVVRDTLHLTNKKKDPPPYNLTMFTGNAYIVASRDFVQHVLKNPKSQQLIEWVKDTYSPDEHLWATLQRARWMPGSVPNHPKYDISDMTSIARLVKWQGHEGDIDKG---------APYAPCSGIHQRAICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEY 427          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:HGNC Symbol;Acc:HGNC:4205])

HSP 1 Score: 172.555 bits (436), Expect = 5.014e-48
Identity = 100/346 (28.90%), Postives = 173/346 (50.00%), Query Frame = 2
Query:  251 QTFTDSQITEEIQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENI-----------------IPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNY----------NPQFRIAG--------SFLGDPDELDSGIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKW 1183
            + FTD+     + R+C  F  ++K+     S EE  FPIA+S+++ +     ERLLR +Y P N YC H+D+KS   F+ A++ ++ C    F N+ I    V V +   S + ADLNCM+DL +    WKYF+N  G +FP+K+NAE+V+ LK   G N++E     + +                     K+  P+ +  F G+ +I+ +R+FV+ + ++   + +++++ +   PDE  ++TL            +P++ I+          + G   ++D G           +   S    R+IC+ G  DLN ++ + HL A+KF       AL+CLE++
Sbjct:   96 EPFTDTHYLS-LTRDCEHFKAERKFIQFPLSKEEVEFPIAYSMVIHEKIENFERLLRAVYAPQNIYCVHVDEKSPETFKEAVKAIISC----FPNVFIASKLVRVVYASWSRVQADLNCMEDLLQSSVPWKYFLNTCGTDFPIKSNAEMVQALKMLNGRNSMESEVPPKHKETRWKYHFEVVRDTLHLTNKKKDPPPYNLTMFTGNAYIVASRDFVQHVLKNPKSQQLIEWVKDTYSPDEHLWATLQRARWMPGSVPNHPKYDISDMTSIARLVKWQGHEGDIDKG---------APYAPCSGIHQRAICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEY 427          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-17 (GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:O02315])

HSP 1 Score: 154.451 bits (389), Expect = 3.459e-42
Identity = 119/381 (31.23%), Postives = 187/381 (49.08%), Query Frame = 2
Query:   74 VIFVLCLFMCLLIYYLFSTNRINFGKIYMPSEF---------NCYEYFQHNASKELINTATLWHIPPNQTFTDSQITEEIQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIE-GTYKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQ-FRIAGSF-LGDPDELDSGIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEK 1180
            VIF+L +   L+   L + N+    +I+ P++          N  + F++  + ELINT  + +   N T     +T   + N               S EE  FP++F ++V+K  SQV  LL  IY+P N YC  + + S   F   ++EL  C    F N+   + R  ++WG   ++ +   C++ L     +WKYF  L+G + PLKTN E+V+ILK   G  NI   TY++R  N   K ++P P+  FK  +  ++ R    ++  SS+P+ +L+FL      DE F+ TL  N   F + GSF   DP     G ++ R++   +  C +   +RS C+ GI D+  L+ S  L AHK Y   +P A  CL K
Sbjct:   18 VIFILFIAKALIPRLLENPNQ----RIHPPTDLLDDLQINCTNILQGFKNENTLELINTKMIENKMWNSTDRCQTLTSMFRFNKVPL-----------SEEEARFPLSFGLLVYKELSQVLFLLSSIYQPQNEYCIAVGENSAPAFLILLKELANC----FPNVYFMK-RPPIKWGSFEIINSVYGCLEFLSHLKSDWKYFQYLSGVDIPLKTNLEMVRILKRLNGTVNIGISTYEDRLLNGKNKTESPLPL--FKSSLSSLIPRKAANYLSSSSVPQQLLEFLRTTWVADEGFWGTLFGNKDLFNVPGSFNFNDPLTNGWGNYVSRHQLWVESECHNYMKDRS-CVFGIGDVPNLMKSRALVAHKLYIESEPEAFFCLLK 375          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-16 (GLY-16; GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:G5EDP7])

HSP 1 Score: 141.739 bits (356), Expect = 2.927e-37
Identity = 97/299 (32.44%), Postives = 153/299 (51.17%), Query Frame = 2
Query:  341 SNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIE-GTYKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQ-FRIAGSF---------------LGDPDELDSGIF--LGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEK 1180
            S EE  FP+++ ++V+K  SQV  +L  IY+P N YC  + + S + F   + EL +C    F N+   + R  + WG   ++ +  +C+K L     NWKYF  L+G + PLKTN E+V+ILK+  G  N+E   Y+NR   ++ + +T  P+  FK  +  ++ R    ++  SSIP+ +L+FL N    DE F+ TL  N   F + GS                L  P +   G F  + R++   +  C +   + S C+ GI D++ L+ +  L AHK Y   +P A  CL K
Sbjct:   91 SEEEARFPLSYGLLVYKELSQVLFMLSSIYQPQNEYCIAVGENSASTFLILLEELSDC----FPNVHFMK-RPPITWGSYEIINSVYDCLKFLSHLKSNWKYFQYLSGVDIPLKTNLEMVRILKSLNGTANVEIKVYENR--RLLGQNETESPLPLFKSSLSSLIPRKAANYLASSSIPQQLLEFLRNTWVADEGFWGTLFGNKGLFDVPGSLNFEEWIYFKENARANLTKPTD---GWFYYISRHQIWFESGCHNHMKDGS-CVFGIGDVSNLLQAKALVAHKLYLTSEPEAYFCLLK 378          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-18 (GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:Q19730])

HSP 1 Score: 136.346 bits (342), Expect = 3.599e-35
Identity = 93/296 (31.42%), Postives = 152/296 (51.35%), Query Frame = 2
Query:  341 SNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIE-GTYKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQ-FRIAGS-----FLGDPDELDSGI---------FLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEK 1180
            S EE+SFP+++ ++V+K  SQV  +L  IY P N YC  + + S   F+  ++EL  C    F+NI   + R  + WG   ++ +  +C++ L     +W+YF  L+G + PLKTN E+V+ILK   G  N+E   Y+ +      + Q+P P+  FK  +  ++ R     +  SSIP+ +L+FL N    DE F+ TL  N   F I GS     ++   + +++ +         ++ R +   +  C + +     C+ GI D+  L+ S  L AHKFY   +P A  CL K
Sbjct:  111 SPEEESFPLSYGLLVYKELSQVLFMLSSIYHPQNEYCIAVGENSAPIFQNLLKELSNC----FSNIHFMK-RPPIDWGSHEIINSAYDCLEFLSHLKSDWRYFQYLSGVDIPLKTNLEMVQILKHLNGTANVEIKPYQYQRLRGKNETQSPLPL--FKSSLSSLIPREAANHLSSSSIPQQLLEFLRNTGIADEGFWGTLFGNKNLFDIPGSLNFKEWISYKNNVETNLTYPTDGWRYYISRDQIWSKPNCHN-YMKAGSCVFGIGDVPRLLKSKALVAHKFYLKSEPEAYFCLLK 398          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-1 (GLY-1; GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:G5ECK8])

HSP 1 Score: 136.732 bits (343), Expect = 4.548e-35
Identity = 94/323 (29.10%), Postives = 162/323 (50.15%), Query Frame = 2
Query:  290 RNCTEFLDQQKYFFQEPSN-EEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGT------YKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQ-FRIAGSF-------------LGDPDELD----SGIFLGRYKNKG-QFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEK 1180
            RN    +D+   F + PS+ EE  +P+A+ ++V+KT  QV   + + Y+P + +C  +D +S  ++++ I+ L  C  +   ++ I E     QWG   +L     C   L +  + WKY+  L+G + P++TN E+V+I KA  G+ N + +      YKN  E ++P    P PV  +K  + ++V R   +++  S   + +L++L+    PDE F+ST+  +P    + GS              L  P E         ++GRY+  G Q  C  +  + S C+ G++D+  ++  P L AHK Y  FQP A  C+ K
Sbjct:  103 RNVCSTIDKYFNFTRIPSSREEAEYPLAYGLVVYKTIVQVLTQMSLFYQPQHMFCITVDDQSPNEYKSVIQALPSCFPNM--HVFIGE---PSQWGSFGILKNVYTCFNWLSKSKQKWKYYQYLSGTDLPIRTNLEMVRIFKALNGSMNTDVSTFEVDRYKNM-EGVLP----PMPV--YKSSMSVVVPREGADYLISSPRVQKLLKYLSKTWIPDESFWSTVLGSPALLPVPGSIRVRDILWLRKNFKLRPPYENTVNSIGTSYIGRYQVWGWQKECFGKVKDFS-CVFGVEDIEEIMTRPELVAHKLYLEFQPAAFMCMLK 412          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-15 (GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:L8E6J1])

HSP 1 Score: 134.035 bits (336), Expect = 2.144e-34
Identity = 119/422 (28.20%), Postives = 187/422 (44.31%), Query Frame = 2
Query:   44 MKIVRYSKAIVIFVLCLFMCLLIYYLFSTNRINFGKIYMPSEFNCYEYFQHNASKELINTATLWHIPPNQTFTDSQITEEIQR-------NCTEFLDQQKYF--FQEP-SNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNI--VITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENIIPKE----------QTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNP-QFRIAGSF-------------------LGDPDELDSGIFLGRYK---NKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCL 1174
            MK   +   ++IFV  L + L+I  +F +   N   I   S   C + F  +     +    L+       F D +I  +I +        C EF   QK F  FQEP S EE  FP+A+ ++V     Q+  LL  IY+P N +C  +D  S+ +F   +R L  C    + NI   IT+   +++W    +L +   C+  L +   +WKYF  L+G + PLK+N E+++ILKA  G+ N E         I+P E           +P P+  +K  +    +R    F+  S      + FL      DE  ++T+  NP +  + G F                    G+  ++D+G ++ RY+   N+    C   ++  S C+ G+ DL  LIN   L AHK Y  +QP A  CL
Sbjct:    1 MKFSIFLGFLLIFVTFLPLVLVILEIFESQ--NPASIIDFSHLECQKMFDGDPVS--LARGALFK------FDDREILAQILKLSGQENAQCAEF---QKIFGFFQEPTSQEELEFPLAYGMLVHGDFVQLSLLLSAIYQPQNQFCLAVDGNSSVEFIGLVRMLSRC----YGNIQYFITD---EIRWCGYEILTSVFQCVDYLAKLPSDWKYFQYLSGVDAPLKSNLEMIRILKALNGSFNAE---------ILPFEFYRLNRKRPWSSPLPL--YKTSLSATFSRKSANFMVNSEKVLEQIDFLRGTTCADESLWATIAGNPKELPMPGGFDAKAWIHKNYRRTRGKLGKYGENQKIDNGYYVSRYQQYVNRAPVKCKGYYYRLS-CVFGVYDLPNLINRHELVAHKLYFSYQPAAFMCL 390          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Fly
Match: oxt (gene:FBgn0015360 transcript:FBtr0072904)

HSP 1 Score: 91.6633 bits (226), Expect = 3.454e-19
Identity = 67/226 (29.65%), Postives = 108/226 (47.79%), Query Frame = 2
Query:  338 PSNEEKSFPIAFSIMVFKTA-SQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG----------------TYKNRDENI--IPKEQTPFPVIWFKGDVHIIVNRNFVEFIF----ESSIPKVILQFLNNQQFPDEQFFSTLNYN 946
            PS E K   IAF + +   A  QV RLL+ +Y P + Y  H+D++ +  +    R+L+E L SKF NI +   R    WG  S+L   L CM+DL +   +W + INL+  +FP+KT  +LV  L A  G N ++G                T+   D ++  I   + P  +    G   + ++R FV ++     +  + + +L+   +   P E FF T+  N
Sbjct:  241 PSEETKRVRIAFLLTLNGRALRQVHRLLKALYAPEHVYYIHVDERQDYLY----RKLLE-LESKFPNIRLARKRFSTIWGGASLLTMLLQCMEDLLQSNWHWDFVINLSESDFPVKTLDKLVDFLSANPGRNFVKGHGRETQKFIQKQGLDKTFVECDTHMWRIGDRKLPAGIQVDGGSDWVALSRPFVGYVTHPREDDELLQALLKLFRHTLLPAESFFHTVLRN 461          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: si:dkeyp-87d8.8 (si:dkeyp-87d8.8 [Source:ZFIN;Acc:ZDB-GENE-041111-161])

HSP 1 Score: 171.785 bits (434), Expect = 8.231e-48
Identity = 120/361 (33.24%), Postives = 179/361 (49.58%), Query Frame = 2
Query:  251 QTFTDSQITEEIQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTY--------------KNRDENI------IPKEQTPFP--VIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFL---GDPDELDSGIFLGRYKN-KGQ-FTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVKESFYTS 1252
            +  TD+ I      +C  F+  Q+Y   + +  E+ FP+A+S++V + A+ VERLLR +Y P N YC H D+KS+  F  A+  L  C+     N+ I      VQ+  +S L ADLNC+ DL +    WKY INL GQ+FPL+TNAELV  LK  KG N +E  +              KN D          P+E+ P P  +  F G  +  ++R FV F+  SS+ K  L +  +   PDE F++TL   P   + G       D  EL S   L ++   +G+ +   +    R ICI G  +L  L+N  H FA+K      P  + CLE    +K+ E+ +S + +     ++S
Sbjct:   79 KGLTDAAIANATI-DCEWFVSSQRYNDIQVTESEREFPLAYSLVVHQDAALVERLLRAVYVPHNIYCIHYDRKSSTDFMLAMNGLARCIP----NVFIASKLERVQYAGISRLRADLNCLSDLLDSEVKWKYVINLCGQDFPLRTNAELVSDLKGLKGRNMVESKWPGGKKIRWSVHHLLKNNDSEYYDFPVSTPEEKPPPPHNIEMFVGSAYFTLSREFVYFVHWSSLAKDFLAWSEDTFSPDEHFWATLVRVPG--VPGEVPRSEADISELISKTRLVKWSAFEGRLYPRCTGVHVRKICIYGAAELRWLLNYGHWFANKVDPKVDPVLIECLE----EKLAEKRRSFHKKSINEVFSS 428          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: gcnt4a (glucosaminyl (N-acetyl) transferase 4a [Source:NCBI gene;Acc:324510])

HSP 1 Score: 171.014 bits (432), Expect = 1.108e-47
Identity = 106/324 (32.72%), Postives = 168/324 (51.85%), Query Frame = 2
Query:  293 NCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGT-------------YKNRD----------ENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFL-GDPD--ELDSGIFLGR--YKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEK 1180
            +C  +++Q++Y     ++EE +FPIA+S++V K ++ VER+LR IY P N YC H D+KS   F  A++ L  C    F N+ I      VQ+  ++ L ADLNC+ DL      WKY INL GQ+FPLK+N ELV  L+   GAN +E +             Y+ +D          +  I K+  P  +  F G  + +++R+FV ++  + + K  LQ+  +   PDE F++++   P   + G     +PD  +L S   L +  Y  +  +   +    RS+CI G  +L  L+   H FA+KF     P  ++CLE+
Sbjct:   96 DCKSYIEQRRYNEVLVTDEECNFPIAYSLVVHKNSAMVERILRAIYAPQNIYCIHYDQKSTKDFIAAMKNLESC----FPNVFIASKIESVQYAHITRLKADLNCLSDLLSSEVKWKYVINLCGQDFPLKSNYELVTELRKLNGANMLETSRPSKVKKQRFQFRYQLKDVSYEYQKMPVKTSIAKDPPPHNIEMFVGSAYFVLSRDFVTYVMNNQLAKDFLQWSVDTYSPDEHFWASMARVPG--VPGELARSEPDVSDLKSRTRLVKWNYLEERLYPKCTGTHRRSVCIYGAAELRWLLEDGHWFANKFDPKVDPVIIKCLEE 413          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: gcnt4a (glucosaminyl (N-acetyl) transferase 4a [Source:NCBI gene;Acc:324510])

HSP 1 Score: 170.629 bits (431), Expect = 1.376e-47
Identity = 106/324 (32.72%), Postives = 168/324 (51.85%), Query Frame = 2
Query:  293 NCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGT-------------YKNRD----------ENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFL-GDPD--ELDSGIFLGR--YKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEK 1180
            +C  +++Q++Y     ++EE +FPIA+S++V K ++ VER+LR IY P N YC H D+KS   F  A++ L  C    F N+ I      VQ+  ++ L ADLNC+ DL      WKY INL GQ+FPLK+N ELV  L+   GAN +E +             Y+ +D          +  I K+  P  +  F G  + +++R+FV ++  + + K  LQ+  +   PDE F++++   P   + G     +PD  +L S   L +  Y  +  +   +    RS+CI G  +L  L+   H FA+KF     P  ++CLE+
Sbjct:   96 DCKSYIEQRRYNEVLVTDEECNFPIAYSLVVHKNSAMVERILRAIYAPQNIYCIHYDQKSTKDFIAAMKNLESC----FPNVFIASKIESVQYAHITRLKADLNCLSDLLSSEVKWKYVINLCGQDFPLKSNYELVTELRKLNGANMLETSRPSKVKKQRFQFRYQLKDVSYEYQKMPVKTSIAKDPPPHNIEMFVGSAYFVLSRDFVTYVMNNQLAKDFLQWSVDTYSPDEHFWASMARVPG--VPGELARSEPDVSDLKSRTRLVKWNYLEERLYPKCTGTHRRSVCIYGAAELRWLLEDGHWFANKFDPKVDPVIIKCLEE 413          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: gcnt4b (glucosaminyl (N-acetyl) transferase 4b [Source:ZFIN;Acc:ZDB-GENE-091118-69])

HSP 1 Score: 168.318 bits (425), Expect = 9.619e-47
Identity = 125/399 (31.33%), Postives = 187/399 (46.87%), Query Frame = 2
Query:   80 FVLCLFMCLLIYYLFSTNRINFGKIYMPSEF--NC---YEYFQHNASKELINTATLWHIPPNQTFTDSQITEEIQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTY---KNRDENI-------------IP------KEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFL---GDPDELDSGIFLGRYKN-KGQ-FTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEK 1180
            F L   +CLL        RI F    + +++  NC   YE      +K L+      ++ P       +I      +C +F+    Y   + +  E+ FP+A+S++V + A+ VERLLR +Y P N YC H D+KS+  F  A+  L  C+     N+ I      VQ+  +S L ADLNC+ DL +    WKY INL GQ+FPL+TNAELV  LK  KG N +E  +   KNR  ++              P      K   P+ +  F G  +  ++R FV F+  S + +  L +  +   PDE F++TL   P   + G       D  EL S   L ++   +G+ +   +    R ICI G  +L  L+N  H FA+K      P  + CLE+
Sbjct:   15 FTLLKILCLL-------KRIKFTMPRLTAKYGINCTRIYEMEPVEVAKTLVIRKQKSYVEPTD-----EIIVNATSDCDQFVSSLGYDAIQVTESEREFPLAYSLVVHRNAALVERLLRAVYVPHNIYCIHYDRKSSTDFMLAMNGLARCIP----NVFIASKLERVQYAGISRLRADLNCLSDLLDSEVKWKYVINLCGQDFPLRTNAELVSDLKGLKGRNMVESKWPGAKNRRWSVHHLLKNKKFEFYNTPVSTSDKKRPPPYDIEMFVGSAYFTLSREFVYFVHWSYLARNFLAWSEDTFSPDEHFWATLVRVPG--VPGEVPRSEADISELISKTRLVKWSAFEGRLYPRCTGVHVRKICIYGAAELRWLLNYGHWFANKVDPKVDPVLIECLEE 395          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: si:dkeyp-87d8.8 (si:dkeyp-87d8.8 [Source:ZFIN;Acc:ZDB-GENE-041111-161])

HSP 1 Score: 166.392 bits (420), Expect = 6.998e-46
Identity = 115/351 (32.76%), Postives = 173/351 (49.29%), Query Frame = 2
Query:  260 TDSQITEEIQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTY---KNRDENI-------------IP------KEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFL---GDPDELDSGIFLGRYKN-KGQ-FTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARV 1231
            TD  I      +C +F+    Y   + +  E+ FP+A+S++V + A+ VERLLR +Y P N YC H D+KS+  F  A+  L  C+     N+ I      VQ+  +S L ADLNC+ DL +    WKY INL GQ+FPL+TNAELV  LK  KG N +E  +   KNR  ++              P      K   P+ +  F G  +  ++R FV F+  S + +  L +  +   PDE F++TL   P   + G       D  EL S   L ++   +G+ +   +    R ICI G  +L  L+N  H FA+K      P  + CLE    +K+ E+ +S + ++
Sbjct:   95 TDETIVNATS-DCDQFVSSLGYDAIQVTESEREFPLAYSLVVHRNAALVERLLRAVYVPHNIYCIHYDRKSSTDFMLAMNGLARCMP----NVFIASKLERVQYAGISRLRADLNCLSDLLDSEVKWKYVINLCGQDFPLRTNAELVSDLKGLKGRNMVESKWPGAKNRRWSVHHLLKNKKFEFYNTPVSTSDKKRPPPYDIEMFVGSAYFTLSREFVYFVHWSYLARNFLAWSEDTFSPDEHFWATLVRVPG--VPGEVPRSEADISELISKTRLVKWSAFEGRLYPRCTGVHVRKICIYGAAELRWLLNYGHWFANKVDPKVDPVLIECLE----EKLAEKRRSFHKKI 434          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: slc24a4 (solute carrier family 24 member 4 [Source:Xenbase;Acc:XB-GENE-478288])

HSP 1 Score: 181.415 bits (459), Expect = 2.713e-51
Identity = 122/395 (30.89%), Postives = 193/395 (48.86%), Query Frame = 2
Query:  101 CLLIYYLFSTNRINFGKIYMPSEFNCYEYFQHNASKELINTATLWHIPPNQT---FTDSQITEEIQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG----TYKNR----------DENII-----PKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLG-----DPDELDSGIFLGRYKN-KGQFTCGSRFF------NRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKW 1183
            C+  YY+     +N      P E NC+   Q     E +  A + ++   +     TD         +C  F  ++KY     S EE+ FPIA+S+++       ERLLR IY P N YC H+DKKS   F  A+R +  C    F N+ +    V+V +     + ADLNCM+DL +    WKY IN  G +FP+KTNAE+VK LK+  G N++E      +K R          D N I      K+ +P PV  F G+ +I+V RNFV  +F +   +  + +  +   PDE  ++TLN   +F     ++      D  ++++   L ++++ +G  + G+ +        R++C+ G  DLN L+   HLFA+KF        ++CLE++
Sbjct:   53 CMASYYM----ALNLSA---PGEKNCHRIIQ--GDMEEVRRALIDNLVAKKKRVIMTDESFINATS-DCKLFRQRRKYVMFSLSKEEQDFPIAYSMVIHDNIEMFERLLRAIYTPHNIYCVHMDKKSPESFHQAVRAITSC----FGNVFVASKLVNVVYASWRRVQADLNCMEDLLQSKVPWKYLINTCGTDFPIKTNAEMVKALKSLNGHNSMESEIPPNHKKRRWEYHFELKEDSNNIVLTNTRKKPSPLPVPVFSGNAYIVVTRNFVNALFVNPTVRSFITWAKDTYSPDEYLWATLN---RFAEMPGYMPAHQKYDTSDINAIARLVKWESLEGDMSKGAPYIPCSGTHRRTVCVYGTGDLNWLLQQHHLFANKFDPKVDNNVIQCLEEY 430          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: ccdc77 (coiled-coil domain containing 77 [Source:Xenbase;Acc:XB-GENE-959311])

HSP 1 Score: 176.407 bits (446), Expect = 1.223e-49
Identity = 108/340 (31.76%), Postives = 168/340 (49.41%), Query Frame = 2
Query:  269 QITEE----IQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIE---------------------GTYKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLG----DPDELDS-GIFLGRYKNKGQFTCGSRF------FNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEK 1180
            Q+T+E    +  +C  F   +KY     S EE+ FPIA+SI+V+     +ERLLR IY P N+YC H+DKKS+  F  A++ +  C    F N+ I     +V +   + + ADLNCM DL+ +   WKY INL G +FP+KTN E+V++LK  K  N++E                        K  ++   P  +TP     F G  + +V R FV +I E+   +  L++  +   PDE  ++TL   P   + GS       D  ++++   F+     +G    G+ +        RS+C+ G  DL  ++   HLF +KF     P A++CLE+
Sbjct:   84 QLTDEDYINMTNDCEAFTRDRKYLLYPLSKEEREFPIAYSIVVYHRIDMLERLLRSIYTPQNYYCIHVDKKSSTSFLNAVKAITSC----FENVFIASQLENVVYASWARVQADLNCMTDLHNKNAKWKYLINLCGMDFPIKTNREMVEMLKGLKSQNSLETEKMPPHKEVRWRKHYEIVDNAIRKTEEDKTPPPLETPV----FSGSAYFVVTRAFVSYILENEKIQRFLEWSKDTYSPDEFIWATLQRIPG--VPGSVPANSKYDVSDMNAYARFVKWAYLEGDVAKGAPYPPCAGNHVRSVCVFGAGDLEFMLQKHHLFGNKFDIDVDPTAIKCLEE 413          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: cnksr2 (connector enhancer of kinase suppressor of Ras 2 [Source:Xenbase;Acc:XB-GENE-490704])

HSP 1 Score: 176.022 bits (445), Expect = 2.360e-49
Identity = 107/331 (32.33%), Postives = 162/331 (48.94%), Query Frame = 2
Query:  284 IQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIE-----GTYKNR-----------DENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDS---------GIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVT 1201
            +  +C+ F   +KY     S EE++FPIA+S+++ +     ERLLR IY P N YC H+D+KS A F+ A+  +  C    F+N+ I    V V +     + ADLNCM+DL +    WKY +N  G +FPLKTNAE+V+ LK+  G N++E      + K R            +  I K   P     F G+ +I+V RNFVE IF +     +++++ +   PDE  ++TLN  P    +  +    ++ D          G   G       +   +    RSIC+ G  DL  L+   H+ A+KF       AL CLE++   K  
Sbjct:  100 MTTDCSYFKKNRKYMPFPMSKEEENFPIAYSMVIHEKIDMFERLLRAIYAPQNIYCVHVDEKSPAVFKEAVNAITSC----FDNVFIASKLVKVVYAAWPRVQADLNCMEDLLQSKVLWKYLLNTCGTDFPLKTNAEIVRTLKSLNGKNSMESEKPSSSKKTRWEFHFEVGDSISKTAIEKSPPPIDSPMFTGNAYIVVCRNFVEHIFNNPQALTLIEWVKDTYSPDEHLWATLNRMPGVPGSSPYSDKYEKSDMNAVARMVKWGYMEGDIAKGAPYPPCTGTHRRSICVYGTGDLYWLLEQHHVLANKFDPKVDNIALECLEEYLRHKTV 426          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: gcnt2.2 (glucosaminyl (N-acetyl) transferase 2 (I blood group), gene 2 [Source:NCBI gene;Acc:100038221])

HSP 1 Score: 174.481 bits (441), Expect = 5.915e-49
Identity = 110/318 (34.59%), Postives = 157/318 (49.37%), Query Frame = 2
Query:  287 QRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGT-----------YKNRDENI--------IPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIFLG-RYKN-KGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLE 1177
            + +C E++ Q  +     S EE +FP+A+ + V K     ERL R IY P N YC H+D+K++A F  A+  LV+C    F N  +      V +G +S L ADLNCMKDL      WKY INL GQ+FPLKTN E++  +K++KG N   G            Y +R++ +        + K   P  +  + G  ++ + R F  FI E      +L +  +   PDE ++ TLN     RIA      PD    G     ++K+ K Q  C   +  R ICI G  DL  L+NS  +FA+KF     P  + CLE
Sbjct:   90 KSSCPEYVRQNHFIMSPLSQEEAAFPLAYILTVHKEFETFERLFRAIYMPQNIYCVHVDEKASADFMQAVDSLVQC----FPNTFLASKMEPVVYGGISRLQADLNCMKDLLASDVQWKYVINLCGQDFPLKTNKEIIHHIKSFKGKNITPGVLPPAHAIPRTKYVHREDIVNSRVVRTRVLKPPPPHNITIYFGSAYVALTREFTRFILEDQRATNLLLWSKDTYSPDEHYWVTLN-----RIADVPGSAPDASWEGQLRAVKWKDMKDQEKCHGHYV-RDICIYGTGDLQWLMNSRSIFANKFEAKSYPPTVECLE 397          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: adsl (adenylosuccinate lyase [Source:Xenbase;Acc:XB-GENE-1001539])

HSP 1 Score: 169.859 bits (429), Expect = 2.171e-47
Identity = 123/397 (30.98%), Postives = 184/397 (46.35%), Query Frame = 2
Query:   59 YSKAIVIFVLCLFMCLLIYYLFSTNRINFGKIYMPSEFNCYEYFQHNASKELINTAT--LW-HIPPNQTFTDSQITEEIQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGT-----------YKNRDENI--------IPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIF--LGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLE 1177
            Y K +    L L M +L+  + S ++I    ++   + +  E     A + L  T     W H+P  +T++ S        NC +F+ +  Y     S EE +FP+A+ + V K     ERL R IY P N YC H+D+K++A F  A+  LV+C    F N  +      V +G +S L ADLNCMKDL      WKY INL GQ+FPLKTN E++  +K++KG N   G            Y +R++ +        + K   P  +  + G  ++ + R F  FI E      +L +  +   PDE ++ TLN     RIA      PD    G    +    +K    C   +  R +C+ G  DL  L+ SP +F +KF     P  + CLE
Sbjct:    3 YPKQLFFIFLALGMVILLNSILSQSQIKKALVFS-QQISLLE----EACQALAKTKKSFFWNHLP--KTYSHSS-------NCKDFILKNNYITLPLSEEEAAFPLAYILTVHKEFETFERLFRAIYMPQNIYCVHVDEKASADFMQAVDSLVQC----FPNTFLASKMEPVVYGGISRLQADLNCMKDLLASDVQWKYVINLCGQDFPLKTNREIIHHIKSFKGKNITPGVLPPAHAIPRTKYVHREDIVNSRVVRTRVLKPPPPHNITIYFGSAYVALTREFTRFILEDQRATNLLLWSKDTYSPDEHYWVTLN-----RIADFPGSVPDAKWEGDLRAIKWSDDKTHDGCHGHYV-RDVCVYGTGDLQWLLKSPSMFGNKFELASYPPTVECLE 375          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt1 (glucosaminyl (N-acetyl) transferase 1, core 2 [Source:MGI Symbol;Acc:MGI:95676])

HSP 1 Score: 186.808 bits (473), Expect = 1.340e-53
Identity = 109/338 (32.25%), Postives = 170/338 (50.30%), Query Frame = 2
Query:  284 IQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTY--KNRDE---------------NIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSF-------LGDPDELDSGI----FLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIK 1213
            + R+C  F+  +KY  +  + EE  FPIA+SI+V      ++RLLR IY P NFYC H+D+K+   F  A++ +  C    F+N+ +      V +   S + ADLNCMKDLY    NWKY INL G +FP+KTN E+V+ LK   G NN+E      N++E                 I K   P     F G  + +V R +V ++ E+   + ++++  +   PDE  ++T+   P+  + GSF       L D + +   +    F G   N   +   S    RS+C+ G  DL+ ++   HLFA+KF     P A++CL++    K  E ++
Sbjct:   96 MTRDCASFIRTRKYIVEPLTKEEVGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDRKAEESFLAAVQGIASC----FDNVFVASQLESVVYASWSRVKADLNCMKDLYRMNANWKYLINLCGMDFPIKTNLEIVRKLKCSTGENNLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVLENENIQKLMEWAQDTYSPDEFLWATIQRIPE--VPGSFPSSNKYDLSDMNAIARFVKWQYFEGHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHHLFANKFDMDVDPFAIQCLDEHLRHKALENLE 427          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt1 (glucosaminyl (N-acetyl) transferase 1, core 2 [Source:MGI Symbol;Acc:MGI:95676])

HSP 1 Score: 186.808 bits (473), Expect = 1.340e-53
Identity = 109/338 (32.25%), Postives = 170/338 (50.30%), Query Frame = 2
Query:  284 IQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTY--KNRDE---------------NIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSF-------LGDPDELDSGI----FLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIK 1213
            + R+C  F+  +KY  +  + EE  FPIA+SI+V      ++RLLR IY P NFYC H+D+K+   F  A++ +  C    F+N+ +      V +   S + ADLNCMKDLY    NWKY INL G +FP+KTN E+V+ LK   G NN+E      N++E                 I K   P     F G  + +V R +V ++ E+   + ++++  +   PDE  ++T+   P+  + GSF       L D + +   +    F G   N   +   S    RS+C+ G  DL+ ++   HLFA+KF     P A++CL++    K  E ++
Sbjct:   96 MTRDCASFIRTRKYIVEPLTKEEVGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDRKAEESFLAAVQGIASC----FDNVFVASQLESVVYASWSRVKADLNCMKDLYRMNANWKYLINLCGMDFPIKTNLEIVRKLKCSTGENNLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVLENENIQKLMEWAQDTYSPDEFLWATIQRIPE--VPGSFPSSNKYDLSDMNAIARFVKWQYFEGHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHHLFANKFDMDVDPFAIQCLDEHLRHKALENLE 427          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt1 (glucosaminyl (N-acetyl) transferase 1, core 2 [Source:MGI Symbol;Acc:MGI:95676])

HSP 1 Score: 186.808 bits (473), Expect = 1.340e-53
Identity = 109/338 (32.25%), Postives = 170/338 (50.30%), Query Frame = 2
Query:  284 IQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTY--KNRDE---------------NIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSF-------LGDPDELDSGI----FLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIK 1213
            + R+C  F+  +KY  +  + EE  FPIA+SI+V      ++RLLR IY P NFYC H+D+K+   F  A++ +  C    F+N+ +      V +   S + ADLNCMKDLY    NWKY INL G +FP+KTN E+V+ LK   G NN+E      N++E                 I K   P     F G  + +V R +V ++ E+   + ++++  +   PDE  ++T+   P+  + GSF       L D + +   +    F G   N   +   S    RS+C+ G  DL+ ++   HLFA+KF     P A++CL++    K  E ++
Sbjct:   96 MTRDCASFIRTRKYIVEPLTKEEVGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDRKAEESFLAAVQGIASC----FDNVFVASQLESVVYASWSRVKADLNCMKDLYRMNANWKYLINLCGMDFPIKTNLEIVRKLKCSTGENNLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVLENENIQKLMEWAQDTYSPDEFLWATIQRIPE--VPGSFPSSNKYDLSDMNAIARFVKWQYFEGHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHHLFANKFDMDVDPFAIQCLDEHLRHKALENLE 427          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt1 (glucosaminyl (N-acetyl) transferase 1, core 2 [Source:MGI Symbol;Acc:MGI:95676])

HSP 1 Score: 186.808 bits (473), Expect = 1.340e-53
Identity = 109/338 (32.25%), Postives = 170/338 (50.30%), Query Frame = 2
Query:  284 IQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTY--KNRDE---------------NIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSF-------LGDPDELDSGI----FLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIK 1213
            + R+C  F+  +KY  +  + EE  FPIA+SI+V      ++RLLR IY P NFYC H+D+K+   F  A++ +  C    F+N+ +      V +   S + ADLNCMKDLY    NWKY INL G +FP+KTN E+V+ LK   G NN+E      N++E                 I K   P     F G  + +V R +V ++ E+   + ++++  +   PDE  ++T+   P+  + GSF       L D + +   +    F G   N   +   S    RS+C+ G  DL+ ++   HLFA+KF     P A++CL++    K  E ++
Sbjct:   96 MTRDCASFIRTRKYIVEPLTKEEVGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDRKAEESFLAAVQGIASC----FDNVFVASQLESVVYASWSRVKADLNCMKDLYRMNANWKYLINLCGMDFPIKTNLEIVRKLKCSTGENNLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVLENENIQKLMEWAQDTYSPDEFLWATIQRIPE--VPGSFPSSNKYDLSDMNAIARFVKWQYFEGHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHHLFANKFDMDVDPFAIQCLDEHLRHKALENLE 427          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:MGI Symbol;Acc:MGI:1919327])

HSP 1 Score: 183.341 bits (464), Expect = 3.252e-52
Identity = 110/348 (31.61%), Postives = 177/348 (50.86%), Query Frame = 2
Query:  251 QTFTDSQITEEIQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGT-------------YKNRDE-NIIPKEQTPFP--VIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIFL----------------GRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKV 1198
            Q FT++     +  +C  F  ++K+     S EE SFPIA+S++V +     ERLLR +Y P N YC H+D+KS+  F+ A+R +V C    F N+ I    V V +   S + ADLNCM+DL +    WKY +N  G +FP+KTNAE+VK LK  KG N++E               Y+  D  ++  K +TP P  +  F G+ +++ +R+F+E +F +S  + +++++ +   PDE  ++TL          S++   D L     L                G  +N   +T  S    R++C+ G  DL+ ++ + HL A+KF        L+CLE++   K 
Sbjct:   96 QLFTEADYLR-MTADCEHFKTKRKFIQVPLSKEEASFPIAYSMVVHEKIENFERLLRAVYTPQNVYCVHMDQKSSEPFKQAVRAIVSC----FPNVFIASKLVSVVYASWSRVQADLNCMEDLLQSPVPWKYLLNTCGTDFPIKTNAEMVKALKLLKGQNSMESEVPPPHKKSRWKYHYEVTDTLHMTSKRKTPPPNNLTMFTGNAYMVASRDFIEHVFSNSKARQLIEWVKDTYSPDEHLWATLQ-------RASWMPGSDPLHRKFDLSDMRAIARLTKWYDHEGDIENGAPYTSCSGIHQRAVCVYGSGDLHWILQNHHLLANKFDPKVDDNVLQCLEEYLRHKA 431          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q09324|GCNT1_MOUSE (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Mus musculus OX=10090 GN=Gcnt1 PE=1 SV=2)

HSP 1 Score: 186.808 bits (473), Expect = 9.375e-53
Identity = 109/338 (32.25%), Postives = 170/338 (50.30%), Query Frame = 2
Query:  284 IQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTY--KNRDE---------------NIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSF-------LGDPDELDSGI----FLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIK 1213
            + R+C  F+  +KY  +  + EE  FPIA+SI+V      ++RLLR IY P NFYC H+D+K+   F  A++ +  C    F+N+ +      V +   S + ADLNCMKDLY    NWKY INL G +FP+KTN E+V+ LK   G NN+E      N++E                 I K   P     F G  + +V R +V ++ E+   + ++++  +   PDE  ++T+   P+  + GSF       L D + +   +    F G   N   +   S    RS+C+ G  DL+ ++   HLFA+KF     P A++CL++    K  E ++
Sbjct:   96 MTRDCASFIRTRKYIVEPLTKEEVGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDRKAEESFLAAVQGIASC----FDNVFVASQLESVVYASWSRVKADLNCMKDLYRMNANWKYLINLCGMDFPIKTNLEIVRKLKCSTGENNLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVLENENIQKLMEWAQDTYSPDEFLWATIQRIPE--VPGSFPSSNKYDLSDMNAIARFVKWQYFEGHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHHLFANKFDMDVDPFAIQCLDEHLRHKALENLE 427          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q5JCT0|GCNT3_MOUSE (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Mus musculus OX=10090 GN=Gcnt3 PE=2 SV=2)

HSP 1 Score: 183.341 bits (464), Expect = 2.274e-51
Identity = 110/348 (31.61%), Postives = 177/348 (50.86%), Query Frame = 2
Query:  251 QTFTDSQITEEIQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGT-------------YKNRDE-NIIPKEQTPFP--VIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIFL----------------GRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKV 1198
            Q FT++     +  +C  F  ++K+     S EE SFPIA+S++V +     ERLLR +Y P N YC H+D+KS+  F+ A+R +V C    F N+ I    V V +   S + ADLNCM+DL +    WKY +N  G +FP+KTNAE+VK LK  KG N++E               Y+  D  ++  K +TP P  +  F G+ +++ +R+F+E +F +S  + +++++ +   PDE  ++TL          S++   D L     L                G  +N   +T  S    R++C+ G  DL+ ++ + HL A+KF        L+CLE++   K 
Sbjct:   96 QLFTEADYLR-MTADCEHFKTKRKFIQVPLSKEEASFPIAYSMVVHEKIENFERLLRAVYTPQNVYCVHMDQKSSEPFKQAVRAIVSC----FPNVFIASKLVSVVYASWSRVQADLNCMEDLLQSPVPWKYLLNTCGTDFPIKTNAEMVKALKLLKGQNSMESEVPPPHKKSRWKYHYEVTDTLHMTSKRKTPPPNNLTMFTGNAYMVASRDFIEHVFSNSKARQLIEWVKDTYSPDEHLWATLQ-------RASWMPGSDPLHRKFDLSDMRAIARLTKWYDHEGDIENGAPYTSCSGIHQRAVCVYGSGDLHWILQNHHLLANKFDPKVDDNVLQCLEEYLRHKA 431          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q8CH87|GCNT3_RAT (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Gcnt3 PE=1 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 7.590e-50
Identity = 106/348 (30.46%), Postives = 173/348 (49.71%), Query Frame = 2
Query:  251 QTFTDSQITEEIQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENI--------------IPKEQTPFP--VIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIFL----------------GRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKV 1198
            Q+FT++     +  +C  F  Q+K+     S EE +FPIA+S+++ +     ERLLR +Y P N YC H+D+KS+  F+ A+R +V C    F N+ I    V V +   S + ADLNCM+DL +    W+Y +N  G +FP+KTNAE+VK LK   G N++E       +                  KE+TP P  +  F G+ +++ +R+F+E +  +S  + +++++ +   PDE  ++TL          S++   D L     L                G  +N   +T  S    R+IC+ G  DL+ ++ + HL A+KF        L+CLE++   K 
Sbjct:   96 QSFTEADYLS-MTADCEHFKTQRKFIQVPLSKEEANFPIAYSMVIHEKIENFERLLRAVYTPQNIYCVHVDQKSSETFQQAVRAIVSC----FPNVFIANKLVSVVYASWSRVQADLNCMEDLLQSPVPWEYLLNTCGTDFPIKTNAEMVKALKLLNGQNSMESEVPPPHKTFRWKYHYEVADTLYRTSKEKTPPPNNITMFTGNAYMVASRDFIEHVLSNSKARQLIEWVKDTYSPDEHLWATLQ-------RASWMPGSDPLHPKFDLSDMRSIARLTKWQDHEGDIENGAPYTSCSGIHQRAICVYGSGDLHWILQNHHLLANKFDPKVDDNVLQCLEEYLRHKA 431          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q02742|GCNT1_HUMAN (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=GCNT1 PE=1 SV=2)

HSP 1 Score: 179.104 bits (453), Expect = 7.597e-50
Identity = 108/342 (31.58%), Postives = 168/342 (49.12%), Query Frame = 2
Query:  284 IQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG---------TYKNRDE------------NIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSF-------LGDPDELDSGI----FLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIK 1213
            +  +C+ F+ ++KY  +  S EE  FPIA+SI+V      ++RLLR IY P NFYC H+D KS   +  A+  +  C    F+N+ +      V +   S + ADLNCMKDLY    NWKY INL G +FP+KTN E+V+ LK   G NN+E           +K R E             ++P  +TP     F G  + +V+R +V ++ ++   + ++++  +   PDE  ++T+   P+  + GS        L D   +   +    F G       +        RS+CI G  DLN ++   HLFA+KF       A++CL++    K  E +K
Sbjct:   96 MTSDCSSFIKRRKYIVEPLSKEEAEFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDTKSEDSYLAAVMGIASC----FSNVFVASRLESVVYASWSRVQADLNCMKDLYAMSANWKYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPL----FSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDEYLWATIQRIPE--VPGSLPASHKYDLSDMQAVARFVKWQYFEGDVSKGAPYPPCDGVHVRSVCIFGAGDLNWMLRKHHLFANKFDVDVDLFAIQCLDEHLRHKALETLK 427          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q92180|GCNT1_BOVIN (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Bos taurus OX=9913 GN=GCNT1 PE=2 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 1.185e-49
Identity = 107/336 (31.85%), Postives = 171/336 (50.89%), Query Frame = 2
Query:  293 NCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIE--------------------GTYKNRD-ENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQF--RIAGSFLGDPDELDSGIFLGRYKN-KGQFTCGSRF-----FNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIK 1213
            +C  F+ ++KY  +  S EE  FPIA+SI+V      ++RLLR IY P NFYC H+D KS   F  A   +  C    F+N+ +      V +   S + ADLNCM+DLY+    WKY INL G +FP+KTN E+V+ LK   G NN+E                    G   N   + I P  +TP     F G  H +V+R +VE++ ++   +  +++  +   PDE  ++T+   P+    ++ S+  D  ++ +     +++  +G  + G+ +       RS+C+ G  DLN L++  HLFA+KF       A++CL++    K  E +K
Sbjct:   99 DCASFIKKRKYITEPLSKEEAGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDAKSEKSFLAAAVGIASC----FSNVFVASQLESVVYASWSRVQADLNCMQDLYQMNAGWKYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETEKMPSHKKERWKKHYEVVNGKLTNMGTDKIHPPLETPL----FSGSAHFVVSREYVEYVLQNQNIQKFMEWAKDTYSPDEYLWATIQRIPEVPGSLSLSYKYDTSDMQAIARFVKWQYFEGDVSKGAPYPPCSVHVRSVCVFGAGDLNWLLHVHHLFANKFDTDIDLFAIQCLDEHLRHKALETLK 426          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A1S3J731 (beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Lingula unguis OX=7574 GN=LOC106170773 PE=4 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 4.928e-86
Identity = 157/358 (43.85%), Postives = 214/358 (59.78%), Query Frame = 2
Query:  149 KIYMPSEFNCYEYFQHNASKELINTATLWHIPPNQTFTDSQITEEIQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENIIPKEQT-PFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLG-DPD-ELDSGIFLGRYKNKG----QFTC-GSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKV 1198
            K+ +PS  NC   F+    KE+ N  +L    P +   D  I  +   NC +F+  ++Y     S EE+ +PIA+S++VFK   QVERLLR IYRP N YCFH+DKKS   F  A+R++  C    F N+ I   R+DVQWG+ SVL ADL CM++L ++ + WKYFINLTGQEFPLKTN ELVKILK Y GAN+IEGT K R+ N      T P+ +   KG VHI+ +R FV+F+      K   ++      PDE FF+TLN+NPQ    G+F G DP+   +   F  R+KN G     + C G R   R +CI GI DL +L+     F++KFY  ++P A  C+E+ +Y++ 
Sbjct:   87 KVRVPS-INCAALFE-GIEKEVQNAKSLMKSSPKKIIPDKDILNDAS-NCDKFVRDRQYIMSTLSREEEEYPIAYSMVVFKEVEQVERLLRAIYRPQNLYCFHVDKKSPENFYIAVRQISNC----FENVFIASKRIDVQWGQYSVLEADLICMEELLKKSRKWKYFINLTGQEFPLKTNLELVKILKTYNGANDIEGTVKRRNMNRFKDLPTPPYNITPMKGSVHIVASRPFVDFVLNDPKAKEFHEWDKKAGIPDESFFTTLNHNPQLGAPGAFTGKDPETHPEKKPFNTRFKNWGDWPFDYPCHGKRV--RMVCIFGIGDLPLLMQRKEFFSNKFYLDYEPLAYDCMEELHYNRT 435          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A1S3JL02 (beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase isoform X2 OS=Lingula unguis OX=7574 GN=LOC106174181 PE=4 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 5.616e-85
Identity = 151/349 (43.27%), Postives = 210/349 (60.17%), Query Frame = 2
Query:  287 QRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYER-FKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENIIPKE-------------QTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIFLGRYK---NKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYA-RVKESFYTSQVFVKHQYV 1279
             +NCT+F+ +++Y     + EE+ FP+AFSIMV+K A QVERLLR IYRP NFYCFH+D KS+  F  A+  L  C    F+N+ +    V+V W +++VL A+L CM++L++R +K WKYFINLTGQEFPLKTN ELVKILKAY GAN++EGT K R+ +   KE               PF ++  KG VHI     FV F     I K  L++        E FF++LN+NP   + GSF G  + L++  F+ RYK   ++    CG +F  R+ICI G++ L  L     LFA+KF++ FQP  L C+E+W+Y+K     + GY+       Y S  FVK + +
Sbjct:  123 SKNCTKFVKERQYILSSLTKEEEEFPLAFSIMVYKNAEQVERLLRAIYRPQNFYCFHVDNKSSPAFLNAMTSLSSC----FDNVFVANTHVNVVWAEVTVLDAELVCMEELFKRYYKKWKYFINLTGQEFPLKTNMELVKILKAYGGANDMEGTLKRRNMDRFTKEWDGHLHLTGQTLPPAPFGIVPTKGAVHITATWGFVNFTLTDPIAKEFLKWTRKTHRACETFFTSLNHNPHLMVPGSFTGSAEALETKPFMTRYKIWVDESIPFCGGKFV-RAICIFGLEHLPRLFVRNELFANKFHQEFQPYTLDCMEEWHYNKT----RLGYSLPFNTQHYRSLPFVKDKII 462          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A2T7P154 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_12288 PE=4 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 4.467e-84
Identity = 145/339 (42.77%), Postives = 206/339 (60.77%), Query Frame = 2
Query:  260 TDSQITEEIQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRD-ENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPD-ELDSGIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVKESFYTSQVFVKH 1270
            T+  IT  + +NC  F+    +     + EE++FPIA+SI+VFK A QV +LL+ IYRP N YC H+D+K++  +   +  + +C    F+N+ +T   VDV+WG  +VL  +L CMKDL+  FK WKYFINLTGQEFPL+TN ELV+IL AY GAN++E   K  + E       TP  +I  KG VHI+VNR+FV+++  S + +  L +      PDE FF++LN+NPQ  I GS+ G P+ +  +  FL R+KN G + C    FNR ICIL   DL +L   P +FA+KFY+ +   AL CL +  Y+   +E   G      S+Y +  FVK+
Sbjct:   32 TEKDITR-LAKNCRNFVRVYGFIMNFLTEEERNFPIAYSILVFKDAHQVTQLLQAIYRPQNVYCIHVDQKADQSYRDTMAAIADC----FHNVFLTSRSVDVRWGTFTVLEPELICMKDLWH-FKKWKYFINLTGQEFPLRTNFELVRILTAYNGANDVESIVKRANKERWASAGPTPHGIIPVKGSVHIVVNRDFVDYVLHSPVAQDFLNWTRRVDVPDETFFASLNHNPQLGIRGSYKGYPETDPVTKPFLTRFKNWGDYPCAEGNFNRDICILSTGDLPLLDTRPEMFANKFYQDYSRVALECLHERLYNHTRDEF-LGMMEFNTSYYQNVSFVKN 363          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A2T7P139 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_12289 PE=4 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 2.091e-83
Identity = 151/370 (40.81%), Postives = 215/370 (58.11%), Query Frame = 2
Query:  167 EFNCYEYFQHNASKELINTATLWHIPPNQTFTDSQITEEIQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRD-ENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPD-ELDSGIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVKESFYTSQVFVKH 1270
            E +C + F     KE +  +   H       T+  IT  + +NC+ F+    +     + EE++FPIA+SI+VFK A QV +LL+ IYRP N YC H+D+K++  +   +  +V+C    F+N+ +    VDVQWG  +VL  +L CMKDL+  FK WKYFINLTGQEFPLKTN ELV+IL AY GAN++E T +  + E        P  +I  KG VHI+VNR+FV+++  S + +  L +      PDE FF++LN+NPQ  I GS+ G P+ +  +  FL R+KN  QF C      R ICIL   DL +L   P +FA+KFY+ +   AL CL +  Y+   +E   G      S+Y +  FVK+
Sbjct:    3 EVDCMKVFA--GDKEELTRSKQVHKDLPALPTEKDITR-LAKNCSNFVRVYGFIMNFLTEEERNFPIAYSILVFKDAHQVTQLLQAIYRPQNVYCIHVDQKADQSYRDTMAAIVDC----FHNVFLASRSVDVQWGTFTVLEPELICMKDLWP-FKKWKYFINLTGQEFPLKTNFELVRILTAYNGANDVESTTETANKERWASAGPAPHGIIPVKGAVHIVVNRDFVDYVLHSPVAQDFLNWTRRVDVPDETFFASLNHNPQLGIRGSYKGYPETDPVTKPFLTRFKNWRQFPCAEEMRIRQICILSTGDLPLLDKRPEMFANKFYQDYSRVALECLHQRLYNHTRDEF-LGMMEFDTSYYQNVSFVKN 363          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A2C9JUK0 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 PE=4 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 2.276e-83
Identity = 147/329 (44.68%), Postives = 204/329 (62.01%), Query Frame = 2
Query:  284 IQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDP--DELDSGI--FLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVKESFYTSQV 1258
            +  +CT F   + Y   + + EE+ FPIA+S++++K    +ERLLR IYRP N+YC H+DKKS+  F  A+  + EC    F N+ I   R+ V WG  SVL  +L CM+ L+ RF+ WKYFINLTGQEFPL+TN ELV+ILK+Y+GAN++EGT K R    +P +  P  +   KG VHI VNR+FV++I      K +L ++ N   PDE FF+TLN+NPQ  I G++ G P  D  DS I  FL R+KN G+  C   +  R ICIL   DL +L  + H+FA+KF+    P A+ CLE+  Y+   +E+     +V  S Y SQ+
Sbjct:   82 LTTDCTRFKQSRGYVTCKLTQEEEDFPIAYSLIIYKDVEMMERLLRAIYRPQNYYCIHVDKKSDQNFFIAVSAIAEC----FENVFIAPERLAVHWGTFSVLEPELVCMQQLW-RFRKWKYFINLTGQEFPLRTNWELVQILKSYRGANDLEGTIKRR----LPTD-PPHNITAIKGSVHIAVNRDFVDYILHHRTAKDLLDWVKNTSIPDETFFTTLNHNPQLGIRGTYKGVPETDNDDSMIKPFLTRFKNWGEKLCAGHWV-RGICILSTGDLPLLGRAKHMFANKFFLWEDPIAIGCLEEMIYNNTRDELSG--VKVFNSTYYSQL 397          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: ENSAMXT00000050168.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001873.1:355693:357685:-1 gene:ENSAMXG00000033034.1 transcript:ENSAMXT00000050168.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 190.66 bits (483), Expect = 3.464e-55
Identity = 115/337 (34.12%), Postives = 177/337 (52.52%), Query Frame = 2
Query:  248 NQTFTDSQITEEIQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG-------TYKNRDENII----------PKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFR--IAGSFLGDPDELDSGIFLGRYK-NKGQFTC------GSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEK 1180
            NQT    +   E+ ++C  F   +KY     S EE++FP+A+SI+V       ERLLR IY P NFYC H+DKK++     AI   V C    F+N+ I     +V +   S + AD+NCMKDLY+    WKYFINL GQ+FP+KTN E+V+ LK   G N++E         Y+ +  +I+           K+  P  +  F G  +I+V+R F+ F+ E    + ++ +  +   PDE  ++T+   P     I      D  ++++   L ++  ++G+F        G+    R+IC+ G+ DL  ++   HLFA+KF   F P A+RCLEK
Sbjct:   76 NQTKMTDEHYIELTQDCERFRVTRKYMPFTLSAEEEAFPLAYSIVVHHKVQNFERLLRSIYAPQNFYCIHVDKKASESTRAAINATVSC----FDNVFIASQLEEVVYASWSRVQADINCMKDLYQISDRWKYFINLCGQDFPMKTNLEMVRALKGLHGGNSLETETMPSNKEYRWKKRHIVKNGAIQYTNEAKKPPPSRIKMFSGGAYIVVSRAFIRFVLEDPKAQELISWSKDTYSPDEFLWATMQRIPGVPGYIRAHHKFDRSDMNTISRLIKWAGHEGEFDAVYPPCQGTHV--RAICVYGVGDLQWMLQQDHLFANKFDTDFDPIAIRCLEK 406          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: ENSAMXT00000026751.2 (glucosaminyl (N-acetyl) transferase 1 [Source:NCBI gene;Acc:103024919])

HSP 1 Score: 187.193 bits (474), Expect = 6.249e-54
Identity = 117/345 (33.91%), Postives = 178/345 (51.59%), Query Frame = 2
Query:  248 NQTFTDSQITEEIQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG-------TYKNRDENII----------PKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFR--IAGSFLGDPDELDSGIFLGRYK-NKGQFTC------GSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTE 1204
            NQT    +   E+ ++C  F   +KY     S EE++FP+A+SI+V       ERLLR IY P NFYC H+DKK++     AI   V C    F+N+ I     +V +   S + AD+NCMKDLY+    WKYFINL GQ+FP+KTN E+V+ LK   G N++E         Y+ +  +I+           K+  P  +  F G  +I+V+R F+ F+ E    + ++ +  +   PDE  ++T+   P     I      D  ++++   L ++  ++G F        G+    RSIC+ G  DL  ++   HLFA+KF   F P A+RCLEK   +K  +
Sbjct:   82 NQTKMTDEHYIELTQDCERFRVTRKYMPFTLSAEEEAFPLAYSIVVHHKVQNFERLLRSIYAPQNFYCIHVDKKASESTRAAINATVSC----FDNVFIASQLEEVVYASWSRVQADINCMKDLYQISDRWKYFINLCGQDFPMKTNLEMVRALKGLHGGNSLETETMPSNKEYRWKKRHIVKNGDIHNTNEAKKPPPSGIKMFSGGAYIVVSRVFIRFVLEDPKAQELILWSKDTYSPDEFLWATMQRIPGVPGYIRAHHKFDRTDMNTISRLIKWVYHEGDFDAVYPPCQGTHV--RSICVYGAGDLQWMLQQDHLFANKFDTDFDPIAIRCLEKHLRNKALQ 420          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: gcnt4a (glucosaminyl (N-acetyl) transferase 4 [Source:NCBI gene;Acc:103033386])

HSP 1 Score: 167.162 bits (422), Expect = 2.241e-46
Identity = 102/334 (30.54%), Postives = 168/334 (50.30%), Query Frame = 2
Query:  263 DSQITEEIQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGT-----------YKNRDENI------IP------KEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSF-LGDPDELD----SGIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEK 1180
            D +       +C  ++  + Y     ++EEK+FP+A+S++V K    VER++R IY P N YC H D+KS+  F  A++ L +C    F NI I      V++  ++ L ADLNC+ DL      WKY INL GQ+FPL++N ELV+ LK   GAN +E +           ++++ +++      +P      K   P  +  F G  + +++R+FV ++  + + K  L +  +   PDE F++TL   P   + G     +PD  D    + +    Y     +   +    RS+CI G  +L  L++  H FA+KF     P  ++CLE+
Sbjct:   91 DDESITAFTADCPRYVKARGYSDISVTDEEKNFPLAYSLVVHKNMPMVERIIRAIYAPTNIYCIHYDQKSSESFIAAVKNLAKC----FPNIFIASKLESVEYAHITRLNADLNCLSDLMSSEVKWKYAINLCGQDFPLRSNYELVEELKKLNGANMLESSRPSELKRERFVFQHKLQDVPYEYHKLPIKTTNAKSAPPHDIEMFIGSAYFVLSRDFVHYVQTAQVAKDFLDWSADTYSPDEHFWATLARVPG--VPGEIPRSEPDVTDLKSKTRLVKWEYLEGSLYPGCTGTHMRSVCIYGAAELRWLLDDGHWFANKFDPKVDPVLIKCLEE 418          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:ZFIN;Acc:ZDB-GENE-110411-253])

HSP 1 Score: 164.081 bits (414), Expect = 3.111e-45
Identity = 95/325 (29.23%), Postives = 157/325 (48.31%), Query Frame = 2
Query:  290 RNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNR--------DENI--------IPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVI--LQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDS---------GIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKW 1183
            ++C  ++ ++ +     S EE+ FPIAFS+++ +     ERLLR IY P N YC H+D KS+ +F  A++ +  CL     N+ +      V +   S + AD+NCM+DL +    W+Y +N  G +FP+KTNAE+V+ LK   G N++E    N           N+        I K   P     F G+ + +V+R FVE +F S  P+++  +++  +   PDE  ++TL   P    +    G  DE D              G  +    +   +     ++C+ G  D+  ++   HLFA+KF       A++CLE +
Sbjct:   95 KDCPAYISERGFLTTPLSIEERDFPIAFSMVIHEKIEMFERLLRAIYSPQNIYCVHVDTKSSKEFMEAVKAITSCL----PNVFVASKLESVVYASWSRVQADINCMQDLLKSSVQWRYLLNTCGADFPIKTNAEMVRTLKQLNGRNSMESEATNDYKKQRWVYQHNVTTSVIRTSIKKTDPPIKSPMFTGNAYFVVSREFVEHMFSS--PEILNFMEWEKDTYSPDEHMWATLQRMPNMPGSNPPNGKYDESDMLAIARLVKWSYLEGDLRKGAPYPPCTGAHRHAVCVYGAGDIKWIVRQKHLFANKFDPEVDDIAIKCLEAY 413          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: gcnt4b (beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4-like [Source:NCBI gene;Acc:103021884])

HSP 1 Score: 161.384 bits (407), Expect = 2.771e-44
Identity = 106/324 (32.72%), Postives = 158/324 (48.77%), Query Frame = 2
Query:  293 NCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG-------------TYKNRD----------ENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSF-LGDPDELD----SGIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEK 1180
            +C  +L  + +     S  E+ FP+A+S++V K A+ VER+L  IY P N YC H D KS+ +F  A++ L  CL     N+ I      VQ+  ++ L ADLNC+ DL E    W+Y INL GQ+FPL++N ELV+ LKA KGA+ +E              +Y  +D          +    K   P  +  F G  +  ++R FV F+  S + K  L +  +   PDE F++TL   P   + G     DPD  D    + +   +Y     +   +    RS+CI G  +L  L+N  H FA+K      P  + CLE+
Sbjct:   91 DCPRYLASRGFHSIRTSQIEREFPLAYSLVVHKEAAMVERILWAIYVPHNSYCIHYDLKSSPEFMAAMQGLALCLP----NVFIASKLERVQYASITRLRADLNCLSDLMESKVKWRYVINLCGQDFPLRSNVELVEELKALKGASMLETARPSPLKKRRFSFSYTLKDVGSQYHQHPMKTDQAKSPPPHKLEMFVGSAYFTLSREFVSFVQWSPMVKDFLSWSEDTYSPDEHFWATLIRVPG--VPGELSRSDPDVSDLASRTRLVKWQYLEGKLYPACTGVHIRSVCIYGAGELRWLLNDGHWFANKLDPRVDPVLVECLEE 408          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: gcnt4a (glucosaminyl (N-acetyl) transferase 4a [Source:NCBI gene;Acc:324510])

HSP 1 Score: 192.971 bits (489), Expect = 2.131e-57
Identity = 113/325 (34.77%), Postives = 175/325 (53.85%), Query Frame = 2
Query:  284 IQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIE----GTYKN----------RDENIIPKEQ--------TPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFL-GDPDELDSGIFLGRYKN-KGQF--TCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEK 1180
            +  +C  FL+ +KYF +  S EE+ FPIA+SI+V K A+ +ERLLR I+ P N YC H+D KS+  F++A++ L +C    F+N+ +     +V +  +S L AD+NC+ DL +    WKY INL GQ+FPL++N ELV  LK+ +G + +E      YK           R ++ +P  Q         P  +  F G  + +++R FV F   S++    L++  +   PDE F++TL  +PQ    G     D  +L S   L ++   +G+    C  R   RS+CI G  +L  L+   H FA+KF  H  P  ++CLE+
Sbjct:   37 LTEDCPVFLETRKYFSKHVSAEERDFPIAYSIVVHKNAATLERLLRAIFVPQNVYCVHVDTKSSTTFKSAVQSLAKC----FDNVFVASKLEEVHYAHISRLQADINCLADLLKSPVRWKYAINLCGQDFPLRSNRELVSELKSLQGRSMLETGKPSAYKQQRFTHKFVLERRDSSLPALQHTQTALAPAPHGLEVFVGSAYFVLSREFVRFAITSAVAADFLRWCADTYSPDEHFWATLARSPQAPGGGGGGKADVSDLQSKTRLVKWSYLEGRLYPVCSGRHV-RSVCIYGAAELGWLLRDGHWFANKFDPHVDPVVVKCLEE 356          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: gcnt4a (glucosaminyl (N-acetyl) transferase 4a [Source:NCBI gene;Acc:324510])

HSP 1 Score: 192.971 bits (489), Expect = 2.197e-57
Identity = 113/325 (34.77%), Postives = 175/325 (53.85%), Query Frame = 2
Query:  284 IQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIE----GTYKN----------RDENIIPKEQ--------TPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFL-GDPDELDSGIFLGRYKN-KGQF--TCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEK 1180
            +  +C  FL+ +KYF +  S EE+ FPIA+SI+V K A+ +ERLLR I+ P N YC H+D KS+  F++A++ L +C    F+N+ +     +V +  +S L AD+NC+ DL +    WKY INL GQ+FPL++N ELV  LK+ +G + +E      YK           R ++ +P  Q         P  +  F G  + +++R FV F   S++    L++  +   PDE F++TL  +PQ    G     D  +L S   L ++   +G+    C  R   RS+CI G  +L  L+   H FA+KF  H  P  ++CLE+
Sbjct:   36 LTEDCPVFLETRKYFSKHVSAEERDFPIAYSIVVHKNAATLERLLRAIFVPQNVYCVHVDTKSSTTFKSAVQSLAKC----FDNVFVASKLEEVHYAHISRLQADINCLADLLKSPVRWKYAINLCGQDFPLRSNRELVSELKSLQGRSMLETGKPSAYKQQRFTHKFVLERRDSSLPALQHTQTALAPAPHGLEVFVGSAYFVLSREFVRFAITSAVAADFLRWCADTYSPDEHFWATLARSPQAPGGGGGGKADVSDLQSKTRLVKWSYLEGRLYPVCSGRHV-RSVCIYGAAELGWLLRDGHWFANKFDPHVDPVVVKCLEE 355          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:ZFIN;Acc:ZDB-GENE-110411-253])

HSP 1 Score: 172.17 bits (435), Expect = 8.269e-49
Identity = 104/337 (30.86%), Postives = 166/337 (49.26%), Query Frame = 2
Query:  284 IQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIE---------GTYKNRDENI--------IPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLG----DPDELDSGIFLGRYK-NKGQFTCGSRF------FNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEI 1210
            + R+C  F   ++Y     S EE +FPIA+S++       +ERLLR IY P N YC H+D+KS   ++ A+R L  C    F N+ +   +  V +     + ADLNCM+DL    + WKYFINL G +FP+KTN E+V+ L+A  G N++E         G ++ R E +          K   P P   F G+ +I+V R FVE +      + ++++  +   PDE  ++TL   P   + GS       D +++ +   L R+   +G    G+ +        R+ICI   +DL  ++   HLF +K        A+ CLE++   K   ++
Sbjct:   96 MTRDCDAFKRDRRYVTVPLSEEEAAFPIAYSVVAHHRVDMLERLLRAIYAPQNVYCLHVDQKSPPPYQEAVRALAAC----FPNVFMASRQERVVYTSWLRVQADLNCMRDLVAAPQPWKYFINLCGLDFPIKTNLEMVRALRALNGENSMESMHTPGGKVGRWQIRHEIVNDGLRSTGEKKSPPPIPTPMFSGNAYIVVTRAFVEHVLSDPTARALMEWEKDTFSPDEHLWATLQRLPG--VPGSTPPHDKYDVEDMMAIARLVRWSYMEGDTLQGAAYPPCRGTHMRAICINSAKDLAWVLKQRHLFVNKLDSDVDELAVHCLERYLRRKALRQV 426          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:ZFIN;Acc:ZDB-GENE-110411-253])

HSP 1 Score: 167.933 bits (424), Expect = 2.635e-47
Identity = 98/339 (28.91%), Postives = 152/339 (44.84%), Query Frame = 2
Query:  284 IQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKN--WKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENI-----------------IPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDP-DELDSGIFLGRYKN----KGQFTCGSRFFN-------RSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEE 1207
            + R+C  F   ++Y     S EE++FPIA+S++       +ERLLR +Y P N YC H+D KS   +  A R L  C    F N+ +  +   V +   S + ADLNCM +L    +   W+YFINL G++FP+KTN E+V+ L+   G N++E     R +                   + K   P P   F G  +++V R FVE +      + ++++  +   PDE  ++TL   P   + GS       ++     L R       +G    G   +        R +C+ G  DL  ++   HLFA+K        A+ CLE     K   E
Sbjct:   99 MTRDCDAFRRARRYVLVPLSREEEAFPIAYSVVAHHRVDMLERLLRAVYAPQNLYCLHVDAKSPRAYLEAARALAAC----FPNVFVAAHLERVVYASWSRVQADLNCMSELVAMAERVPWRYFINLCGRDFPIKTNLEMVRALRTLNGRNSLETVRMPRGKRARWTLSYKVAGNEIRSTGLTKRPPPIPTPMFAGSAYVVVTRAFVEHVLSDPAARALIEWAGDTYSPDEHLWATLQRMPG--VPGSTPAHRIHDVTDAAALARLVKWSAFEGDVAGGGAAYPPCRGTHVRDVCVYGAGDLAWVLRQHHLFANKVDTAVDHVAVHCLEHHLRKKALAE 431          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: GCNT2 (glucosaminyl (N-acetyl) transferase 2 (I blood group) [Source:HGNC Symbol;Acc:HGNC:4204])

HSP 1 Score: 161.384 bits (407), Expect = 3.531e-45
Identity = 108/341 (31.67%), Postives = 159/341 (46.63%), Query Frame = 2
Query:  278 EEIQR---------NCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILK-AYKGANNIEGTY------------------KNRDENI---IPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEE 1207
            +EIQR         NC+ F+++Q Y  +  S EE+ FP+A+ I V K       L R IY P N YC H+D KS+  F+ +++ L  C    F+N+ +      V +   S L AD+NCM+DL  R   WKY +NL GQ+FPL+TN E+V+ILK  ++G N   G +                  K++ + I   + K   P  +    G  +  V R FV+++ +    + +L++      PDE +F TLN  P     G+      E ++     R   K    C   +  R IC+ G  DL  L     LFA+KF     P  L CLE W   +   E
Sbjct:   56 KEIQRPTMAIEENVNCSAFIEKQSYITEALSKEEQDFPLAYIITVHKDFETFSILFRNIYMPQNIYCIHVDVKSSESFKKSMQRLAGC----FDNVFLASRSETVVYAGFSRLKADINCMRDLATRPTPWKYVLNLCGQDFPLRTNQEIVRILKNKWRGKNITPGIFQPPHMKWRTQYVYKEVVDKDKKQMIRTNVAKGPPPHGINLCFGTAYYAVTREFVQYVLDDKKAQDLLEWSQETFSPDEHYFVTLNSLPD--APGANTVPSWEGNTRAVKWRDGEKTHKGCKGHYV-RDICVYGEGDLEWLTKRSDLFANKFEMQRYPLVLECLEHWARQRTLNE 389          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Nematostella
Match: EDO39617 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9I5])

HSP 1 Score: 172.555 bits (436), Expect = 2.145e-50
Identity = 103/286 (36.01%), Postives = 157/286 (54.90%), Query Frame = 2
Query:  323 YFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGT-----------YKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLI---NSPHLFAHKF 1138
            Y    P+  E  FPIA+ I+++K     ERLL+ +Y P N+YC HIDKK+N+ F  A + +V CL     N+ I + RV+V+WG++S++ A+L+CM +L + FK WKY+INL GQ+FPL  N E+V++LK+  G NNIE             +    + ++ K   P  +I  KG VH I+ R F EF+    + + +L++L +    DE FF+TL Y+      G   G   E      + R K      C  R+  R+IC + I+DL  ++   N+  LF +K 
Sbjct:    7 YPHPTPTRTELDFPIAYGILIYKGLPLFERLLQALYMPQNYYCIHIDKKTNSYFVDAAQRMVACL----PNVFIAKTRVNVKWGEISLVKAELSCMTEL-QTFK-WKYYINLVGQDFPLYNNMEIVRVLKSLHGLNNIESIEMPAYNVHRVEFVRHGQKLLRKSPPPHGLIIRKGSVHGILTRKFTEFVLRDKVARDLLKWLEDVFAADEIFFATLQYDQA--TPGGIHGQQPEC-----IARVKRWRPGYCAGRYV-RNICWIDIRDLTWVLSEGNNRKLFVNKI 278          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Nematostella
Match: EDO37446 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFS7])

HSP 1 Score: 162.54 bits (410), Expect = 2.313e-46
Identity = 94/294 (31.97%), Postives = 153/294 (52.04%), Query Frame = 2
Query:  350 EKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG-----TYKNRDENI---------IPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLI---NSPHLFAHKFYEHFQPGALRCLEK 1180
            E+ FP+AF IM++      ERLL+ IY P N YC HID+K+   F  A+++++ CL     N+ I    V V WG+ S++ A +NC+++L +    WKY++++ GQ+FPL TN E+V+ +K     NN+E      + ++R E +         I K   PF +   KG++H ++ R FVEF+ ES I    + + N+   PDE FF+++  +P     G  +GD       +    + ++    C  R   R +C + I+DL  ++   N   LF HK    +    L CL +
Sbjct:    2 ERDFPLAFGIMIYNGLPLFERLLQEIYMPHNVYCIHIDRKTRQSFHKAVKQMISCLP----NVFIASKLVKVYWGEFSIVQAKMNCLRNLLKSPVKWKYYLHMIGQDFPLYTNHEMVRAIKTLNYTNNMESIKVPISNRDRTEYVYIGSRTRTKILKPPPPFNITLRKGNIHAMLTRGFVEFLLESEIANAFIDWCNDTSVPDETFFASMQNHPG--APGGVVGDQPPYIFKLIRWYWFDR----CYGRII-RQVCWIDIKDLRSVLSQFNLSFLFVHKIPFDYDIELLDCLSQ 284          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Nematostella
Match: EDO36835 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHI4])

HSP 1 Score: 64.6994 bits (156), Expect = 4.060e-11
Identity = 53/212 (25.00%), Postives = 94/212 (44.34%), Query Frame = 2
Query:  365 IAFSIMVFKTA-SQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFK-NWKYFINLTGQEFPLKTNAELVKILKAYKGAN----------------NIEGTYKNRDENI--IPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKV--ILQFLNNQQFPDEQFFST 934
            IA+ + +   A  Q+ RL ++IY   +++ FHID +S+      +R  V  +   F N  +    +   WG  ++L   L  M+DL  R +  W +FINL+G +FP+K N  L   L++++  N                 ++ T+   DE++  +   + P  +    G   I +NR + +++  S    V  +         P E FF T
Sbjct:   80 IAYVLSLHGRALRQIRRLFKVIYHTHHYFYFHIDTRSDY-----LRREVSNMIKDFPNAALAPWSMATIWGGATLLQMLLKSMEDLIARKEWKWDFFINLSGNDFPIKVNTVLSSFLRSHRDVNFLKPHGRDIARFIKKQGLDRTFLQCDEHMWRLGDRKLPADLDIDGGSDWIALNRKYCDYLVTSRDELVTGLKHMYRYTLLPAESFFHT 286          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:NCBI gene;Acc:101155272])

HSP 1 Score: 174.481 bits (441), Expect = 4.339e-49
Identity = 103/322 (31.99%), Postives = 162/322 (50.31%), Query Frame = 2
Query:  290 RNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKN-------------RDENII----PKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIFLGRYK---NKGQFTCGSRF------FNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLE 1177
            ++C  F+ ++ +  +  S EEK FPIA+S+++ +     ERLLR IY P N YC H+D+KS+ +++TA++ +V C    F NI I      V +   S + ADLNCMKDL      WKY +N  G +FP+KTN E+V  LK   G N++E    N              D ++I     K   P     + G+ + IV+R FV+ + +    + ++ +  +   PDE  ++TL   PQ   +  F    D  D   F    K   + G    G+ +      + R++C+ G+ DL  L+ + HLFA+KF       A+RC+E
Sbjct:   88 KDCPAFIAKRGFITEPLSEEEKKFPIAYSMVIHEKIEMFERLLRAIYAPQNVYCVHVDQKSSPEYQTAVKRIVSC----FPNIFIASKLERVVYASWSRVQADLNCMKDLLNSDVPWKYLLNTCGTDFPIKTNREMVSALKLLNGRNSMETEVTNDYKKGRWEYHHNVTDTSVIRTGVKKSPPPISSPMYSGNAYFIVSRAFVKHLMKDEEAQRLIDWEKDTYSPDEHLWATLQRMPQVPGSLPFNSKYDTSDMLAFARAVKWVYHTGDVRKGAPYPPCTGTYRRAVCVYGVGDLLWLLQTHHLFANKFDPEVDDIAIRCME 405          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: ENSORLT00000007218.2 (glucosaminyl (N-acetyl) transferase 1 [Source:NCBI gene;Acc:101157299])

HSP 1 Score: 172.555 bits (436), Expect = 2.045e-48
Identity = 120/390 (30.77%), Postives = 184/390 (47.18%), Query Frame = 2
Query:  164 SEFNCYEYFQHNASKELINTATLWHIPPNQTFTDS-QITEEIQRNCTE----FLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENIIP-----------------------KEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIFLGRYKNKGQFTCGSRF------------FNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIK 1213
            SE NC    +    +E ++ A L  +   + F    +I++E   N TE    F+  +KY     S EE+ FP+A+S++V       ERLLR IY P NFYC H+DKK+      AI  +  C    F N+ +    VDV +     + ADLNCM DLY   + WKYF+NL GQ+FPLKTN E+V+ILK   G N++E       EN+ P                       K  +PF +    G+ +I+ +R ++  +      + +++++ +   PDE  ++T+   P   + GS   +     S I       K Q+  GS+               R+IC+ G  DL  L+ + H FA+KF     P A+ CLE++   K   E++
Sbjct:   54 SECNCSSILE--GDQEALDQAKLLTL--TRAFQKRIKISDEYYINATEDCRLFIKTRKYITFPLSKEEEDFPLAYSMIVHHKVQNFERLLRAIYAPQNFYCVHVDKKAEPSVFAAILAISSC----FPNVFLVSQSVDVVYAGWPRVQADLNCMADLYNTSRRWKYFLNLCGQDFPLKTNLEMVRILKTLNGGNSMES------ENMPPEKKWRVTNAHQIVDGKIQAKGEAKSPSPFNLPIMSGNAYIVASRGYIHSVLHDKRIQALIEWMKDTYSPDEAIWATIQRIPG--VPGSTRPNRKYDVSDINALARLVKWQWHEGSQDSLDALYPVCHGNHVRAICVYGAGDLQWLLENHHFFANKFDTDTDPIAIYCLERYLRKKALAELE 427          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: gcnt7 (beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 7-like [Source:NCBI gene;Acc:101157298])

HSP 1 Score: 167.933 bits (424), Expect = 1.346e-46
Identity = 130/432 (30.09%), Postives = 211/432 (48.84%), Query Frame = 2
Query:   80 FVLCLFMCLLIY-YLFSTNRINFGKIYMPSEFNCYEYFQHNASKELI---NTATLWHIPPNQTFTDSQITEEIQRN---CTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKIL--KAYKGANNIEGT-----YKNRDE---------NIIPKEQTPFPV-----IWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNY---NPQFRIAGSFLGDPDELDSGIFLGRYKNK-GQFTCGSR-FFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIK-----SGYARVKESFYTSQVF 1261
            F+LCL + ++I  +++   RI     ++ S  +C  +   N  + ++    TA  W+        D Q+   I ++   C E +    +  +  S EE+ +P+AF + + K      R LR IY P N YC HID K+  +++  +R LV C    F NI ++     V +G  S L ADLNCMKDL      WK  +NL GQ+FP+K+N ELV+ +  K ++  N   G       ++R E         ++I K +   P      I+F G  +  + R FV+F+ +S I   +L++  +   PDE ++ TLN+    P  R+ G + GD       I   ++K++ G    G +  + R IC+ G+ D+  +IN+ ++FA+KF  +  P AL CLE+W+  KV  + K     S    + E   TS  F
Sbjct:   11 FLLCLGISIIIVSFIYFKTRIPTDLKHLQSS-DCRNF--SNECRPILPGLETAAQWY------RRDCQVVNHILKDNQPCVELIRDLHFITRPLSQEEEDYPLAFIMTIHKDLEMFVRTLRAIYMPQNVYCIHIDAKAPLEYKKVVRGLVGC----FENIFLSSQSETVTYGGYSRLQADLNCMKDLIRSNVGWKKVVNLCGQDFPIKSNLELVQYMQSKEWRDKNLTPGVKQPAHIRSRTEFQHQEIVGSHVIQKGEKKEPPPDNLQIYF-GTAYYALTRAFVDFVLKSPIALNLLKWSKDAYSPDEHYWVTLNHLKEAPGSRVDGGWEGD-------IRAIKWKDQEGTNHQGCKGHYVRDICVYGMGDIEWIINNNNMFANKFESNAYPEALDCLEQWHRSKVLNQAKIPVQPSWVLAITEKLSTSDDF 421          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: si:dkeyp-87d8.8 (glucosaminyl (N-acetyl) transferase 4 [Source:NCBI gene;Acc:101166645])

HSP 1 Score: 162.155 bits (409), Expect = 1.706e-44
Identity = 117/362 (32.32%), Postives = 171/362 (47.24%), Query Frame = 2
Query:  260 TDSQITEEIQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENI--------------------IP------KEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGD-PDELD----SGIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVKESFYTS 1252
            TD  + E    NC  F+  + Y     S++EK FP+A+S++V K A  VERLLR  Y P N YC H D+KS  +F  A+  L  CL     N+ I   R  V +  +S L ADLNC+ DL E    WKY INL GQ+FPLK+N ELV  L+   G+N +E +   R  NI                    +P      K   P  +  F G+ + +++R F+  +  S I      +  +   PDE F++TL   P F   G    + PD  D    + +    Y     +   +    RS+CI G  +L  L+N  H FA+KF     P  ++CLE    +++ E+ +S + R   + + S
Sbjct:   85 TDESLAE-FTENCPSFIKIRGYDDVCFSDQEKDFPLAYSLVVHKNAWMVERLLRATYSPVNVYCIHYDQKSTPQFTAAMEGLARCLP----NVFIASKRESVFYASISRLQADLNCLHDLVESEVKWKYVINLCGQDFPLKSNMELVSELRKLNGSNMLETS---RPSNIKKDRFSFHHELKDASFEYQKLPVRTDQAKSPPPHGIEMFIGNAYFVLSREFILHMTSSVIAMDFFDWSKDTYSPDEHFWATLVRVPGF--PGEVAREKPDITDLMSKTRLVKWSYLEGSLYPLCTGEHVRSVCIYGCGELRWLLNYGHWFANKFEPKVDPVLIQCLE----ERLEEKQRSLFTRTSLTCHKS 432          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: xylt1 (xylosyltransferase 1 [Source:NCBI gene;Acc:100049390])

HSP 1 Score: 82.0333 bits (201), Expect = 4.819e-16
Identity = 68/252 (26.98%), Postives = 116/252 (46.03%), Query Frame = 2
Query:  272 ITEEIQRNCTEFLDQQKYFFQEPSNEEKSFP-----IAFSIMVFKTAS-QVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYE-RFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENIIPKEQTPFPVIWFKGDVHI---------------------IVNRNFVEFIFES--SIPKVILQFLNNQQFPDEQFFSTL 937
            + E++ R C     +     Q   +  +SFP     IAF +++   AS Q +RL + IY   +FY  H+D++SN      +   V+ +  K+ N+ +T  R+   WG  S+L   L  M DL   R  +W +FINL+  ++P++TN +LV  L  Y+  N I+     RD     ++Q     ++F+ D H+                     ++NR FV+++  S   +   + +F      P E FF T+
Sbjct:  271 MPEKVTRYCP-LEGKANVNIQWDEHSAESFPSNPVRIAFVLVIHGRASRQFQRLFKAIYHTSHFYYIHVDQRSNY-----LHRQVQIMAMKYPNVRVTPWRMATIWGGASLLTMYLRSMADLLAMRDWSWDFFINLSAADYPIRTNNQLVAFLSKYRDMNFIKS--HGRDNARFIRKQG-LDRLFFECDTHMWRLGDRKIPEGISVDGGSDWFLLNRMFVDYVINSKDDLVTSMKRFYAYTLLPAESFFHTV 513          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000043063.1 (SMESG000043063.1)

HSP 1 Score: 604.749 bits (1558), Expect = 0.000e+0
Identity = 292/373 (78.28%), Postives = 325/373 (87.13%), Query Frame = 2
Query:  176 CYEYFQHNASKELINTATLWHIPPNQTFTDSQITEEIQRNCTEFLDQQKYFFQ-EPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVKESFYTSQVFVKHQYVRPTL 1291
            C  +F+       +     W   P    +DS++ ++I ++CT+FL  QKYF   + + +E++F IA+SI+ F++ASQ+ERLLR IYRPWN+YC HID KS+  FE A+ ELV+CL+SK+ NI+ +ENRV V+   MSVL ADLNCMK+LY +F NWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGI+LGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVKESFYTSQVFVKHQYVRPTL
Sbjct:   37 CENFFKQYIKSPEMEFGETWK--PKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIYLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVKESFYTSQVFVKHQYVRPTL 407          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000008883.1 (SMESG000008883.1)

HSP 1 Score: 475.707 bits (1223), Expect = 3.707e-166
Identity = 230/415 (55.42%), Postives = 295/415 (71.08%), Query Frame = 2
Query:   53 VRYSKAIVIFVLCLFMCLLIYY----LFSTNRI--NFGKIYM-PSEFNCYEYFQHNASKELINTATLWHIPPNQTFTDSQITEEIQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVKESFYTSQVFVKHQY 1276
            + + K  + F   L +C+++ Y    L   N+I  +F  + +  SE +CYE  + N   + +  A  W +P N T TDSQ+ + I  +C  FL  + Y    PS EEK+FP++FSI+ FK++SQ+ERLLR IYRPWN+YC H+D KS+ +F TAI  LV CLNSK+NNIV T+NRVDV+WGKMSVL ADLNCMK+LYE++K+WKYFINLTGQEFPLKTNAELVKIL AYKGANN+EG YK R+E  IP  + PFPV+WFKG VHI VNR+FV FIFES   K +L  + +Q  PDE FFSTLNYNPQ RI GS++G+PDE+ S  F+ RYKN GQ+ C S    R ICI G  DL  L+ +P+LFA+KF+E FQP  LRCLE+W +DKV +E ++G   +   FY+S  FVK+QY
Sbjct:    3 ISFRKFYLFFFTLLAICIIVGYFRSVLSPANQIVQSFKNLSIQSSEPDCYELLKPNVENKSLQDAEKWVVPLNDTLTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKNRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKRNEERIPHIKMPFPVVWFKGSVHITVNRDFVAFIFESPKSKTLLNIVKSQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSEYFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEAQTGTVEIDSEFYSSLPFVKYQY 417          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000051787.1 (SMESG000051787.1)

HSP 1 Score: 474.552 bits (1220), Expect = 1.351e-165
Identity = 231/400 (57.75%), Postives = 292/400 (73.00%), Query Frame = 2
Query:  116 YLFSTNRINFGKIYM-------PSEFNCYEYFQHNASKELINTATLWHIPPNQTFTDSQITEEIQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDS-----GIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVKESFYTSQVFVKHQYV 1279
            Y +S N +N  K  +        +E NC E F+ + SK +IN++  W   PN++FTD Q+ + I ++C+ F+  +KY  +E S EEK F IAFSI+V+K ASQVERLLR IYRPWN+YC H+D KS  +F  AI +L ECLNSK NN++ T+NRVDVQWGKMSVL ADLNCMK+LY+R+KNWKYFINLTGQEFPLKTNAELVKILKA+KGAN++E  YK R +N IP  + PFP+IW+ G VHIIVN +FV FIFES + KV+L  LNN   PDE FFSTLNYNPQ RI+GS++G+PDE+ S     G    RYKN GQ+ C S+   R ICILG+ DL  ++N+P+LFA+KFYE FQP  LRCLE+W YDKV +E + G A + +SFY    FVK +Y+
Sbjct:   23 YFYSKNELNISKNLIFANLNIALTEPNCNELFRTDISKSVINSSINWKWFPNESFTDYQMYQVINKSCSNFIMNKKYLLKELSKEEKDFRIAFSIVVYKNASQVERLLRTIYRPWNYYCIHVDTKSKPEFVKAIGKLTECLNSKHNNVINTDNRVDVQWGKMSVLTADLNCMKELYQRYKNWKYFINLTGQEFPLKTNAELVKILKAFKGANHVEAYYKRRFDNRIPTVKMPFPIIWYTGSVHIIVNLDFVSFIFESPVSKVLLDSLNNHFIPDETFFSTLNYNPQLRISGSYVGNPDEIQSQNDSLGYMKTRYKNWGQYPCESKKIVRDICILGVGDLPRIVNAPNLFANKFYEEFQPATLRCLERWIYDKVDKEFRKGTAAIDDSFYKLLPFVKFRYI 422          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000051787.1 (SMESG000051787.1)

HSP 1 Score: 474.552 bits (1220), Expect = 1.353e-165
Identity = 231/400 (57.75%), Postives = 292/400 (73.00%), Query Frame = 2
Query:  116 YLFSTNRINFGKIYM-------PSEFNCYEYFQHNASKELINTATLWHIPPNQTFTDSQITEEIQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDS-----GIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVKESFYTSQVFVKHQYV 1279
            Y +S N +N  K  +        +E NC E F+ + SK +IN++  W   PN++FTD Q+ + I ++C+ F+  +KY  +E S EEK F IAFSI+V+K ASQVERLLR IYRPWN+YC H+D KS  +F  AI +L ECLNSK NN++ T+NRVDVQWGKMSVL ADLNCMK+LY+R+KNWKYFINLTGQEFPLKTNAELVKILKA+KGAN++E  YK R +N IP  + PFP+IW+ G VHIIVN +FV FIFES + KV+L  LNN   PDE FFSTLNYNPQ RI+GS++G+PDE+ S     G    RYKN GQ+ C S+   R ICILG+ DL  ++N+P+LFA+KFYE FQP  LRCLE+W YDKV +E + G A + +SFY    FVK +Y+
Sbjct:   24 YFYSKNELNISKNLIFANLNIALTEPNCNELFRTDISKSVINSSINWKWFPNESFTDYQMYQVINKSCSNFIMNKKYLLKELSKEEKDFRIAFSIVVYKNASQVERLLRTIYRPWNYYCIHVDTKSKPEFVKAIGKLTECLNSKHNNVINTDNRVDVQWGKMSVLTADLNCMKELYQRYKNWKYFINLTGQEFPLKTNAELVKILKAFKGANHVEAYYKRRFDNRIPTVKMPFPIIWYTGSVHIIVNLDFVSFIFESPVSKVLLDSLNNHFIPDETFFSTLNYNPQLRISGSYVGNPDEIQSQNDSLGYMKTRYKNWGQYPCESKKIVRDICILGVGDLPRIVNAPNLFANKFYEEFQPATLRCLERWIYDKVDKEFRKGTAAIDDSFYKLLPFVKFRYI 423          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000051810.1 (SMESG000051810.1)

HSP 1 Score: 471.47 bits (1212), Expect = 2.109e-164
Identity = 230/400 (57.50%), Postives = 291/400 (72.75%), Query Frame = 2
Query:  116 YLFSTNRINFGKIYM-------PSEFNCYEYFQHNASKELINTATLWHIPPNQTFTDSQITEEIQRNCTEFLDQQKYFFQEPSNEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETAIRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDS-----GIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVKESFYTSQVFVKHQYV 1279
            Y +S N +N  K  +        +E NC E F+ + SK +IN++  W   PN++FTD Q+ + I ++C+ F+  +KY  +E S EEK F IAFSI+V+K ASQVERLLR IYRPWN+YC H+D KS  +F  AI +L ECLNSK NN++ T+NRVDVQWGKMSVL ADLNCMK+LY+R+KNWKYFINLTGQEFPLKTNAELVKILKA+KGAN++E  YK R +N IP  + PFP+IW+ G VHIIVN +FV FIFES + KV+L  LNN   PDE FFSTLNYNPQ RI+GS++G+PDE+ S     G    RYKN GQ+ C S+     ICILG+ DL  ++N+P+LFA+KFYE FQP  LRCLE+W YDKV +E + G A + +SFY    FVK +Y+
Sbjct:   23 YFYSKNELNISKNLIFANLNIALTEPNCNELFRTDISKSVINSSINWKWFPNESFTDYQMYQVINKSCSNFIMNKKYLLKELSKEEKDFRIAFSIVVYKNASQVERLLRTIYRPWNYYCIHVDTKSKPEFVKAIGKLTECLNSKHNNVINTDNRVDVQWGKMSVLTADLNCMKELYQRYKNWKYFINLTGQEFPLKTNAELVKILKAFKGANHVEAYYKRRFDNRIPTVKMPFPIIWYTGSVHIIVNLDFVSFIFESPVSKVLLDSLNNHFIPDETFFSTLNYNPQLRISGSYVGNPDEIQSQNDSLGYMKTRYKNWGQYPCESKKIVPDICILGVGDLPRIVNAPNLFANKFYEEFQPATLRCLERWIYDKVDKEFRKGTAAIDDSFYKLLPFVKFRYI 422          
The following BLAST results are available for this feature:
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GCNT11.582e-5031.58glucosaminyl (N-acetyl) transferase 1 [Source:HGNC... [more]
GCNT11.582e-5031.58glucosaminyl (N-acetyl) transferase 1 [Source:HGNC... [more]
GCNT11.582e-5031.58glucosaminyl (N-acetyl) transferase 1 [Source:HGNC... [more]
GCNT35.014e-4828.90glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
GCNT35.014e-4828.90glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gly-173.459e-4231.23GLYcosylation related [Source:UniProtKB/TrEMBL;Ac... [more]
gly-162.927e-3732.44GLY-16; GLYcosylation related [Source:UniProtKB/T... [more]
gly-183.599e-3531.42GLYcosylation related [Source:UniProtKB/TrEMBL;Ac... [more]
gly-14.548e-3529.10GLY-1; GLYcosylation related [Source:UniProtKB/Tr... [more]
gly-152.144e-3428.20GLYcosylation related [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
oxt3.454e-1929.65gene:FBgn0015360 transcript:FBtr0072904[more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkeyp-87d8.88.231e-4833.24si:dkeyp-87d8.8 [Source:ZFIN;Acc:ZDB-GENE-041111-1... [more]
gcnt4a1.108e-4732.72glucosaminyl (N-acetyl) transferase 4a [Source:NCB... [more]
gcnt4a1.376e-4732.72glucosaminyl (N-acetyl) transferase 4a [Source:NCB... [more]
gcnt4b9.619e-4731.33glucosaminyl (N-acetyl) transferase 4b [Source:ZFI... [more]
si:dkeyp-87d8.86.998e-4632.76si:dkeyp-87d8.8 [Source:ZFIN;Acc:ZDB-GENE-041111-1... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc24a42.713e-5130.89solute carrier family 24 member 4 [Source:Xenbase;... [more]
ccdc771.223e-4931.76coiled-coil domain containing 77 [Source:Xenbase;A... [more]
cnksr22.360e-4932.33connector enhancer of kinase suppressor of Ras 2 [... [more]
gcnt2.25.915e-4934.59glucosaminyl (N-acetyl) transferase 2 (I blood gro... [more]
adsl2.171e-4730.98adenylosuccinate lyase [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gcnt11.340e-5332.25glucosaminyl (N-acetyl) transferase 1, core 2 [Sou... [more]
Gcnt11.340e-5332.25glucosaminyl (N-acetyl) transferase 1, core 2 [Sou... [more]
Gcnt11.340e-5332.25glucosaminyl (N-acetyl) transferase 1, core 2 [Sou... [more]
Gcnt11.340e-5332.25glucosaminyl (N-acetyl) transferase 1, core 2 [Sou... [more]
Gcnt33.252e-5231.61glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q09324|GCNT1_MOUSE9.375e-5332.25Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
sp|Q5JCT0|GCNT3_MOUSE2.274e-5131.61Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
sp|Q8CH87|GCNT3_RAT7.590e-5030.46Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
sp|Q02742|GCNT1_HUMAN7.597e-5031.58Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
sp|Q92180|GCNT1_BOVIN1.185e-4931.85Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3J7314.928e-8643.85beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
A0A1S3JL025.616e-8543.27beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
A0A2T7P1544.467e-8442.77Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A2T7P1392.091e-8340.81Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A2C9JUK02.276e-8344.68Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000050168.13.464e-5534.12pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000026751.26.249e-5433.91glucosaminyl (N-acetyl) transferase 1 [Source:NCBI... [more]
gcnt4a2.241e-4630.54glucosaminyl (N-acetyl) transferase 4 [Source:NCBI... [more]
gcnt33.111e-4529.23glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
gcnt4b2.771e-4432.72beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gcnt4a2.131e-5734.77glucosaminyl (N-acetyl) transferase 4a [Source:NCB... [more]
gcnt4a2.197e-5734.77glucosaminyl (N-acetyl) transferase 4a [Source:NCB... [more]
gcnt38.269e-4930.86glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
gcnt32.635e-4728.91glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
GCNT23.531e-4531.67glucosaminyl (N-acetyl) transferase 2 (I blood gro... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO396172.145e-5036.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374462.313e-4631.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368354.060e-1125.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gcnt34.339e-4931.99glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
ENSORLT00000007218.22.045e-4830.77glucosaminyl (N-acetyl) transferase 1 [Source:NCBI... [more]
gcnt71.346e-4630.09beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
si:dkeyp-87d8.81.706e-4432.32glucosaminyl (N-acetyl) transferase 4 [Source:NCBI... [more]
xylt14.819e-1626.98xylosyltransferase 1 [Source:NCBI gene;Acc:1000493... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043063.10.000e+078.28SMESG000043063.1[more]
SMESG000008883.13.707e-16655.42SMESG000008883.1[more]
SMESG000051787.11.351e-16557.75SMESG000051787.1[more]
SMESG000051787.11.353e-16557.75SMESG000051787.1[more]
SMESG000051810.12.109e-16457.50SMESG000051810.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020563 ID=SMED30020563|Name=beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1429bp
GTCATTTGTTTTTATTTCTTTTTAAAATATTTTATTTATCGAAATGAAAA
TAGTAAGATATTCAAAAGCAATTGTAATATTTGTATTATGCCTATTTATG
TGCCTTCTTATATACTATTTGTTTTCAACTAATCGAATTAACTTCGGAAA
AATTTATATGCCATCAGAATTTAATTGTTATGAATATTTTCAACACAATG
CCAGTAAAGAATTAATAAATACAGCCACTTTATGGCATATTCCTCCTAAT
CAGACCTTCACTGATTCTCAAATTACTGAAGAAATTCAAAGGAATTGCAC
TGAATTTTTAGATCAGCAAAAATATTTTTTTCAAGAACCGAGTAACGAAG
AAAAAAGCTTTCCAATCGCTTTTAGTATTATGGTTTTTAAAACTGCCTCT
CAAGTCGAAAGATTATTGAGAATGATTTATCGTCCTTGGAATTTTTATTG
TTTCCATATCGATAAAAAATCTAATGCAAAATTCGAAACTGCTATTCGAG
AATTGGTGGAGTGTCTCAATTCTAAATTTAATAATATAGTTATTACAGAA
AATCGTGTCGATGTGCAATGGGGCAAAATGTCGGTTTTAATTGCTGACTT
AAACTGTATGAAAGATCTTTATGAAAGATTTAAAAATTGGAAATATTTCA
TTAATTTAACCGGACAAGAATTTCCACTGAAAACAAATGCTGAGTTAGTA
AAGATTCTCAAAGCTTACAAAGGAGCCAACAATATAGAGGGAACATATAA
AAATAGGGACGAAAATATAATTCCTAAAGAACAGACGCCGTTTCCAGTCA
TCTGGTTTAAAGGAGATGTTCATATTATAGTGAATCGAAATTTCGTAGAA
TTCATTTTTGAATCTTCAATACCAAAAGTTATCCTACAGTTTTTAAATAA
TCAACAATTTCCGGATGAACAATTCTTTTCAACTCTAAACTACAATCCAC
AGTTCAGAATTGCGGGCTCCTTTCTAGGAGATCCTGATGAATTGGATTCG
GGAATTTTCCTGGGAAGGTATAAAAACAAAGGTCAATTTACGTGTGGAAG
TCGATTTTTTAACCGAAGTATTTGTATATTGGGAATTCAAGATTTGAATA
TGTTAATCAACTCTCCGCATTTATTTGCACATAAATTCTATGAACACTTT
CAACCGGGAGCATTGCGCTGTCTTGAAAAGTGGTATTATGATAAAGTGAC
GGAAGAAATCAAATCGGGCTATGCAAGAGTTAAAGAGAGCTTTTACACTT
CACAAGTATTCGTTAAACATCAATATGTTCGACCAACTTTATGACAAAAT
TGAAAAAGTTCTCGTAGATTAGAAGAAAATTAATGTTTATTTTTCAAGGG
TGACAAATGTTTTATTGCGTTTTCTGCTTAGTAATAAATTGATTTTATTT
TATTTCAATTAATTAATTACTTATTGACA
back to top

protein sequence of SMED30020563-orf-1

>SMED30020563-orf-1 ID=SMED30020563-orf-1|Name=SMED30020563-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=417bp
MKIVRYSKAIVIFVLCLFMCLLIYYLFSTNRINFGKIYMPSEFNCYEYFQ
HNASKELINTATLWHIPPNQTFTDSQITEEIQRNCTEFLDQQKYFFQEPS
NEEKSFPIAFSIMVFKTASQVERLLRMIYRPWNFYCFHIDKKSNAKFETA
IRELVECLNSKFNNIVITENRVDVQWGKMSVLIADLNCMKDLYERFKNWK
YFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENIIPKEQTPF
PVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNY
NPQFRIAGSFLGDPDELDSGIFLGRYKNKGQFTCGSRFFNRSICILGIQD
LNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVKESF
YTSQVFVKHQYVRPTL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
Vocabulary: INTERPRO
TermDefinition
IPR003406Glyco_trans_14
Vocabulary: molecular function
TermDefinition
GO:0008375acetylglucosaminyltransferase activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003406Glycosyl transferase, family 14PFAMPF02485Branchcoord: 108..304
e-value: 1.6E-36
score: 126.1
NoneNo IPR availablePANTHERPTHR19297GLYCOSYLTRANSFERASE 14 FAMILY MEMBERcoord: 37..390
NoneNo IPR availableTMHMMTMhelixcoord: 7..29