Ss-alanyl conjugating enzyme

Overview
NameSs-alanyl conjugating enzyme
Smed IDSMED30020538
Length (bp)2768
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ss-alanyl conjugating enzyme (SMED30020538) t-SNE clustered cells

Violin plots show distribution of expression levels for Ss-alanyl conjugating enzyme (SMED30020538) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ss-alanyl conjugating enzyme (SMED30020538) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ss-alanyl conjugating enzyme (SMED30020538) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020538

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30020538h1SMcG0022351 Contig50528uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020538h1SMcG0022351 Contig50528newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020538h1SMcG0022355 Contig50528uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020538h1SMcG0022355 Contig50528newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30020538h1SMcG0022351 dd_Smed_v4_17289_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020538h1SMcG0022353 Contig50528uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020538h1SMcG0022353 Contig50528newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
testisSMED30020538h1SMcG0022351 GDAG01033469.1SmedSxl_ww_GDAG01PMID:279364
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Human
Match: AASDH (aminoadipate-semialdehyde dehydrogenase [Source:HGNC Symbol;Acc:HGNC:23993])

HSP 1 Score: 69.707 bits (169), Expect = 2.127e-11
Identity = 101/477 (21.17%), Postives = 190/477 (39.83%), Query Frame = 1
Query:  259 CLNDCRKDNPNHIAAIHNDSFLTYSMLNTKANIVAKNLIRSCNLEIPMNECLVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIII----------------------------------HKKCSDIDLLSNDNSIQTVLMDTLLDESKIIDSFNLLPREYNPPQSREKTVVLLHTSGSSGTPKTIKIT------SAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVI-QKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNK--------FLSVGTPISNNQVFFESNSDNEGEVIVIGKN--------VSPTCGLAFQTGDVGFIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNC 1518
            C ++C    P          + TY  +   A+ ++  L+  C+ +  + E  +G+    G +    I+  L++   +VP+  +    L    + KCNL  I+                                  H K ++++L+ ND   +          S+ ++       E+   + +     +LHTSG++G PK +++       + Q F  LF           +++   +   F  ++VE    + S  +++IV  +      KLA V+   + V+ +   P+LL+++  QL   S +L+  +SL  +   GE  FPSL          N  ++ N+YG TEV       T+Y I +  +NS  K        F  +GT +        +  +  G+V + G+N        V+   G    TGD   + D ++F  GR D  +K +GK++  + +         V++C
Sbjct:   21 CFDECNNQLP---------VYYTYKTVVNAASELSNFLLLHCDFQ-GIRE--IGLYCQPGIDLPSWILGILQVPAAYVPIEPDSPPSLSTHFMKKCNLKYILVEKKQINKFKSFHETLLNYDTFTVEHNDLVLFRLHWKNTEVNLMLNDGKEKYEKEKIKSISSEHVNEEK--AEEHMDLRLKHCLAYVLHTSGTTGIPKIVRVPHKCIVPNIQHFRVLF------DITQEDVLFLASPLTFDPSVVEIFLALSSGASLLIVPTSVKLLPSKLASVLFSHHRVTVLQATPTLLRRFGSQLIK-STVLSATTSLRVLALGGEA-FPSLTVLRSWRGEGNKTQIFNVYGITEVSS---WATIYRIPEKTLNSTLKCELPVQLGFPLLGTVVEVRDTNGFTIQEGSGQVFLGGRNRVCFLDDEVTVPLGTMRATGDFVTVKDGEIFFLGRKDSQIKRHGKRLNIELVQQVAEELQQVESC 472          
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Human
Match: AASDH (aminoadipate-semialdehyde dehydrogenase [Source:HGNC Symbol;Acc:HGNC:23993])

HSP 1 Score: 69.707 bits (169), Expect = 2.217e-11
Identity = 101/477 (21.17%), Postives = 190/477 (39.83%), Query Frame = 1
Query:  259 CLNDCRKDNPNHIAAIHNDSFLTYSMLNTKANIVAKNLIRSCNLEIPMNECLVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIII----------------------------------HKKCSDIDLLSNDNSIQTVLMDTLLDESKIIDSFNLLPREYNPPQSREKTVVLLHTSGSSGTPKTIKIT------SAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVI-QKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNK--------FLSVGTPISNNQVFFESNSDNEGEVIVIGKN--------VSPTCGLAFQTGDVGFIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNC 1518
            C ++C    P          + TY  +   A+ ++  L+  C+ +  + E  +G+    G +    I+  L++   +VP+  +    L    + KCNL  I+                                  H K ++++L+ ND   +          S+ ++       E+   + +     +LHTSG++G PK +++       + Q F  LF           +++   +   F  ++VE    + S  +++IV  +      KLA V+   + V+ +   P+LL+++  QL   S +L+  +SL  +   GE  FPSL          N  ++ N+YG TEV       T+Y I +  +NS  K        F  +GT +        +  +  G+V + G+N        V+   G    TGD   + D ++F  GR D  +K +GK++  + +         V++C
Sbjct:   21 CFDECNNQLP---------VYYTYKTVVNAASELSNFLLLHCDFQ-GIRE--IGLYCQPGIDLPSWILGILQVPAAYVPIEPDSPPSLSTHFMKKCNLKYILVEKKQINKFKSFHETLLNYDTFTVEHNDLVLFRLHWKNTEVNLMLNDGKEKYEKEKIKSISSEHVNEEK--AEEHMDLRLKHCLAYVLHTSGTTGIPKIVRVPHKCIVPNIQHFRVLF------DITQEDVLFLASPLTFDPSVVEIFLALSSGASLLIVPTSVKLLPSKLASVLFSHHRVTVLQATPTLLRRFGSQLIK-STVLSATTSLRVLALGGEA-FPSLTVLRSWRGEGNKTQIFNVYGITEVSS---WATIYRIPEKTLNSTLKCELPVQLGFPLLGTVVEVRDTNGFTIQEGSGQVFLGGRNRVCFLDDEVTVPLGTMRATGDFVTVKDGEIFFLGRKDSQIKRHGKRLNIELVQQVAEELQQVESC 472          
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Human
Match: AASDH (aminoadipate-semialdehyde dehydrogenase [Source:HGNC Symbol;Acc:HGNC:23993])

HSP 1 Score: 68.9366 bits (167), Expect = 3.797e-11
Identity = 101/477 (21.17%), Postives = 190/477 (39.83%), Query Frame = 1
Query:  259 CLNDCRKDNPNHIAAIHNDSFLTYSMLNTKANIVAKNLIRSCNLEIPMNECLVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIII----------------------------------HKKCSDIDLLSNDNSIQTVLMDTLLDESKIIDSFNLLPREYNPPQSREKTVVLLHTSGSSGTPKTIKIT------SAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVI-QKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNK--------FLSVGTPISNNQVFFESNSDNEGEVIVIGKN--------VSPTCGLAFQTGDVGFIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNC 1518
            C ++C    P          + TY  +   A+ ++  L+  C+ +  + E  +G+    G +    I+  L++   +VP+  +    L    + KCNL  I+                                  H K ++++L+ ND   +          S+ ++       E+   + +     +LHTSG++G PK +++       + Q F  LF           +++   +   F  ++VE    + S  +++IV  +      KLA V+   + V+ +   P+LL+++  QL   S +L+  +SL  +   GE  FPSL          N  ++ N+YG TEV       T+Y I +  +NS  K        F  +GT +        +  +  G+V + G+N        V+   G    TGD   + D ++F  GR D  +K +GK++  + +         V++C
Sbjct:   21 CFDECNNQLP---------VYYTYKTVVNAASELSNFLLLHCDFQ-GIRE--IGLYCQPGIDLPSWILGILQVPAAYVPIEPDSPPSLSTHFMKKCNLKYILVEKKQINKFKSFHETLLNYDTFTVEHNDLVLFRLHWKNTEVNLMLNDGKEKYEKEKIKSISSEHVNEEK--AEEHMDLRLKHCLAYVLHTSGTTGIPKIVRVPHKCIVPNIQHFRVLF------DITQEDVLFLASPLTFDPSVVEIFLALSSGASLLIVPTSVKLLPSKLASVLFSHHRVTVLQATPTLLRRFGSQLIK-STVLSATTSLRVLALGGEA-FPSLTVLRSWRGEGNKTQIFNVYGITEVSS---WATIYRIPEKTLNSTLKCELPVQLGFPLLGTVVEVRDTNGFTIQEGSGQVFLGGRNRVCFLDDEVTVPLGTMRATGDFVTVKDGEIFFLGRKDSQIKRHGKRLNIELVQQVAEELQQVESC 472          
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Human
Match: AASDH (aminoadipate-semialdehyde dehydrogenase [Source:HGNC Symbol;Acc:HGNC:23993])

HSP 1 Score: 63.929 bits (154), Expect = 1.438e-9
Identity = 73/289 (25.26%), Postives = 127/289 (43.94%), Query Frame = 1
Query:  721 LLHTSGSSGTPKTIKITSA------QLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVI-QKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNK--------FLSVGTPISNNQVFFESNSDNEGEVIVIGKN--------VSPTCGLAFQTGDVGFIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNC 1518
            +LHTSG++G PK +++         Q F  LF           +++   +   F  ++VE    + S  +++IV  +      KLA V+   + V+ +   P+LL+++  QL   S +L+  +SL  +   GE  FPSL          N  ++ N+YG TEV       T+Y I +  +NS  K        F  +GT +        +  +  G+V + G+N        V+   G    TGD   + D ++F  GR D  +K +GK++  + +         V++C
Sbjct:   95 VLHTSGTTGIPKIVRVPHKCIVPNIQHFRVLF------DITQEDVLFLASPLTFDPSVVEIFLALSSGASLLIVPTSVKLLPSKLASVLFSHHRVTVLQATPTLLRRFGSQLIK-STVLSATTSLRVLALGGEA-FPSLTVLRSWRGEGNKTQIFNVYGITEVSS---WATIYRIPEKTLNSTLKCELPVQLGFPLLGTVVEVRDTNGFTIQEGSGQVFLGGRNRVCFLDDEVTVPLGTMRATGDFVTVKDGEIFFLGRKDSQIKRHGKRLNIELVQQVAEELQQVESC 372          
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Human
Match: AASDH (aminoadipate-semialdehyde dehydrogenase [Source:HGNC Symbol;Acc:HGNC:23993])

HSP 1 Score: 63.1586 bits (152), Expect = 2.051e-9
Identity = 73/289 (25.26%), Postives = 128/289 (44.29%), Query Frame = 1
Query:  721 LLHTSGSSGTPKTIKIT------SAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVI-QKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNK--------FLSVGTPISNNQVFFESNSDNEGEVIVIGKN--------VSPTCGLAFQTGDVGFIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNC 1518
            +LHTSG++G PK +++       + Q F  LF           +++   +   F  ++VE    + S  +++IV  +      KLA V+   + V+ +   P+LL+++  QL   S +L+  +SL  +   GE  FPSL          N  ++ N+YG TEV       T+Y I +  +NS  K        F  +GT +        +  +  G+V + G+N        V+   G    TGD   + D ++F  GR D  +K +GK++  + +         V++C
Sbjct:   42 VLHTSGTTGIPKIVRVPHKCIVPNIQHFRVLF------DITQEDVLFLASPLTFDPSVVEIFLALSSGASLLIVPTSVKLLPSKLASVLFSHHRVTVLQATPTLLRRFGSQLIK-STVLSATTSLRVLALGGEA-FPSLTVLRSWRGEGNKTQIFNVYGITEVSS---WATIYRIPEKTLNSTLKCELPVQLGFPLLGTVVEVRDTNGFTIQEGSGQVFLGGRNRVCFLDDEVTVPLGTMRATGDFVTVKDGEIFFLGRKDSQIKRHGKRLNIELVQQVAEELQQVESC 319          
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Celegans
Match: acs-11 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:Q20264])

HSP 1 Score: 52.373 bits (124), Expect = 1.197e-6
Identity = 98/453 (21.63%), Postives = 176/453 (38.85%), Query Frame = 1
Query:  163 VMNQLSNTSHCLYGENDSYEHCNNLATYFEMNCLNDCRKDNPNHIAAIHNDSFLTYSMLNTKANIVAKNLIRSCNLEIPMNECLVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIIIHKKC-SDIDLLSNDNSIQTVLMDTLLDESKIIDSFNLLPR-EYNPPQSREKTVVLLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSC-ILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLV-NLYGSTEVCGDVCCQTLYSINDVRMNSKNKFLSVGTPISNNQVFFESNSDNEGE--VIVIGKNVSP-------TCGLAFQTGDVGFI-ADKKLFICGRIDDMVKVNGKKIFTKDI 1479
            ++++L ++ H   G   +    NN+ +  ++       + +P+ +  I  D   TY     +    A  L    N++   +  +  V        LY  +ACL++G +++P+            I     SI++   C  ++D +  D  I+ +  D L  E+  +++  ++   E + P S      + +TSG++G PK   +T   L N      R+  F  N+   H   F  V  +   L C + S  TM+  S  E  D +K  +     + + ++ VP+   + L       +          V  SG      L+   +  F   + +++   YG TE  G +    L        N + K  +VG  +         N   E +   I  G   +P       T    F+TGDVG +  D  L I GR  DMV   G  ++ K++
Sbjct:    1 MLSRLVSSVHPQIGLRAASSAANNIVSQAQL-------QSDPSKLLFIDGDRKTTYGEFVKRTGQYATALTEKYNIK-KGDRVMARVSKTTDTAALY--IACLQIGALYIPVNPGYTESEAAHYIKDATPSILV--SCNEELDKVFRDK-IRVINEDKLASEAGSLNACTMIEHVEKSDPAS------VCYTSGTTGLPKGAILTHGSLSNNAHDIVRDWGFTGNDYNLHALPFYHVHGLYYSLHCSLFSHSTMIWRSKFEVEDCIKYMK-----NATVMMGVPTFFSRLLAS----KNFNKEAFGNVRVFISGSA---PLSVSTIEEFRERTGQVILERYGMTE-AGVMTTNPL--------NGERKAGTVGPAVQGVGCRIAKNGGIEVKTNAIFAGYWKNPKKTAEEFTEDGWFKTGDVGHLDEDGYLTIGGRSKDMVITGGLNVYPKEL 413          
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Celegans
Match: acs-11 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:Q20264])

HSP 1 Score: 52.373 bits (124), Expect = 1.197e-6
Identity = 98/453 (21.63%), Postives = 176/453 (38.85%), Query Frame = 1
Query:  163 VMNQLSNTSHCLYGENDSYEHCNNLATYFEMNCLNDCRKDNPNHIAAIHNDSFLTYSMLNTKANIVAKNLIRSCNLEIPMNECLVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIIIHKKC-SDIDLLSNDNSIQTVLMDTLLDESKIIDSFNLLPR-EYNPPQSREKTVVLLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSC-ILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLV-NLYGSTEVCGDVCCQTLYSINDVRMNSKNKFLSVGTPISNNQVFFESNSDNEGE--VIVIGKNVSP-------TCGLAFQTGDVGFI-ADKKLFICGRIDDMVKVNGKKIFTKDI 1479
            ++++L ++ H   G   +    NN+ +  ++       + +P+ +  I  D   TY     +    A  L    N++   +  +  V        LY  +ACL++G +++P+            I     SI++   C  ++D +  D  I+ +  D L  E+  +++  ++   E + P S      + +TSG++G PK   +T   L N      R+  F  N+   H   F  V  +   L C + S  TM+  S  E  D +K  +     + + ++ VP+   + L       +          V  SG      L+   +  F   + +++   YG TE  G +    L        N + K  +VG  +         N   E +   I  G   +P       T    F+TGDVG +  D  L I GR  DMV   G  ++ K++
Sbjct:    1 MLSRLVSSVHPQIGLRAASSAANNIVSQAQL-------QSDPSKLLFIDGDRKTTYGEFVKRTGQYATALTEKYNIK-KGDRVMARVSKTTDTAALY--IACLQIGALYIPVNPGYTESEAAHYIKDATPSILV--SCNEELDKVFRDK-IRVINEDKLASEAGSLNACTMIEHVEKSDPAS------VCYTSGTTGLPKGAILTHGSLSNNAHDIVRDWGFTGNDYNLHALPFYHVHGLYYSLHCSLFSHSTMIWRSKFEVEDCIKYMK-----NATVMMGVPTFFSRLLAS----KNFNKEAFGNVRVFISGSA---PLSVSTIEEFRERTGQVILERYGMTE-AGVMTTNPL--------NGERKAGTVGPAVQGVGCRIAKNGGIEVKTNAIFAGYWKNPKKTAEEFTEDGWFKTGDVGHLDEDGYLTIGGRSKDMVITGGLNVYPKEL 413          
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Fly
Match: e (gene:FBgn0000527 transcript:FBtr0084106)

HSP 1 Score: 154.836 bits (390), Expect = 3.451e-38
Identity = 181/839 (21.57%), Postives = 361/839 (43.03%), Query Frame = 1
Query:  325 TYSMLNTKANIVAKNLIRSCNLEIPM----NECLVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIIIHKKCSDIDLLSNDNSIQTVLMDTLLDESKIIDSFNLLPREYNPPQSREKTVVLLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLPFKSNEIV-CHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWLK--QLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNKFLSVGTPISNNQVF-----FESNSDNE-GEVIVIGKN--------------------VSPTCGLAFQTGDVGFIADKKLFICGRIDDMVKVNGKKI----FTKDISTAVMVHSDVDNCYTIQLIISGRPQLVSFFTTKTEIGNKTKTKMEINNILMNHSLNVCLPRLEYIKSIPIQPQSMKPDKKMLCKIAKKILSENRRMKTKLTHGKHXXXXXXXXXXXXXXXXXXNSQKHYIYEILAKHLSLLPDEIDDSMKFYDIGGDSLTIVICIADLNRKGFSCTTEVFFHNHSIGELVECILEQSNSKIRNNSDYKLFKYDMKN-----DFTVEQIQYENKTEIIEFLVENFYTKELVVRYLNTPV--KVFVEVVSEIFDLSLRSGCSFCIRNSISKSIVGLQLSEDS--SYEIPNTSQLYKLDEENSLDCFLQNCKPRIAE-FLKTPK-----LNVSVVALSGTLNKSIVIQLLYFIEKHTIDLAQCKNYKTIETINTSEATKKICSELNYRLIKSTSMSHFLN 2685
            +Y  +N +AN  A+ L+   +          + +V V +      + +++A  K G  ++P+  +  ++ +  I+ +   +++I     D        ++ T     L  +S  +   NLL  E       +   ++L+TSGS+G PK +++    + NRL WQW   P+ +NE V   +T   FVD+I E    ++  + +++V      D  +L  ++++Y +  ++ VP+LL+  L   +++       LL +L   V SGE L  SLA      F+    +L N YGSTEV GDV   T ++    +  S    + +G P+SN  V+     +    + E GE+   G N                    V       ++TGD G + +  +   GR D  VK+ G ++      K+++   +V   +  CY    +      +++F   + +    T+ +ME    L +   +   P++  ++ +P+     K D++ L K  +   +        L      +     L   D                LA H             FY++GG+SL  +  +  L  KG++     F    ++GE++E        K+  N D    + +  N           ++ E++ E+I+ +V +FY K  + ++L   V    + +++++I+++ +    SF + ++ +  I+G  L+ D+    E+   S+L  + E      FL+ C+  I + +L  PK     L+  ++  +  LN    I  ++F+E   + +A+ K +  I T NTS  T+++    +Y+ + +  ++ +++
Sbjct:   56 SYRQMNERANRAARLLVAETHGRFLQPNSDGDFIVAVCMQPSEGLVTTLLAIWKAGGAYLPIDPSFPANRIHHILLEAKPTLVIRDDDIDAGRFQGTPTLSTT---ELYAKSLQLAGSNLLSEEMLR-GGNDHIAIVLYTSGSTGVPKGVRLPHESILNRLQWQWATFPYTANEAVSVFKTALTFVDSIAELWGPLMCGLAILVVPKAVTKDPQRLVALLERYKIRRLVLVPTLLRSLLMYLKMEGGGAAQKLLYNLQIWVCSGEPLSVSLASSFFDYFDEGVHRLYNFYGSTEVLGDV---TYFACESKKQLSLYDNVPIGIPLSNTVVYLLDADYRPVKNGEIGEIFASGLNLAAGYVNGRDPERFLENPLAVEKKYARLYRTGDYGSLKNGSIMYEGRTDSQVKIRGHRVDLSEVEKNVAELPLVDKAIVLCYHAGQVDQA---ILAFVKLRDDAPMVTEMQMEAR--LKDKLADYMTPQVVILEHVPLLVNG-KVDRQALLKTYETANNNEGDSSIVLDFDYSQVPEDLKLTARDLFETVGGVIGRSTRATLAPH-----------SNFYELGGNSLNSIFTVTLLREKGYNIGISEFIAAKNLGEIIE--------KMAANHDAVQLEEESLNACPHLKMEAVPLRLEHRQEVIDIIVASFYNKADLEQWLKPGVLRTDYSDILNDIWNVLVERDLSFVVYDTNTDRIIGTALNFDARNEPEVDIKSKLLIVFE------FLEFCEGPIRDNYL--PKGLNQILHSFMMGTAEKLNPRENIACMHFMEHEVLRVAREKQFAGIFTTNTSPLTQQLADVYHYKTLLNFQVNEYVH 854          
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Zebrafish
Match: aasdh (aminoadipate-semialdehyde dehydrogenase [Source:NCBI gene;Acc:570338])

HSP 1 Score: 53.5286 bits (127), Expect = 1.335e-6
Identity = 70/293 (23.89%), Postives = 130/293 (44.37%), Query Frame = 1
Query:  697 QSREKTVVLLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWIL-TVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPS--LAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRM---NSKNKFLSVGTPISNN--QVFFESN---SDNEGEVIVIGKNV--------SPTCGLAFQTGDVGFIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNC 1518
            Q  E    +LHTSG++G PK +K+    +   +            ++V   +   F  ++VE    + S   ++IV         +LA V+ K + + +L   P+L++++ K +    ++L+  SSL  +   GE   PS  L K      NR    + NLYG+TEV    C  + Y + D  +   +  +  + +G P+ +   +V  E+    ++ EG++ + G+N         +   G    TGD   + +  L+  GR D +VK  G+++    +   +   S V+ C
Sbjct:  170 QQGEPLAYILHTSGTTGLPKIVKVPHRCIVPNIIHLRSVFKMTPEDVVFLSSPLTFDPSVVEVFLALSSGACLLIVPSAVKKMPRRLAHVLFKRNTTTVLQATPTLVRRFGKVVLQ-EEVLSADSSLRILAFGGEPC-PSLNLVKSWRQEGNRT--HIYNLYGTTEVS---CWASWYKVPDEHLCLEDITDAPVPLGEPMLDTVMEVRDETGHLVTEGEGQLFIGGQNRVCLLDDEETVVKGTMRATGDWVQVQNSNLYFLGRKDRLVKRFGQRVHLDALQQMIESFSGVEAC 455          
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Zebrafish
Match: aasdh (aminoadipate-semialdehyde dehydrogenase [Source:NCBI gene;Acc:570338])

HSP 1 Score: 53.5286 bits (127), Expect = 1.386e-6
Identity = 70/293 (23.89%), Postives = 130/293 (44.37%), Query Frame = 1
Query:  697 QSREKTVVLLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWIL-TVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPS--LAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRM---NSKNKFLSVGTPISNN--QVFFESN---SDNEGEVIVIGKNV--------SPTCGLAFQTGDVGFIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNC 1518
            Q  E    +LHTSG++G PK +K+    +   +            ++V   +   F  ++VE    + S   ++IV         +LA V+ K + + +L   P+L++++ K +    ++L+  SSL  +   GE   PS  L K      NR    + NLYG+TEV    C  + Y + D  +   +  +  + +G P+ +   +V  E+    ++ EG++ + G+N         +   G    TGD   + +  L+  GR D +VK  G+++    +   +   S V+ C
Sbjct:  170 QQGEPLAYILHTSGTTGLPKIVKVPHRCIVPNIIHLRSVFKMTPEDVVFLSSPLTFDPSVVEVFLALSSGACLLIVPSAVKKMPRRLAHVLFKRNTTTVLQATPTLVRRFGKVVLQ-EEVLSADSSLRILAFGGEPC-PSLNLVKSWRQEGNRT--HIYNLYGTTEVS---CWASWYKVPDEHLCLEDITDAPVPLGEPMLDTVMEVRDETGHLVTEGEGQLFIGGQNRVCLLDDEETVVKGTMRATGDWVQVQNSNLYFLGRKDRLVKRFGQRVHLDALQQMIESFSGVEAC 455          
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Xenopus
Match: rapsn (receptor associated protein of the synapse [Source:Xenbase;Acc:XB-GENE-990995])

HSP 1 Score: 71.633 bits (174), Expect = 5.071e-12
Identity = 103/487 (21.15%), Postives = 213/487 (43.74%), Query Frame = 1
Query:  319 FLTYSMLNTKANIVAKNLIRSCNLEIPMNECLVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLS-IIIHKKCSDIDLLSN--DNSIQTVLMDTLLDESKIIDSFNLLPREYNPPQSREKTVVLLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECL------SCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNKF------LSVGTPISNNQVFFESNS-----DNEGEVIVIGKN---------VSPTCGLAFQTGDVGFIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNCYTIQLIISGRPQLVSFFTTKTEIGNKTKTKMEINNILMNHSLNVCLP-RLEYIKSIPI 1689
            + TYS +   A  +A  L   C        C +G+  + G      I+  L++   + P+  + +SD+  ++++K N+  +++HK   ++   S      I  V+ +   +E       N++ +E+   + +     +LHTSG++G PK + +    +   ++          ++++   +   F  +++E        +C+L     + + P + CDI     +  ++ V+ +   P+ L+++  +    S +L+  +SL  +   GE  FPS++         N  +L+NLYG TEV       T Y I +  +NS N F      + +G P+    V  ++       + EG+V++ G+          + P  G   +TGD   + D +++  GR D+ +K +GK++  + +  +    + V+ C  +        QLV F      I N    K  +   L +H L+  +P  L  ++++P+
Sbjct:   26 YYTYSKMMRLAEELALFLKSHCR---HTETCKIGLYCNPGINLPSYIIGILQVPAAYFPVDPSNSSDVSIKLLEKSNVEYMLVHKDMVEVSATSVFLILCIGKVMFNDTPEEKH---KENVMYKEHMDMREKHCLAYILHTSGTTGAPKIVSVPHKCIVPNIYHLRSIFAISPDDLLFLASPLTFDPSVIELFLALSSGACLLVVPNPIKMMPHKLCDI-----LFHQHRVTVLQATPTFLRRFGSR-SIRSSVLSKGTSLRVLALGGEP-FPSVSVLRSWREPGNRTRLINLYGITEVSS---WATYYEITEQMINS-NLFYDIFSCVPLGFPLQGTIVEVQNEKGYKIDEGEGQVLLGGRERICFLDNEFILPY-GTMRKTGDWVTLKDGEMYFLGRKDNQIKRHGKRLNIEYVQQSAESLAHVEVCTALWF---QEKQLVMFV-----IPNGPLEKKFLWKELQSHLLSYAVPDDLVLVETLPL 486          
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Xenopus
Match: rapsn (receptor associated protein of the synapse [Source:Xenbase;Acc:XB-GENE-990995])

HSP 1 Score: 67.3958 bits (163), Expect = 1.137e-10
Identity = 103/496 (20.77%), Postives = 210/496 (42.34%), Query Frame = 1
Query:  319 FLTYSMLNTKANIVAKNLIRSCNLEIPMNECLVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIID--------------KCNLSIIIHKKCSDIDLLSNDNSIQTVLMDTLLDESKIIDSFNLLPREYNPPQSREKTVVLLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECL------SCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSIND-VRMNSKNKFLS---VGTPISNNQVFFESNS-----DNEGEVIVIGKN---------VSPTCGLAFQTGDVGFIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNCYTIQLIISGRPQLVSFFTTKTEIGNKTKTKMEINNILMNHSLNVCLP-RLEYIKSIPI 1689
            + TYS +   A  +A  L   C        C +G+  + G      I+  L++   + P+  + +SD++  ++               + + S I H   +  ++  N  +I   L     D  +     N++ +E+   + +     +LHTSG++G PK + +    +   ++          ++++   +   F  +++E        +C+L     + + P + CDI     +  ++ V+ +   P+ L+++  +    S +L+  +SL  +   GE  FPS++         N  +L+NLYG TEV       T Y I + V+ NS+ K  S   +G P+    V  ++       + EG+V++ G+          + P  G   +TGD   + D +++  GR D+ +K +GK++  + +  +    + V+ C  +        QLV F      I N    K  +   L +H L+  +P  L  ++++P+
Sbjct:   26 YYTYSKMMRLAEELALFLKSHCR---HTETCKIGLYCNPGINLPSYIIGILQVPAAYFPVDPSNSSDVMTNLLSLTLQNFKLQFPGFVELDSSSIQHINVNLFEVKRNKKAIVRGLHRHQNDTPEEKHKENVMYKEHMDMREKHCLAYILHTSGTTGAPKIVSVPHKCIVPNIYHLRSIFAISPDDLLFLASPLTFDPSVIELFLALSSGACLLVVPNPIKMMPHKLCDI-----LFHQHRVTVLQATPTFLRRFGSR-SIRSSVLSKGTSLRVLALGGEP-FPSVSVLRSWREPGNRTRLINLYGITEVSS---WATYYEITESVQNNSRGKEESCVPLGFPLQGTIVEVQNEKGYKIDEGEGQVLLGGRERICFLDNEFILPY-GTMRKTGDWVTLKDGEMYFLGRKDNQIKRHGKRLNIEYVQQSAESLAHVEVCTALWF---QEKQLVMFV-----IPNGPLEKKFLWKELQSHLLSYAVPDDLVLVETLPL 499          
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Xenopus
Match: rapsn (receptor associated protein of the synapse [Source:Xenbase;Acc:XB-GENE-990995])

HSP 1 Score: 63.929 bits (154), Expect = 1.228e-9
Identity = 98/492 (19.92%), Postives = 205/492 (41.67%), Query Frame = 1
Query:  319 FLTYSMLNTKANIVAKNLIRSCNLEIPMNECLVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIID--------------KCNLSIIIHKKCSDIDLLSNDNSIQTVLMDTLLDESKIIDSFNLLPREYNPPQSREKTVVLLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECL------SCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNKFLSVGTPISNNQVFFESNS-----DNEGEVIVIGKN---------VSPTCGLAFQTGDVGFIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNCYTIQLIISGRPQLVSFFTTKTEIGNKTKTKMEINNILMNHSLNVCLP-RLEYIKSIPI 1689
            + TYS +   A  +A  L   C        C +G+  + G      I+  L++   + P+  + +SD++  ++               + + S I H   +  ++  N  +I   L     D  +     N++ +E+   + +     +LHTSG++G PK + +    +   ++          ++++   +   F  +++E        +C+L     + + P + CDI     +  ++ V+ +   P+ L+++  +    S +L+  +SL  +   GE  FPS++         N  +L+NLYG TEV       T Y I +     +   + +G P+    V  ++       + EG+V++ G+          + P  G   +TGD   + D +++  GR D+ +K +GK++  + +  +    + V+ C  +        QLV F      I N    K  +   L +H L+  +P  L  ++++P+
Sbjct:   26 YYTYSKMMRLAEELALFLKSHCR---HTETCKIGLYCNPGINLPSYIIGILQVPAAYFPVDPSNSSDVMTNLLSLTLQNFKLQFPGFVELDSSSIQHINVNLFEVKRNKKAIVRGLHRHQNDTPEEKHKENVMYKEHMDMREKHCLAYILHTSGTTGAPKIVSVPHKCIVPNIYHLRSIFAISPDDLLFLASPLTFDPSVIELFLALSSGACLLVVPNPIKMMPHKLCDI-----LFHQHRVTVLQATPTFLRRFGSR-SIRSSVLSKGTSLRVLALGGEP-FPSVSVLRSWREPGNRTRLINLYGITEVSS---WATYYEITE-----EESCVPLGFPLQGTIVEVQNEKGYKIDEGEGQVLLGGRERICFLDNEFILPY-GTMRKTGDWVTLKDGEMYFLGRKDNQIKRHGKRLNIEYVQQSAESLAHVEVCTALWF---QEKQLVMFV-----IPNGPLEKKFLWKELQSHLLSYAVPDDLVLVETLPL 490          
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Xenopus
Match: rapsn (receptor associated protein of the synapse [Source:Xenbase;Acc:XB-GENE-990995])

HSP 1 Score: 57.3806 bits (137), Expect = 1.312e-7
Identity = 77/352 (21.88%), Postives = 155/352 (44.03%), Query Frame = 1
Query:  703 REKTVV--LLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECL------SCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNKFLSVGTPISNNQVFFESNS-----DNEGEVIVIGKN---------VSPTCGLAFQTGDVGFIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNCYTIQLIISGRPQLVSFFTTKTEIGNKTKTKMEINNILMNHSLNVCLP-RLEYIKSIPI 1689
            REK  +  +LHTSG++G PK + +    +   ++          ++++   +   F  +++E        +C+L     + + P + CDI+       ++ V+ +   P+ L+++  +    S +L+  +SL  +   GE  FPS++         N  +L+NLYG TEV       T Y I +     +   + +G P+    V  ++       + EG+V++ G+          + P  G   +TGD   + D +++  GR D+ +K +GK++  + +  +    + V+ C  +        QLV F      I N    K  +   L +H L+  +P  L  ++++P+
Sbjct:    9 REKHCLAYILHTSGTTGAPKIVSVPHKCIVPNIYHLRSIFAISPDDLLFLASPLTFDPSVIELFLALSSGACLLVVPNPIKMMPHKLCDIL-----FHQHRVTVLQATPTFLRRFGSR-SIRSSVLSKGTSLRVLALGGEP-FPSVSVLRSWREPGNRTRLINLYGITEVSS---WATYYEITE-----EESCVPLGFPLQGTIVEVQNEKGYKIDEGEGQVLLGGRERICFLDNEFILPY-GTMRKTGDWVTLKDGEMYFLGRKDNQIKRHGKRLNIEYVQQSAESLAHVEVCTALWF---QEKQLVMFV-----IPNGPLEKKFLWKELQSHLLSYAVPDDLVLVETLPL 336          
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Mouse
Match: Aasdh (aminoadipate-semialdehyde dehydrogenase [Source:MGI Symbol;Acc:MGI:2442517])

HSP 1 Score: 85.1149 bits (209), Expect = 2.088e-16
Identity = 140/621 (22.54%), Postives = 251/621 (40.42%), Query Frame = 1
Query:  325 TYSMLNTKANIVAKNLIRSCNLEIPMNECLVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIII-------------------------HKKCSDIDLLSNDNSIQTVLMDTLLDESKIIDSFNLLPREYNPPQSREKTV-------VLLHTSGSSGTPKTIKITSA------QLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECL------SCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNKFLS---VGTPISNNQVFFESNS-----DNEGEVIVIGKN--------VSPTCGLAFQTGDVGFIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNCYTIQLIISGRPQLVSFFTTKTEIGNKTKTKMEINNILMNHSLNVCLPRLEYIKSIPIQPQSMKPDKKMLCKIAKKILSENRRMKTKLTHGKHXXXXXXXXXXXXXXXXXXNSQKHYIYEILAKHLSLLPDEIDDSMK------FYDIGGDSLTIVICIADLNR 1989
            +Y  L + A+ ++  LI  C+    + E  +G+    G      I+  L++   + P+  +    L    + KC+L  ++                         HK  +   L   D  + TVL D   D+ K+ D  + +  E   P+     +        +LHTSG++GTPK +++  A      Q F  LF           +I+   +   F  ++VE        +C+L   T V V P++  DI     +  ++ V+ +   P+LL+++  +L   S +L+  +SL  +   GE  FPSL          N  ++ N+YG TEV       T Y I +  +NS  K  S   +G+P+    +     +     +  G+V + GKN        ++   G    TGD   + D ++F  GR D  +K +GK++   +I+    V  ++    +  +    + +L+ F  +K ++      K E+   L  H+L      +  I ++P      K D   L KI    +S   R +    HGK  L                  +  Y++    K +  LP++ +D++K      F D GGDSL  +  ++++ R
Sbjct:   34 SYKALLSAASELSHFLIAHCDFG-GIRE--IGLYCQPGINLPSWILGILQVPAAYAPIDPDSPPSLSTYFMKKCDLKYVLVEKQQLSKFKSSHETVLNYDTVSVEHKDLALFRLHWEDGRVSTVLGDRA-DQHKVTDREDRVSAESRTPEKEHMDMRHDGCLAYVLHTSGTTGTPKIVRVPHACILPNIQHFRSLF------DITQEDILFLASPLTFDPSVVEIFVSLSSGACLLIVPTSVKVLPSKLADI-----LFSRHRVTVLQATPTLLRRFGSELIK-STVLSAHTSLRVLALGGEA-FPSLTILKSWRGKGNRTQIFNIYGITEVS---SWATFYRIPEEILNSAVKHESPVQLGSPLLGTVIEVRDQNGSPVLEGTGQVFLGGKNRVCFLDDEMTVPLGTMRATGDFVTVKDGEIFFLGRKDSQIKRHGKRL---NIALVQQVAEELRQVESCAVTWYNQERLILFIVSKVDLVKDCIFK-ELQKHLPAHALP---DDMVLIDTLPFTCHG-KVDVSELNKIYLDYISSQPRNE---LHGKEELW----------------GKLQYLW----KSILCLPEDPEDTLKVPANSVFLDSGGDSLKSMRLLSEIER 603          
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Mouse
Match: Aasdh (aminoadipate-semialdehyde dehydrogenase [Source:MGI Symbol;Acc:MGI:2442517])

HSP 1 Score: 83.9593 bits (206), Expect = 6.435e-16
Identity = 142/623 (22.79%), Postives = 253/623 (40.61%), Query Frame = 1
Query:  325 TYSMLNTKANIVAKNLIRSCNLEIPMNECLVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIII-------------------------HKKCSDIDLLSNDNSIQTVLMDTLLDESKIIDSFNLLPREYNPPQSREKTV-------VLLHTSGSSGTPKTIKITSA------QLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECL------SCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLA--KKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNKFLS---VGTPISNNQVFFESNS-----DNEGEVIVIGKN--------VSPTCGLAFQTGDVGFIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNCYTIQLIISGRPQLVSFFTTKTEIGNKTKTKMEINNILMNHSLNVCLPRLEYIKSIPIQPQSMKPDKKMLCKIAKKILSENRRMKTKLTHGKHXXXXXXXXXXXXXXXXXXNSQKHYIYEILAKHLSLLPDEIDDSMK------FYDIGGDSLTIVICIADLNR 1989
            +Y  L + A+ ++  LI  C+    + E  +G+    G      I+  L++   + P+  +    L    + KC+L  ++                         HK  +   L   D  + TVL D   D+ K+ D  + +  E   P+     +        +LHTSG++GTPK +++  A      Q F  LF           +I+   +   F  ++VE        +C+L   T V V P++  DI     +  ++ V+ +   P+LL+++  +L   S +L+  +SL  +   GE  FPSL   K      NR   ++ N+YG TEV       T Y I +  +NS  K  S   +G+P+    +     +     +  G+V + GKN        ++   G    TGD   + D ++F  GR D  +K +GK++   +I+    V  ++    +  +    + +L+ F  +K ++      K E+   L  H+L      +  I ++P      K D   L KI    +S   R +    HGK  L                  +  Y++    K +  LP++ +D++K      F D GGDSL  +  ++++ R
Sbjct:   34 SYKALLSAASELSHFLIAHCDFG-GIRE--IGLYCQPGINLPSWILGILQVPAAYAPIDPDSPPSLSTYFMKKCDLKYVLVEKQQLSKFKSSHETVLNYDTVSVEHKDLALFRLHWEDGRVSTVLGDRA-DQHKVTDREDRVSAESRTPEKEHMDMRHDGCLAYVLHTSGTTGTPKIVRVPHACILPNIQHFRSLF------DITQEDILFLASPLTFDPSVVEIFVSLSSGACLLIVPTSVKVLPSKLADI-----LFSRHRVTVLQATPTLLRRFGSELIK-STVLSAHTSLRVLALGGEA-FPSLTILKSWRGKGNRT--QIFNIYGITEVSS---WATFYRIPEEILNSAVKHESPVQLGSPLLGTVIEVRDQNGSPVLEGTGQVFLGGKNRVCFLDDEMTVPLGTMRATGDFVTVKDGEIFFLGRKDSQIKRHGKRL---NIALVQQVAEELRQVESCAVTWYNQERLILFIVSKVDLVKDCIFK-ELQKHLPAHALP---DDMVLIDTLPFTCHG-KVDVSELNKIYLDYISSQPRNE---LHGKEELW----------------GKLQYLW----KSILCLPEDPEDTLKVPANSVFLDSGGDSLKSMRLLSEIER 603          
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Mouse
Match: Aasdh (aminoadipate-semialdehyde dehydrogenase [Source:MGI Symbol;Acc:MGI:2442517])

HSP 1 Score: 83.9593 bits (206), Expect = 6.435e-16
Identity = 142/623 (22.79%), Postives = 253/623 (40.61%), Query Frame = 1
Query:  325 TYSMLNTKANIVAKNLIRSCNLEIPMNECLVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIII-------------------------HKKCSDIDLLSNDNSIQTVLMDTLLDESKIIDSFNLLPREYNPPQSREKTV-------VLLHTSGSSGTPKTIKITSA------QLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECL------SCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLA--KKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNKFLS---VGTPISNNQVFFESNS-----DNEGEVIVIGKN--------VSPTCGLAFQTGDVGFIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNCYTIQLIISGRPQLVSFFTTKTEIGNKTKTKMEINNILMNHSLNVCLPRLEYIKSIPIQPQSMKPDKKMLCKIAKKILSENRRMKTKLTHGKHXXXXXXXXXXXXXXXXXXNSQKHYIYEILAKHLSLLPDEIDDSMK------FYDIGGDSLTIVICIADLNR 1989
            +Y  L + A+ ++  LI  C+    + E  +G+    G      I+  L++   + P+  +    L    + KC+L  ++                         HK  +   L   D  + TVL D   D+ K+ D  + +  E   P+     +        +LHTSG++GTPK +++  A      Q F  LF           +I+   +   F  ++VE        +C+L   T V V P++  DI     +  ++ V+ +   P+LL+++  +L   S +L+  +SL  +   GE  FPSL   K      NR   ++ N+YG TEV       T Y I +  +NS  K  S   +G+P+    +     +     +  G+V + GKN        ++   G    TGD   + D ++F  GR D  +K +GK++   +I+    V  ++    +  +    + +L+ F  +K ++      K E+   L  H+L      +  I ++P      K D   L KI    +S   R +    HGK  L                  +  Y++    K +  LP++ +D++K      F D GGDSL  +  ++++ R
Sbjct:   34 SYKALLSAASELSHFLIAHCDFG-GIRE--IGLYCQPGINLPSWILGILQVPAAYAPIDPDSPPSLSTYFMKKCDLKYVLVEKQQLSKFKSSHETVLNYDTVSVEHKDLALFRLHWEDGRVSTVLGDRA-DQHKVTDREDRVSAESRTPEKEHMDMRHDGCLAYVLHTSGTTGTPKIVRVPHACILPNIQHFRSLF------DITQEDILFLASPLTFDPSVVEIFVSLSSGACLLIVPTSVKVLPSKLADI-----LFSRHRVTVLQATPTLLRRFGSELIK-STVLSAHTSLRVLALGGEA-FPSLTILKSWRGKGNRT--QIFNIYGITEVSS---WATFYRIPEEILNSAVKHESPVQLGSPLLGTVIEVRDQNGSPVLEGTGQVFLGGKNRVCFLDDEMTVPLGTMRATGDFVTVKDGEIFFLGRKDSQIKRHGKRL---NIALVQQVAEELRQVESCAVTWYNQERLILFIVSKVDLVKDCIFK-ELQKHLPAHALP---DDMVLIDTLPFTCHG-KVDVSELNKIYLDYISSQPRNE---LHGKEELW----------------GKLQYLW----KSILCLPEDPEDTLKVPANSVFLDSGGDSLKSMRLLSEIER 603          
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Mouse
Match: Aasdh (aminoadipate-semialdehyde dehydrogenase [Source:MGI Symbol;Acc:MGI:2442517])

HSP 1 Score: 62.003 bits (149), Expect = 1.888e-9
Identity = 86/365 (23.56%), Postives = 150/365 (41.10%), Query Frame = 1
Query:  325 TYSMLNTKANIVAKNLIRSCNLEIPMNECLVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIII-------------------------HKKCSDIDLLSNDNSIQTVLMDTLLDESKIIDSFNLLPREYNPPQSREKTV-------VLLHTSGSSGTPKTIKITSA------QLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECL------SCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNKFLS---VGTPI 1278
            +Y  L + A+ ++  LI  C+    + E  +G+    G      I+  L++   + P+  +    L    + KC+L  ++                         HK  +   L   D  + TVL D   D+ K+ D  + +  E   P+     +        +LHTSG++GTPK +++  A      Q F  LF           +I+   +   F  ++VE        +C+L   T V V P++  DI     +  ++ V+ +   P+LL+++  +L   S +L+  +SL  +   GE  FPSL          N  ++ N+YG TEV       T Y I +  +NS  K  S   +G+P+
Sbjct:   34 SYKALLSAASELSHFLIAHCDFG-GIRE--IGLYCQPGINLPSWILGILQVPAAYAPIDPDSPPSLSTYFMKKCDLKYVLVEKQQLSKFKSSHETVLNYDTVSVEHKDLALFRLHWEDGRVSTVLGDRA-DQHKVTDREDRVSAESRTPEKEHMDMRHDGCLAYVLHTSGTTGTPKIVRVPHACILPNIQHFRSLF------DITQEDILFLASPLTFDPSVVEIFVSLSSGACLLIVPTSVKVLPSKLADI-----LFSRHRVTVLQATPTLLRRFGSELIK-STVLSAHTSLRVLALGGEA-FPSLTILKSWRGKGNRTQIFNIYGITEVS---SWATFYRIPEEILNSAVKHESPVQLGSPL 378          
BLAST of Ss-alanyl conjugating enzyme vs. UniProt/SwissProt
Match: sp|O68006|BACA_BACLI (Bacitracin synthase 1 OS=Bacillus licheniformis OX=1402 GN=bacA PE=3 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.104e-20
Identity = 107/464 (23.06%), Postives = 202/464 (43.53%), Query Frame = 1
Query:  286 PNHIAAIHNDSFLTYSMLNTKANIVAKNLIRSCNLEIPMNECLVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIIIHKKCSDIDLLSNDNSIQTVLMDTLLDESKIIDSFNLLPREYNPPQSREK-TVVLLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNYSDIXXX-XXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNKFLSVGTPISNNQVFFESNSDN------EGEVIVIGKNVS--------------------PTCGLAFQTGDVG-FIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDV-DNCYTIQLIISGRPQLVSFFTTKTEI 1587
            P+H A +     +TY  LN KAN  A+ L+R   +       +  ++ D  FE +  I+  LK G  ++P+      D +  ++     ++++       D L     I+TV + +        D  +LL  E  P  +R   T  +++TSGS+GTPK + I       R+      +    N+++   + + F  ++ +    +L+  ++V++      +  +LAEVI+K  VS +    +L        +  +DI    L+ L  ++  GE       +K L    R+  KL+++YG TE        T Y IN++  + + + + +G+P++N  V     +         GE+ + G  +S                    P   L ++TGD+  ++ D  +   GRID  VK+ G +I   +I + + +H D+ +   T++     RP + ++ T   EI
Sbjct: 4680 PDHTALVFGAQRMTYRELNEKANQTAR-LLREKGI---GRGSIAAIIADRSFEMIIGIIGILKAGGTYLPIDPETPRDRIDYMLKNSGAALLV-----TTDSLLKPFDIKTVDLCS--------DELHLLSEENLPRVNRSSDTAYIVYTSGSTGTPKGVVIPHYSA-ARVVKNTNYIDITGNDVILQLSNYSFDGSVFDIFGALLNGASLVLIEKETVLNTHELAEVIKKEQVSVMFITTAL-------FNTLADINIGCLAKLRKILFGGERASIPHVRKVLDHVGRD--KLIHVYGPTE---STVYATYYFINEI--DDEAETIPIGSPLANTSVLIMDEAGKLLPIGVPGELCIAGDGLSKGYLNREELTAEKFIPHPFIPGERL-YKTGDLAKWLPDGNIEFIGRIDHQVKIRGFRIELGEIESRLEMHEDINETIVTVREDEESRPYICAYITANREI 5110          

HSP 2 Score: 91.2781 bits (225), Expect = 3.409e-17
Identity = 104/493 (21.10%), Postives = 201/493 (40.77%), Query Frame = 1
Query:  223 HCNNLATYFEMN-----CLNDCRKDNPNHIAAIHNDSFLTYSMLNTKANIVAKNLIRSCNLEIPMNECLVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIII--HKKCSDIDLLSNDNSIQTVLMDTLLDE--SKIIDSFNLLPREYNPPQSREKTVVLLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWLK-QLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNKFLSVGTPISNNQVFFESNSDN------EGEVIVIGKNVS--------------------PTCGLAFQTGDVG-FIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDV-DNCYTIQLIISGRPQLVSFFTTKTEI 1587
            H NN  T +  N        +     P+H A +     +TY  LN KAN  A+ L+R   +       +  ++ D  FE +  I+  LK G  ++P+      D +  ++     ++++   K    ID  ++   +     D    E  S + DS +              T  +++TSGS+GTPK + IT      R+      +    + ++   + + F  ++ +    +L+  ++V++      +I +L   I +  VS +    +L        +D  S++         ++  GE       +K L    R+  KL+++YG TE        T Y IN++  + + + + +G+P++N  V     +         GE+ + G  +S                    P   L ++TGD+  ++ D  +   GRID  VK+ G +I   +I + + +H D+ +   T++     RP + ++ T   EI
Sbjct:   25 HFNNTKTDYPKNKTLHELFEEQAMKTPDHTALVFGAQRMTYRELNEKANQTAR-LLREKGI---GRGSIAAIIADRSFEMIIGIIGILKAGGAYLPIDPETPKDRIAFMLSDTKAAVLLTQGKAADGIDCEADIVQLDREASDGFSKEPLSSVNDSGD--------------TAYIIYTSGSTGTPKGV-ITPHYSVIRVVQNTNYIDITEDNVILQLSNYSFDGSVFDIFGALLNGASLVMIEKEALLNINRLGSAINEEKVSVMFITTALFNMIADIHVDCLSNL-------RKILFGGERASIPHVRKVLNHVGRD--KLIHVYGPTE---STVYATYYFINEI--DDEAETIPIGSPLANTSVLIMDEAGKLVPIGVPGELCIAGDGLSKGYLNREELTAEKFIPHPFIPGERL-YKTGDLAKWLPDGNIEFIGRIDHQVKIRGFRIELGEIESRLEMHEDINETIVTVREDEESRPYICAYITANREI 483          

HSP 3 Score: 87.4261 bits (215), Expect = 5.863e-16
Identity = 110/469 (23.45%), Postives = 195/469 (41.58%), Query Frame = 1
Query:  286 PNHIAAIHNDSFLTYSMLNTKANIVAKNLIRSCNLEIPMNECLVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIIIHKKCSDIDLLSN--DNSIQTVLMD----TLLDESKIIDSFNLLPREYNPPQSREKTVVLLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNKFLSVGTPISNNQVFFESNSD-------NEGEVIVIGKNVS--------------------PTCGLAFQTGDVG-FIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNCYTIQLIISGR-PQLVSFFTTKTEI 1587
            P+H A +  D  LTY  LN KAN VA+ L+R   ++    + LVG++++   + + +I+  LK G  ++P+      + ++ +     + +II    SD+ L       SI+ + MD       D S  ID+ N         QS +   V ++TSGS+G PK + I    L N   W         N+         F   + E    I +  T+ +++     D+ KL      + ++ I  +P+ + +    LDN+S        L T+++ G+          L  F   S ++VN YG TE   +    T + I+    N     + +G PI N +V+   N D         GE+ + G+ ++                    P   + ++TGD+   + D  +   GR+D  VK+ G +I   +I   ++ +  ++    I        P L ++ T K E+
Sbjct: 2139 PDHTAVVFEDQKLTYRQLNEKANQVAR-LLREKGVK---PDTLVGIMMERSSDMIAAILGVLKAGGAYLPIDPEYPPERMRYMAFDSEVKVII----SDVPLAEELTAESIELIHMDDERIAGQDRSD-IDNVN---------QSGDLAYV-IYTSGSTGKPKGVMIEHQSLINLCSWHQSCFEVGQNDNSSIYASISFDAFVWELFPYITAGATVHVLNQETRLDVEKLNRYFHDHHIT-ISFLPTPVCEQFTALDNHS--------LRTLLTGGDK---------LNVFKEKSYQIVNNYGPTE---NTVVATSFPIDKSHQN-----IPIGKPIDNVKVYI-LNKDLQLCPLGASGELCIAGEGLARGYVNRPELTREKFIGNPFVPGERM-YRTGDLAKMLPDGNIQFLGRVDQQVKIRGYRIEPGEIENRLLKYEKIEEAAVIAREDGDHDPYLCAYVTVKKEV 2560          

HSP 4 Score: 83.9593 bits (206), Expect = 6.432e-15
Identity = 96/457 (21.01%), Postives = 187/457 (40.92%), Query Frame = 1
Query:  286 PNHIAAIHNDSFLTYSMLNTKANIVAKNLIRSCNLEIPMNECLVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIIIHKKCSDIDLLSNDNSIQTVLMDTLLDESKIIDSFNLLPREYNPPQSREKTVVLLHTSGSSGTPKTIKITSAQLFNRLFWQ----WRNLPFKSNEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNKFLSVGTPISNNQVFFESNSDNE---------GEVIVIGKNVS--------------------PTCGLAFQTGDVG-FIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNCYTIQLIISGRPQ 1554
            P+H A    D  ++Y  LN +AN +A  L R   +     + + G+L +   E +  IM  LK G  ++P+      + +  I+   ++S++    C+  D+   +     ++    +D++   D    L  +  P    +    +++TSGS+G PK + I    + N +       +++L    N  V     ++F  ++ +  + +L   T+ IV    A D + L E   K +++     P+ L      +  Y D   L   +  ++  G+ L P +       F   SC + N+YG TE C D     + S    +  S    + +G P+ N  ++     D E         GE+ + G+ V+                    P   + ++TGD+  ++ D ++   GR D  VK+ G +I   ++   ++ H  +        +I+G+ Q
Sbjct: 3163 PDHPAVAFGDETISYRELNERANSLAFTL-RQKGV---GPDVIAGILTERSIEMIVGIMGILKAGGAYLPIDPAYPQERISYIVKDSDVSVL----CAAGDVDPGEAYTGDIIR---IDQTGQNDHVENLKHDIKP----QHLAYVIYTSGSTGKPKGVMIEHHSVNNLVHGLNERIYQHLDAHLN--VALVAPYIFDASVKQIFAALLFGHTLCIVPRETAWDAMSLIEYYSKNNINVSDMTPAHLN-----MLAYVDKTELEFDVKELIVGGDALTPDVIGGLFHKFPNLSCNITNVYGPTECCVDAASHQIESGKVPQTPS----IPIGRPLLNTSIYI---VDKELRPLPVGIAGELCIAGEGVARGYVNRPELTAEKFVDHPFEPGKKM-YKTGDLAMWLPDGQIEFLGRADHQVKIRGYRIELGEVEQQLLTHEKIKEA----AVIAGKDQ 3585          

HSP 5 Score: 82.4185 bits (202), Expect = 1.618e-14
Identity = 122/598 (20.40%), Postives = 238/598 (39.80%), Query Frame = 1
Query:  277 KDNPNHIAAIHNDSFLTYSMLNTKANIVAKNLIRSCNLEIPMNECLVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIIIHKKCSDIDLLSNDNSIQTVLMDTLLDESKIIDSFNLLPREYNPPQSREKTVVLLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNKFLSVGTPISNNQVFFESNSDN------EGEVIVIGKNVSP-----------------TCGLAFQTGDVGFI-ADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNCYTIQLI-ISGRPQLVSFFTTKTEIGNKTKTKMEINNILMNHSLNVCLP-RLEYIKSIPIQPQSMKPDKKMLCKIAKKILSENRRMKTKLTHGKHXXXXXXXXXXXXXXXXXXNSQKHYIYEILAKHLSLLPDEIDDSMKFYDIGGDSLTIVICIADLNRK 1992
            K  P+ +A  H+D  +TY  L+ K+N VA+ LI    +E       +GV+       + +++A LK G  ++PL  +   +    I  K N    I     D                      + I+ F+  P +       +    ++ TSGS+G PK ++IT     N +            + +   +   F  ++ +    + S  ++VI+   +  D+  L E  +K  ++   +VP+++       D Y D   L   L  ++ SG+ +   L      TF   + ++++L G+TE  G +     Y I  V  + K+  +  G P++N +++  + +        EGE+ + G  V+                    G  ++TGD G +  D  +   GR D  VK+ G ++   +I   ++ H ++     I      G   L +F   +  I     +++++   L     +  +P +   I+ IP+     K DK+ L  +A++  ++  +   ++                       N  +  + EI      L  D I+  + +Y+IGGDSL  +  I ++N++
Sbjct: 1099 KHGPDRMALKHHDEVMTYQELDEKSNQVARFLI-GKGVE---KGDYIGVIGKRSLGTIVNLLAVLKTGAAYIPLDPDYPEERKAYIQSKSNCKFFISHDVYD---------------------KEHIERFSKAPVDRK--VDLDDMAYVIFTSGSTGKPKGVQITHVPQRNTILDINEKFNVTEQDNIMGISSLCFDLSVYDVFGALSSGASLVIID--DQRDVFSLKETAEKERITIWNSVPAIMG---MTADVYPD-NELNHHLRLILLSGDWIPLQLPATIKKTF--KNAEVISLGGATE--GSIWS-IYYPIQKVEEDWKS--IPYGKPLANQKIYVLNQNKQLCPVGVEGELYIGGAGVASGYIHDQEKTEHSFIQHQELGYIYKTGDYGVLKEDGYVEFLGRKDSQVKIRGYRVEMGEIENTLVSHQEITKASVIDYTSPDGIKNLYAFVVAENAI-----SQLDVKEFLQKTLPDYMIPAKFVQIEEIPLTVNG-KVDKRTLHDLAEQHTADEGQRGGRM--------------------LPENETQAMLLEIWKDIFGL--DSINLDVSYYEIGGDSLKAISIITEINKR 1628          
BLAST of Ss-alanyl conjugating enzyme vs. UniProt/SwissProt
Match: sp|P39581|DLTA_BACSU (D-alanine--D-alanyl carrier protein ligase OS=Bacillus subtilis (strain 168) OX=224308 GN=dltA PE=1 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 3.248e-20
Identity = 92/362 (25.41%), Postives = 166/362 (45.86%), Query Frame = 1
Query:  454 SIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIIIHKKCSDIDLLSNDNSIQTVLMDTLLDESKIIDSFNLLPREYNPPQSREKTVVLLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNKFLSVGTPISNNQVFFESNS----DNEGEVIVIGKNVS------PTC----------GLAFQTGDVGFIADKKLFICGRIDDMVKVNGKKIFTKDI 1479
            S +  +K G  ++P+  +  S+ + +II+     ++IH     ID +     IQTV  + LL+      S +   +E+       +T  +++TSGS+G PK ++I++A L +   W   + P    +I  ++  F F  ++++   C+ S  T+  V+         L E ++K  ++   + PS +Q  L       D+   L    T +  GE+L  S+AK  L  F +   K+ N YG TE    V   ++   NDV   S++  +    P  N  +  E         +GE+++ G +VS      P              A++TGD GFI D ++F  GR+D  +K++G ++  ++I
Sbjct:   68 SFLGSVKAGHPYIPVDLSIPSERIAKIIESSGAELLIHAAGLSIDAVGQQ--IQTVSAEELLENEGGSVSQDQWVKEH-------ETFYIIYTSGSTGNPKGVQISAANLQSFTDWICADFPVSGGKIFLNQAPFSFDLSVMDLYPCLQSGGTLHCVTKDAVNKPKVLFEELKKSGLNVWTSTPSFVQMCLMDPGFSQDL---LPHADTFMFCGEVLPVSVAKALLERFPK--AKIFNTYGPTEAT--VAVTSVEITNDVISRSESLPVGFAKPDMNIFIMDEEGQPLPEGEKGEIVIAGPSVSRGYLGEPELTEKAFFSHEGQWAYRTGDAGFIQDGQIFCQGRLDFQIKLHGYRMELEEI 413          
BLAST of Ss-alanyl conjugating enzyme vs. UniProt/SwissProt
Match: sp|D4AU31|SWNK_ARTBC (Reducing polyketide synthase swnK OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=swnK PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 3.827e-20
Identity = 120/457 (26.26%), Postives = 211/457 (46.17%), Query Frame = 1
Query:  286 PNHIAAIHNDSFLTYSMLNTKANIVAKNLIRSCNLEIPMNECLVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIIIHKKCSDIDLLSNDNSIQTVLMDTLLDESKIIDSFNLLPREYNPPQSREKTVVLLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLP-FKSNEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPS----LLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNKFLSVGTPISNNQVFFESNSDN------EGEVIVIGKNVSPTC------------------GLAFQTGDVG-FIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNCYTIQLIISGRPQLVSF 1566
            P + A IH D+ +T+S LN  ANI+A++LI+   L+   +  LVG+ +    + +  ++A LKLG  +VP+     ++ + +++      +I+        L S  +   +V  D   D S I+D+ NL   +  P         +++TSGS+G PK ++I+     N L    +  P    ++I+   T   F  + +E L  ++S  TMVI   T   +  +L E+++++ V+ +   P+    LL+   K     S I+            GE L   LA + LA  +     + N+YG +E        T  S+  V        + VG P+ N +++   ++ +      EGE+ + G +VS                     GL F+TGD+G F+A  KL + GRID +VK+ G +I   DI   ++ H+ V    +  ++IS   +LV++
Sbjct:   47 PKNTALIHRDTEITFSELNESANILARSLIKR-GLK---HGDLVGLAVSRSIDLIVVVLAVLKLGAAYVPIDPLFPAERINQMVSDAGPKLILLSGSPSKGLASWKDICISV--DEARDSS-IVDTTNL-EADIQP----HDLSYVIYTSGSTGKPKGVEISHGAAANFLSSLRKYEPGCNEHDILLAITTISFDMSALELLLPLVSGTTMVIADTTAVKNPRELLELMRRHHVTILQATPATWTMLLESGWKGDPRLSKIICG----------GEPLTRQLADRLLAAAD----SVWNVYGPSET-------TYGSVGRVGEGD----IVVGKPVVNGRIYVLDDNLSPAPVGCEGEIYIGGGSVSNGYRNNAELTRARFLANPFHGGLFFRTGDLGRFLAPGKLQVVGRIDGVVKIRGHRIDVGDIEAVLLDHASV----SAAVVISHDDRLVAY 462          
BLAST of Ss-alanyl conjugating enzyme vs. UniProt/SwissProt
Match: sp|P94459|PPSD_BACSU (Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) OX=224308 GN=ppsD PE=1 SV=2)

HSP 1 Score: 100.908 bits (250), Expect = 4.405e-20
Identity = 138/629 (21.94%), Postives = 252/629 (40.06%), Query Frame = 1
Query:  286 PNHIAAIHNDSFLTYSMLNTKANIVAKNL-IRSCNLEIPMNECLVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIIIHKKCSDIDLLSN-DNSIQTVLMDTLLDESKIIDSFNLLPREYNPPQSREKTVVLLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNKFLSVGTPISNNQVFFESNSDNEGEVIVIGKNVSPTCGLA-------------------------FQTGDVG-FIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDV-DNCYTIQLIISGRPQLVSFFTTKTEIGNKTKTKMEINN---ILMNHSLNVCLPRLEYIKSIPIQPQSMKPDKKMLCKIAKKILSENRRMKTKLTHGKHXXXXXXXXXXXXXXXXXXNSQKHYIYEILAKHLSLLPDEIDDSMKFYDIGGDSLTIVICIADLNRKGFSCTTEVFFHNHSIGELVECILEQSNS 2076
            P   A +  D  LTY  L+  +N +A+ L  R    + P     VG+++   F  + SI+   K G  +VP+      +  + I+      +++    +D+ +L++ +  I T+       ES   D  + LP+      S      +++TSG++G PK + +    + N L W+     F   + +     F F   I    + +LS    V++   EA DI+ +   + +  ++ ++ VP L +  L  +         + +L+   +  E++  SLA  C  T      +L N YG TE           +   +R   K  ++S+G PI   QV   +++     + V G+      GLA                         ++TGD   ++AD  L   GRIDD VK+ G ++ TK+I + +     V D      +  SG+ +L ++  TK  +      + E+ N   + M+ +       +E + S+P+ P   K D+  L K       E   +                           +S+   I   + K + L  ++I  +  F+++GGDS+  +   A L+R G     +  F + +I EL   I +   S
Sbjct: 2547 PKASALVSGDKTLTYQELDEWSNGIARALRSRGVKPDTP-----VGIMMHRSFSMIASILGVWKAGGCYVPIDPEYPKERKRYILSDSGTKLLMTINEADLGVLADFEGEILTI-------ESVEEDDKSPLPQM----SSAHHLAYIIYTSGTTGRPKGVMVEHKGIANTLQWRRNAYAFNETDTILQLFSFSFDGFITSMFTPLLSGAKAVLLHEEEAKDILAIKHQLSRQRITHMIIVPVLYRALLDVVQPEDVKTLRVVTLAGEAADRELIARSLA-ICPHT------ELANEYGPTE--------NSVATTVMRHMEKQAYVSIGQPIDGTQVLILNSNHQLQPIGVAGELCIAGTGLARGYVNLPELTERAFTQNPFKPEARMYRTGDAARWMADGTLEYLGRIDDQVKIRGYRVETKEIESVIRCIKGVKDAAVVAHVTASGQTELSAYVVTKPGLSTNA-VRSELQNKLPVFMHPAF------IEKLDSLPLSPNG-KLDRGALPKPVYNHEGERPFLPP-------------------------SSKMEQILADIWKEV-LGAEKIGTADSFFELGGDSIKALQVSARLHRIGKQMAVKDLFSHPTIQELAAYIRDSDTS 3110          

HSP 2 Score: 71.633 bits (174), Expect = 3.399e-11
Identity = 109/500 (21.80%), Postives = 194/500 (38.80%), Query Frame = 1
Query:  205 ENDSYEHCNNLA-TYFEMN-----CLNDCRKDNPNHIAAIHNDSFLTYSMLNTKANIVAKNLI-RSCNLEIPMNECLVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIIIHKKCS--------DIDLLSNDNSIQTVLMDTLLDESKIIDSFNLLPREYNP-----PQSREKTVVLLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNKFLSVGTPISNNQVFFESNSDNEGEVIVIGKNVSPTCGLA-------------------------FQTGDVG-FIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNCYTIQLIISGRPQLVSF 1566
            E D  E C+    T + MN      L    +  P+  A I  D  +TY  LN +AN +A  LI R         E  V ++     E L  I   LK G  ++P+  +   + +  +++    +I++ +           +I  L+  NS                    L  R  NP     PQS      +++TSGS+G PK ++I      N L         K ++++ H+T + F  +I E      +  ++ ++      +   +A+ I++  ++ +  VPS+L  +L+ +  Y  +    + L  V S GE L   L  +        S  + N YG TE   +       +  D   + K + + +G P+ + +++  + +     V  IG+      G+A                         ++TGDV  ++ D  +   GR DD VK+ G +I   +I  A+     V          SG P+L ++
Sbjct: 1475 ERDFIESCHLFEETGYSMNQTLHYALEQQAEKTPDQAAVIFEDGVMTYKELNEQANRIAWELIGRGVK-----PETTVAIIGKRSPEMLLGIYGILKAGGAYLPIDPDYPEERISFLLEDSGTNILLLQSAGLHVPEFTGEIVYLNQTNS-------------------GLAHRLSNPNVDVLPQS---LAYVIYTSGSTGMPKGVEIEHRSAVNFLNSLQSRYQLKHSDMIMHKTSYSFDASIWELFWWPYAGASVYLLPQGGEKEPEVIAKAIEEQKITAMHFVPSMLHAFLEHI-KYRSVPIKTNRLKRVFSGGEQLGTHLVSRFYELLPNVS--ITNSYGPTEATVEA------AFFDCPPHEKLERIPIGKPVHHVRLYLLNQNQRMLPVGCIGELYIAGAGVARGYLNRPALTEERFLEDPFYPGERMYKTGDVARWLPDGNVEFLGRTDDQVKIRGYRIEPGEIEAALRSIEGVREAAVTVRTDSGEPELCAY 1938          
BLAST of Ss-alanyl conjugating enzyme vs. UniProt/SwissProt
Match: sp|F4K1G2|AEE19_ARATH (Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana OX=3702 GN=At5g35930 PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 6.257e-20
Identity = 139/556 (25.00%), Postives = 232/556 (41.73%), Query Frame = 1
Query:  412 LVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIIIHKKCSDID--LLSNDNSIQTVL--MDTLLDESKIIDSFNLLPREYNPPQSREKTVVLLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACD-IVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNKFLSVGTPISNNQVFFESNSDN--EGEVIVIG--------------------------KNVSPTCG--LAFQTGDVGF-IADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNCYTIQLIISGRPQLVS---FFTTKTEIGNKTKTKMEINNILMNHSLNVCLP-RLEYIKSIPIQPQSMKPDKKMLCKIAKKILSENRRMKTKLTHGKHXXXXXXXXXXXXXXXXXXNSQKHYIYEILAKHLSLLPDEIDDSMKFYDIGGDSLT 1959
            +V + +    E + S+ + L+ G  F+PL  +   + +  +I   N+S++I    S ++   L   N    +L  MD  L       SF    ++    + + K   L++TSGS+G PK +  T   L NR  W     P    +    +T   F+D+I E L  ILS+  +VI   T   + ++ + + +++YS+S +L VPS+++  L  L +      L S L  VV SGE  FP      L +    +C  +NLYGSTEV GD        +  +    +   + +G  ISN +V    + D   EGE+ V G                           +++  CG  L ++TGD G  ++   L   GR D  VK+NGK++  ++I T + ++ D+     + L+     +L S   F     E  +       I N +      V +P     ++ +P+   S K D + L ++          M++  T                      NS    I + +    +LL  E+ D   F+ IGGDSL 
Sbjct:    4 VVALYMPPSVEYVISVFSVLRCGEAFLPLDPSWPRERVLSLISSSNISLVIACGLSSVESHWLVERNVCPVLLFSMDEKLSVETGCSSFVWPCKK----ERQRKFCYLMYTSGSTGKPKGVCGTEQGLLNRFLWMQELYPVVGEQRFAFKTSVGFIDHIQEFLGAILSSTALVIPPFTLLKENMISIIDFLEEYSISRLLAVPSMIRAILPTLQHRGHNNKLQSCLKLVVLSGEP-FPVSLWDSLHSLLPETC-FLNLYGSTEVSGDCTYFDCSELPRLLKTEEIGSVPIGKSISNCKVVLLGDEDKPYEGEICVSGLCLSQGYMHSSIESEGYVKLHNNSLCNHLTNDCGSQLYYRTGDYGRQLSSGDLIFIGRRDRTVKLNGKRMALEEIETTLELNPDIAE--AVVLLSRDETELASLKAFVVLNKESNSSDGIIFSIRNWMGGKLPPVMIPNHFVLVEKLPLT-SSGKVDYEALARLKCPTTGAQDMMQSNGT----------------------NSLLQNIKKAVCD--ALLVKEVSDDDDFFAIGGDSLA 526          
BLAST of Ss-alanyl conjugating enzyme vs. TrEMBL
Match: N1PB61 (Carrier domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_210260 PE=4 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 1.964e-52
Identity = 196/775 (25.29%), Postives = 356/775 (45.94%), Query Frame = 1
Query:  412 LVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIIIHKKCSDIDLLSNDNSIQTVLMDTLLDESKIIDSFNLLPREYNPPQSREKTVVLLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWL--KQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNKFLSVGTPISNNQVFFESNSDNE-----GEVIVIGKNVSPTCGLAFQTGDVGFIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNCYTIQLIISGRPQLVSFFTTKTEIGNKTKTKMEINNILMNHSLNV---CLPRLEYIKSIPIQPQSMKPDKKMLCKIAKKILSENRRMKTKLT-HGKHXXXXXXXXXXXXXXXXXXNSQKHYIYEILAKHLSLLPDEIDDSMKFYDIGGDSLTIVICIADLNRKGFSCTTEVFFHNHSIGELVECILEQSNSKIRNNSDYKLFKYDMKNDFTVEQIQYENKTEIIEFLVENFYTKELVVRYLNTPVKVFVEVVSEIFDLSLRSGCSFCIRNSISKSIVGLQLSEDSSYEIPNTSQLYKLDEENSLDCFLQNCKPRIAEFLKTPK---LNVSVVALSGTLNKSIVIQLLYFIEKHTIDLAQCKNYKTIETINTSEATKKICSELNYRLIKSTSMSHFLNESQ 2694
            ++G++     ER+  ++A +K+G  FV L  +     +K +++   +  ++  +     +    + I  V    LL ++K+      +P  Y  P  ++  V +L+TSGS+G PK + + +  + NR+ W W+  PF   +  C ++  +FVD++ E L+ +L  + +++V   +  D       I +  V+ I+ VPS LQ  L    +D   D    L  ++ V+SSGE L   LAK+ L +  +NS  L N YGSTE  GD+      S+ D+   S    L++G P+ N  +  +   +       GEV V GKN+S    L ++ GD+GFI D  L+ CGR D  +K+ G +I   ++   V             +++     LV+ + T+     KT   M  + IL N    +    +P L  + ++P+Q  + K DK+ML  +           K+++T HG +                        +  I+A  L++  +E+  +  F+D+GG+SL  V  ++ LN      +   F + +SI E +E IL        NN D        ++ FT+ + + +++ E    L E F T   +   + T    F++ +S I    L  G SFCIR + ++ +V   ++ D+S  I   ++   + E N      +  +  + E LK      ++  + A++ +    + ++LL  IE   + LA+ K ++ I T+N++  T+ +  +  Y+L     +  F  ESQ
Sbjct:   75 VLGLMFSASVERVAYMLAIIKIGSAFVSLDPSLPPPRMKAMLNASRVHFVLASRTMAEYVPETPDVITLV---DLLHDTKMSSG---IP--YVIP--KDPLVAVLYTSGSTGAPKAVHLKAMNIINRVVWSWKEYPFAREDRCCMKSSPLFVDSLTELLTPLLRGIPILMVDRRDVIDTQVFLRRIHQGKVTRIVVVPSQLQAMLTMNAIDTSIDF---LEFITMVISSGEELPVGLAKQFLQS-TKNSV-LCNFYGSTETTGDIASINFSSLEDIEKRSVGDHLALGKPVINTHITIKEPVETAFGVRVGEVCVSGKNIS-GAELEYRMGDLGFIQDNHLYYCGRNDKQIKIRGHRIDANEVEKVVY---QSHPAVKQVVVVGVDTDLVAIYETEA----KTYPGMLEDEILRNCGRKLPAYMMPVLFRVDAMPLQEHTGKLDKQMLKSL----------WKSRITCHGDNS-----------------------VAAIIANVLNISQEEMKMNRSFFDLGGNSLLAVTALSKLNDHDLKISFSDFINTNSIHE-IEQILSNKTEIYSNNFD--------RSAFTIHEFREDDEVEAFGLLAEEFTTNNPLDTAIGTTKSAFLKWMSSISQEMLADGLSFCIRETKTQRLVACCVNFDTSTVINPIAEHSAVLEIN------EGVEAPVRELLKEEGGRWMDSYLNAVTSSAAPDLKVRLLTLIEDEELRLAKEKGFRGIVTVNSNLVTQCLAEDYGYQLRNQIHVKSF--ESQ 776          
BLAST of Ss-alanyl conjugating enzyme vs. TrEMBL
Match: A0A2H1VGR8 (SFRICE_007321 OS=Spodoptera frugiperda OX=7108 GN=SFRICE_007321 PE=4 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 1.695e-48
Identity = 192/833 (23.05%), Postives = 380/833 (45.62%), Query Frame = 1
Query:  322 LTYSMLNTKANIVAKNLI-----RSCNLEIPMNECLVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIIIHKKCSDIDLLSNDNSIQTVLMDTLLDESKIIDSFNLLPREYNPPQSREKTVVLLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLPFKSNEIVC-HRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATF-NRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNKFLSVGTPISNNQVFF---ESNSDNE---GEVIVIGKN--------------------VSPTCGLAFQTGDVGFIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNCYTI-QLIISGRPQLVSFFTTKTEIGNKTKTKMEINNILMNHSLNVCLPRLEYIKSIPIQPQSMKPDKKMLCKIAKKI-LSENRRMKTKLTHGKHXXXXXXXXXXXXXXXXXXNSQKHYIYEILAKHLSLLPDEIDDSMKFYDIGGDSLTIVICIADLNRKGFSCTTEVFFHNHSIGELVECILEQSNSKIRNNSDYKLFKYDMKNDFTVEQIQYENKTEIIEFLVENFYTKELVVRYLNTPVKV--FVEVVSEIFDLSLRSGCSFCIRNSISKSIVGLQLSEDSSYEIPNTSQLYKLDEENSL---DCFLQNCKPRIAEFLKTPK----LNVSVVALSGTLNKSIVIQLLYFIEKHTIDLAQCKNYKTIETINTSEATKKICSE-LNYRLIKSTSMSHFLN 2685
            ++Y+ L  + N +A+ +      +  N +    + ++ V +      + +++A  K G  +VP+  +     +  I+     +++I+ + ++  + S  + I  V  + L  E+  + +  +   E   P   E   ++L+TSGS+G PK ++++ + + NRL+WQ++  P+  +E+ C  +T   FVD++ E    +L   T+VI+S     D  KL  V+    +  ++ VP+LL+  L  L +       L  L   V SGE L   LA +    F + N  KL N YGSTEV GDV   T Y + + R    +  + +GTP++N  V+    E N  +E   GEV V G+N                    V P  G  ++TGD G +    +   GR D  +K+ G ++  +++  AV   + VD C  +   +  G P++++F T K E          I   L N   +  +P++  ++SIP+     K D++ L K+ +    +++  +  +L +     S      +              + E+L +        I     FY++GG+SL  +  I  L  KG+      F    ++GE++  +   S S  +++ + +L        F+ E +  E+K E+IE +V +FY K  + ++L   +    +  ++S+ +   +++  S  ++NS S   + + L+ D+  E P+       DE   L     FL+  +  + + +  P     L+  ++A + +L     +  +  +E  T+++A+ + +  + T NTS  T+++ ++ L Y+ +    ++ +++
Sbjct:   48 VSYAELEARTNALARAITSRAAPKGANRD---GDYVIAVCMQPTHNTITTLLATWKAGAAYVPMEPSFPQARISHILKDAEPALVIYDETANPAMFSG-SGIPAVSFEELSHEASGLSADKVKDMEALSPARSESIAIVLYTSGSTGIPKGVRLSYSAVCNRLWWQFQTFPYTDSEVHCVWKTALTFVDSVCEIWGPLLHGRTLVILSRETTRDPQKLVNVLADNQIQRLVLVPTLLRSILMYL-SLKPSERPLKHLKLWVCSGETLSKDLAAQFFKNFGDHNGYKLANFYGSTEVMGDV---TYYVLENARQLDIHPTIPIGTPLNNCAVYLLDEEMNPAHESEPGEVWVAGRNLAEGYVGGQGADKFIDNPHAVHPDFGRLYRTGDFGVLQKGVILYAGRTDSQIKIRGHRVDLQEVDRAVAGVNGVDKCVVLCYGLERGNPEILAFVTIKPE---ARIAAQHIEAALKNSLTHYMIPQVIEVESIPLLVNG-KVDRQALLKMYENTNNNDDSEIPLELDYSSVSPSDMQAAKVLFET----------VGEVLGRAAR---GAISVRAGFYELGGNSLNSIYTITRLRDKGYYIDISDFLGASNLGEVLSHM---STSPQQDDGEKEL--------FSAEPLADEHKQEVIEMIVSSFYNKAELEQFLKHEIDTNDYAVLISDTWPALIKAQLSVVLKNS-SGVPIAVALNFDARDE-PDVES----DETGGLMKIMIFLEFVESSVRDAMLPPGKGTILHSFMMATAESLTPRENVAAIRALETATMNIAKERGFHGVFTTNTSPLTQQLGTDVLGYQTLLDYQINQYVD 838          
BLAST of Ss-alanyl conjugating enzyme vs. TrEMBL
Match: A0A2A4J0M6 (Uncharacterized protein (Fragment) OS=Heliothis virescens OX=7102 GN=B5V51_8779 PE=4 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 4.979e-48
Identity = 191/830 (23.01%), Postives = 368/830 (44.34%), Query Frame = 1
Query:  322 LTYSMLNTKANIVAKNLIRSCNLEIPMNEC--LVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIIIHKKCSDIDLLSNDNSIQTVLMDTLLDESKIIDSFNLLPREYNPPQSREKTVVLLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLPFKSNEIVC-HRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATF-NRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNKFLSVGTPISNNQVFF------ESNSDNEGEVIVIGKNVS--------------------PTCGLAFQTGDVGFIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNCYTI-QLIISGRPQLVSFFTTKTEIGNKTKTKMEINNILMNHSLNVCLPRLEYIKSIPIQPQSMKPDKKMLCKIAKKILSENRRMKTKLTHGKHXXXXXXXXXXXXXXXXXXNSQKHYIYEILAKHLSLLPDEIDDSMKFYDIGGDSLTIVICIADLNRKGFSCTTEVFFHNHSIGELVECILEQSNSKIRNNSDYKLFKYDMKNDFTVEQIQYENKTEIIEFLVENFYTKELVVRYLNTPVKV--FVEVVSEIFDLSLRSGCSFCIRNSISKSIVGLQLSEDS----SYEIPNTSQLYKLDEENSLDCFLQNCKPRIAEFLKTPK----LNVSVVALSGTLNKSIVIQLLYFIEKHTIDLAQCKNYKTIETINTSEATKKICSE-LNYRLIKSTSMSHFLN 2685
            ++Y+ L  + N +A+ +        P  +   +V V +      + +++A  K G  +VP+        +  I+     S++I+   ++  + S  + + +V  + L  E+  + +  L   E       E   ++L+TSGS+G PK ++++ + + NRL+WQ+R  P+  +E+ C  +T   FVD++ E    +L   T++I+S     D  KL  V+ +  +  ++ VP+LL+  L  L +       L  L   V SGE L   LA +    F + N  KL N YGSTEV GDV    L + + + M+     + +G+P+ N  V+        +     GEV V G N++                    P  G  ++TGD G +    +   GR D  VK+ G ++  +++  AV     VD C  +   +  G P+++SF T +    +       I   L N   +  +P++  + SIP+     K D++ L K     + EN    T       +        ++   +         + E+L +        I     FY++GG+SL  +  I  L  KG+      F    ++GE++  +   S S   +++D +L        FT E +  E+K ++IE +V +FY K  + ++L   +    +  ++S+ +   + +  S  ++NS S + V + L+ D+      E   T  L K      +  FL+  +  + + +  P     L+  ++A + +L+    +  +  +E  T+ LAQ + ++ + T NTS  T+++ ++ L Y+ +    ++ +++
Sbjct:    7 ISYAELWARTNALARAITARAQPSGPNRDGDFVVAVCMQPTHNTITTLLATWKAGAAYVPMEPTFPQARISHILKDAEPSLVIYDDTANPAMFSG-SGVPSVSYEELAHEASGLSADELQDGEVLAVARSESIGIVLYTSGSTGIPKGVRLSYSAVCNRLWWQFRTFPYSDSEVNCVWKTALTFVDSVCEIWGPLLHGRTLIILSRETTRDPQKLVNVLAENQIQRLVLVPTLLRSILMYL-SLKPTERPLQHLKLWVCSGETLSKDLAAQFFKNFGDHNGYKLANFYGSTEVMGDVTYYVLENTSQLDMHPT---IPIGSPLDNCAVYLLDEEMNPARQSEPGEVWVAGANLAAGYVGGQGADKFLDNPHAAHPDFGRLYRTGDFGVLEKGVILFAGRTDSQVKIRGHRVDLQEVDRAVAAVDGVDKCVVLCYGLERGNPEILSFVTIRP---DARVAAQHIEAALKNSLTHYMIPQVIEVDSIPLLVNG-KVDRQALLK-----MYEN----TNNNDDSEIPLDIDYTSVSQSELVAARVLFETVGEVLGRAAR---GAISLKAGFYELGGNSLNSIYTITRLRDKGYYIDISDFLGASNLGEVLSHM---STSPHSDDADNEL--------FTAEPLADEHKQQVIEMIVSSFYNKAELEQFLKHEIDTNDYAVLISDTWPALISAKLSVVLKNS-SGTAVAVALNFDARDEPDVESEETGGLMK------IMIFLEFVESSVRDTMLPPGKGTILHSFMMATAESLSPRENVAAIRALEHATMTLAQEQGFRGVFTTNTSPLTQQLGTDVLGYKTLLDYQINQYVD 797          
BLAST of Ss-alanyl conjugating enzyme vs. TrEMBL
Match: A0A0R3SIC4 (Carrier domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS4687 PE=4 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 5.780e-48
Identity = 234/843 (27.76%), Postives = 363/843 (43.06%), Query Frame = 1
Query:  415 VGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIIIHKKCSDIDLLSNDNSIQ-------TVLMDTLLDESKIIDSFNLLPREYNPPQSREKTVVLL-HTSGS-SGTPKTIKITSAQLFNRLFWQWRN-LPFKS-NEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTE------ACDIVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDV-----RMNSKNKFLSVGTPISNNQVFFESNSDN----------EGEVIVIGKNV-------------------------SPTCGLAFQTGDVGFIADKK--LFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNC--------YTIQLIIS---GRPQLVSFFTTKTEIGNKTKTKMEINNILMNHSLNVCLPRLEYIKSIPIQPQSMKPDKKMLCKIAKKILSENRRMKTKLTHGKHXXXXXXXXXXXXXXXXXXNSQKHYIYEILAKHLSLLP-----DEIDDSMKFYDIGGDSLTIVICIADLNRKGFSCTTEVFFHNHSIGELVECILEQSN---------SK---IRNNSDYKLFKYDMKNDFT----VEQIQYENKTEIIEFLVENFYTKELVVRYLNTPVKVFVEVVSEI-----FDLSLRSGCSFCIRNSISKSIVGLQLSEDSSYEIPNTSQ-LYKLDEENSLDCFLQNCKPRIAEFLKTPKLNVSVVALSG-TLNKS-IVIQLLYFIEKHTIDLAQCKNYKTIETINTSEATKKICSELNY 2646
            V   L+ G  R+Y  +AC+ L L ++P+    +S+L K   D+ NL   I      I  +++D +++       T  +D LL ++   D    +P E    +  E  ++LL  TSGS S  PK + + ++QL NRL WQW    P          +T  +FVD+  E    +L    +++   +E        DI  L  +I +Y ++ I +VP+ L+ W+ Q+           SL  +VSSG+ML  +LA K  A F   + +L+NLYGSTEV GDV   +  S  +V     ++++ +  L VG PISN +++                 EGEV+  G  +                         SP     FQTGD+GF+  K   L+I GR+DD+VKVNG KI   ++     + + +D           TI L +       QLV F+ T    GNKT T  ++  I+  H ++        + + PI   S K DK  L +  K    E R + T  T  +                   + ++  I  I A++L+L        E DD+  F+ IGGDS+   + I++L +KG+     +F  N  IG+L++ +   +N         SK   IR     K F  D   D      +  I  ++  E     +     +E V +     +K F EV+  +     F LS  +G    +   +S   +G  L    + E P  S  LY+  EE       + C  R AE L+ P    S   L    LN    +IQLL  IE+  I+ A+   +  I +INTS  T+ +  EL Y
Sbjct:  111 VATYLNAGINRVYIQLACMYLRLTYIPM----DSNLPK---DRINL---IFNSFEPIAFITDDTNVKIEDIETLTFTVDELLKKANAAD----IPAEEPLFKGMENPLILLLFTSGSTSPIPKGVPLRNSQLANRLSWQWSTESPLAGITGPSLIKTSCLFVDSFTEMFGPLLGGRPIIVSGTSEITSERLVTDIEILKRLISQYQITQITSVPTQLELWMNQMAGDG---TAFKSLRVIVSSGQMLPYTLALKIFAVFGSGNLRLLNLYGSTEVAGDVTAISFDSKEEVSKAAIQLSTGSLVLPVGKPISNTEIYVVEGGTGSSSKVAPMGLEGEVLTSGAGILIEEPILTLSDKKLAPTLSRNYLMKSPCFPRLFQTGDIGFVCSKSENLYITGRVDDVVKVNGVKISVGNVD---QILAGLDRSSGKFASLGATITLALEKGETSSQLVCFYQTS---GNKTFTDRDLAAIVKTHLMSFLHVIFVEVPTFPILKHSGKIDKVKLGQNYKTGAYEKRSIVTSATKRE------------------TSDEREVIRRIFARNLALSEIAVENGEPDDNADFFLIGGDSILAAVVISELRKKGYKVNMNLFTENQKIGDLLDALTNVANPIAQSSLNGSKVPFIREFQPGKTFASDSALDAQWRNLIANILADSFVEFEPMAIAINLNRETVYQIAIGRMKQF-EVMPGLLFVAGFTLSDPNGPLNDLFPEVSAVTLGYPL---LTPESPGVSDPLYQKIEEA-----FEICNSR-AEKLEDPSKCFSSAMLGARRLNAGNDIIQLLILIEESLINGAKRLGFNAIRSINTSVVTRIMSDELGY 902          
BLAST of Ss-alanyl conjugating enzyme vs. TrEMBL
Match: A0A564ZE13 (Carrier domain-containing protein (Fragment) OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS14546 PE=4 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 7.729e-48
Identity = 234/843 (27.76%), Postives = 363/843 (43.06%), Query Frame = 1
Query:  415 VGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIIIHKKCSDIDLLSNDNSIQ-------TVLMDTLLDESKIIDSFNLLPREYNPPQSREKTVVLL-HTSGS-SGTPKTIKITSAQLFNRLFWQWRN-LPFKS-NEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTE------ACDIVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDV-----RMNSKNKFLSVGTPISNNQVFFESNSDN----------EGEVIVIGKNV-------------------------SPTCGLAFQTGDVGFIADKK--LFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNC--------YTIQLIIS---GRPQLVSFFTTKTEIGNKTKTKMEINNILMNHSLNVCLPRLEYIKSIPIQPQSMKPDKKMLCKIAKKILSENRRMKTKLTHGKHXXXXXXXXXXXXXXXXXXNSQKHYIYEILAKHLSLLP-----DEIDDSMKFYDIGGDSLTIVICIADLNRKGFSCTTEVFFHNHSIGELVECILEQSN---------SK---IRNNSDYKLFKYDMKNDFT----VEQIQYENKTEIIEFLVENFYTKELVVRYLNTPVKVFVEVVSEI-----FDLSLRSGCSFCIRNSISKSIVGLQLSEDSSYEIPNTSQ-LYKLDEENSLDCFLQNCKPRIAEFLKTPKLNVSVVALSG-TLNKS-IVIQLLYFIEKHTIDLAQCKNYKTIETINTSEATKKICSELNY 2646
            V   L+ G  R+Y  +AC+ L L ++P+    +S+L K   D+ NL   I      I  +++D +++       T  +D LL ++   D    +P E    +  E  ++LL  TSGS S  PK + + ++QL NRL WQW    P          +T  +FVD+  E    +L    +++   +E        DI  L  +I +Y ++ I +VP+ L+ W+ Q+           SL  +VSSG+ML  +LA K  A F   + +L+NLYGSTEV GDV   +  S  +V     ++++ +  L VG PISN +++                 EGEV+  G  +                         SP     FQTGD+GF+  K   L+I GR+DD+VKVNG KI   ++     + + +D           TI L +       QLV F+ T    GNKT T  ++  I+  H ++        + + PI   S K DK  L +  K    E R + T  T  +                   + ++  I  I A++L+L        E DD+  F+ IGGDS+   + I++L +KG+     +F  N  IG+L++ +   +N         SK   IR     K F  D   D      +  I  ++  E     +     +E V +     +K F EV+  +     F LS  +G    +   +S   +G  L    + E P  S  LY+  EE       + C  R AE L+ P    S   L    LN    +IQLL  IE+  I+ A+   +  I +INTS  T+ +  EL Y
Sbjct:  106 VATYLNAGINRVYIQLACMYLRLTYIPM----DSNLPK---DRINL---IFNSFEPIAFITDDTNVKIEDIETLTFTVDELLKKANAAD----IPAEEPLFKGMENPLILLLFTSGSTSPIPKGVPLRNSQLANRLSWQWSTESPLAGITGPSLIKTSCLFVDSFTEMFGPLLGGRPIIVSGTSEITSERLVTDIEILKRLISQYQITQITSVPTQLELWMNQMAGDG---TAFKSLRVIVSSGQMLPYTLALKIFAVFGSGNLRLLNLYGSTEVAGDVTAISFDSKEEVSKAAIQLSTGSLVLPVGKPISNTEIYVVEGGTGSSSKVAPMGLEGEVLTSGAGILIEEPILTLSDKKLAPTLSRNYLMKSPCFPRLFQTGDIGFVCSKSENLYITGRVDDVVKVNGVKISVGNVD---QILAGLDRSSGKFASLGATITLALEKGETSSQLVCFYQTS---GNKTFTDRDLAAIVKTHLMSFLHVIFVEVPTFPILKHSGKIDKVKLGQNYKTGAYEKRSIVTSATKRE------------------TSDEREVIRRIFARNLALSEIAVENGEPDDNADFFLIGGDSILAAVVISELRKKGYKVNMNLFTENQKIGDLLDALTNVANPIAQSSLNGSKVPFIREFQPGKTFASDSALDAQWRNLIANILADSFVEFEPMAIAINLNRETVYQIAIGRMKQF-EVMPGLLFVAGFTLSDPNGPLNDLFPEVSAVTLGYPL---LTPESPGVSDPLYQKIEEA-----FEICNSR-AEKLEDPSKCFSSAMLGARRLNAGNDIIQLLILIEESLINGAKRLGFNAIRSINTSVVTRIMSDELGY 897          
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Cavefish
Match: aasdh (aminoadipate-semialdehyde dehydrogenase [Source:NCBI gene;Acc:103042755])

HSP 1 Score: 61.2326 bits (147), Expect = 5.281e-9
Identity = 101/477 (21.17%), Postives = 187/477 (39.20%), Query Frame = 1
Query:  262 LNDCRKDNPNHIAAIHN-DSF---LTYSMLNTKANIVAKNLIRSCNLEIPMN-ECLVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNL------------------SIIIHKKCSDID-------------LLSNDNSIQTVLMDTLLDESKIIDSFNLLPREYNPPQSREKTVV--------LLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWIL-TVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNKFLSVGTPISNNQVFFESN-----SDNEGEVIVIGKN--------VSPTCGLAFQTGDVGFIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNC 1518
            L   R+   N  A +H+ DS    LTY  L T    V++ L    ++ +  + E  +G+           I+  L+L   +VPL       L  RI++KC+L                   ++  K C+                ++S+  S +T   D  + + K        P E   P +   T V        +LHTSG++G PK +K+    +   +            ++V   +   F  ++VE    + S   +++V         +LA V+ K + S +L   P+L++ +  ++    +++    S   V++ G    PSLA        RN  ++ NLYG+TEV    CC  L +      N  +  + +G P+ +  +          ++ EG+  + G++        ++   G    TGD   + +   +  GR D +VK +G+++    +         VD+C
Sbjct:   10 LQAARRHAGNTAAVLHSGDSARTCLTYRELIT----VSQQLTEQLHISVGEHREQSIGLFCTAHIHLPAWIIGVLQLPAAYVPLDPVSPPLLTLRIMEKCSLRFCLIQNSLLQQFQGAFSGLLSLKVCTTFSTSNLTLVKMQRNSVISSHPSSETQPADDQIWQKK--------PEEKQHPSAAVPTAVNQEEQLAYILHTSGTTGLPKIVKVPHKCIVPNILHLRTLFQMTPEDVVFLASPLTFDPSVVEMFLALTSGACLLMVPSAVKRMPGRLARVLFKENKSTVLQATPALVRSFGGRV--LREVVLSADSSLRVLALGGEACPSLAVLRSWKQERNKTRIFNLYGTTEVSCWACCYELPNNLLSPDNMDDGSVPLGGPLMDTALEVRDKGGGLVTEGEGQAFIGGQDRVCLLDDEITAARGTMRATGDWVMVKNSHTYYLGRKDRLVKRHGQRVNLDALQQIAESLPQVDSC 472          
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Sea Lamprey
Match: aasdh (aminoadipate-semialdehyde dehydrogenase [Source:NCBI gene;Acc:570338])

HSP 1 Score: 60.4622 bits (145), Expect = 1.502e-9
Identity = 77/345 (22.32%), Postives = 145/345 (42.03%), Query Frame = 1
Query:  721 LLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWIL-TVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNR--NSCKLVNLYGSTEVCGDVCCQTLYSINDVRM--NSKNKFLSVGTPISNNQVFFESNSD-----NEGEVIVIGKNVSPTC----------GLAFQTGDVGFIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNCYTIQLIISGRPQLVSFFTTKTEIGNKTKTKMEINNILMNHSLNVCLPRLEYIKSIPIQP 1695
            +LHTSG++G PK + +  A +   +            ++V   +   F  ++VE    + S   +++V P        L  V+ + S + +L   P+LL+++   +    D++    S   V++ G   FP L+   L T+    N  +L NLYG TEV    C  T + I    +    +   + VG P+   +V     +       +G++ + G+    TC          G    TGDVG +A + ++  GR D +VK +G+++    +       + V+ C  +  +  G+  L+  F        +     E+ ++L +H+      R + +  IP  P
Sbjct:    4 VLHTSGTTGPPKIVHVPHACIVPNITHLRSLFAMSPEDVVVLVSALTFDPSVVELFVALASGAMLLLVPPYVRRSPRDLQRVLFQRSRATVLQATPTLLRRFGAAM--LRDVVLACGSPLRVLALGGEPFPPLS--VLRTWKSMGNRTRLFNLYGITEVS---CWATCHEIPTQHLLPGCEQCAVPVGKPLLGTRVEVRDGAGLVLHHGQGQIYIGGERR--TCLLDGEAELVPGTMRATGDVGRVAGRLVYYVGRSDGLVKRHGQQLDPLLLQQTAECLAAVETCAAV--MTPGQ-TLLLLFVVPAMDALRGGIMQELASLLPSHA------RPDSVMLIPTLP 330          
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Sea Lamprey
Match: aasdh (aminoadipate-semialdehyde dehydrogenase [Source:NCBI gene;Acc:570338])

HSP 1 Score: 60.077 bits (144), Expect = 2.247e-9
Identity = 110/536 (20.52%), Postives = 206/536 (38.43%), Query Frame = 1
Query:  721 LLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVI-QKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNR--NSCKLVNLYGSTEVCGDVCCQTLYSINDVRM--NSKNKFLSVGTPISNNQVFFESNSD-----NEGEVIVIGKNVSPTC----------GLAFQTGDVGFIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNCYTIQLIISGRPQLVSFFTTKTEIGNKTKTKMEINNILMNHSLNVCLPRLEYIKSIPIQPQSMKPDKKMLCKIAKKILSENRRMKTKLTHGKHXXXXXXXXXXXXXXXXXXNSQKHYIYEILAKHLSLL-----PDEI---------------------DDSMKFYDIGGDSLTIVICIADLNRK-GFSCT--TEVFFHNHSIGELVECILEQSNSKIRNNS--DYKLFKYDMKNDFTVEQIQYENKTEII 2175
            +LHTSG++G PK + +  A +   +            ++V   +   F  ++VE    + S   +++V P        L  V+ Q+   + +   P+LL+++   +    D++    S   V++ G   FP L+   L T+    N  +L NLYG TEV    C  T + I    +    +   + VG P+   +V     +       +G++ + G+    TC          G    TGDVG +A + ++  GR D +VK +G+++    +       + V+ C  +  +  G+  L+ F    +   +    + E+ ++L +H+                     +PD  ML  I    L+         +HGK                   +++   +YE+   H+S +     PD++                     D +  F  +GGDSL +V    D+ R+ G S     ++     S   + E     +N+   N+     K+ K  ++ D   EQ   E K  ++
Sbjct:    4 VLHTSGTTGPPKIVHVPHACIVPNITHLRSLFAMSPEDVVVLVSALTFDPSVVELFVALASGAMLLLVPPYVRRSPRDLQRVLFQRSRATVLQATPTLLRRFGAAM--LRDVVLACGSPLRVLALGGEPFPPLS--VLRTWKSMGNRTRLFNLYGITEV---SCWATCHEIPTQHLLPGCEQCAVPVGKPLLGTRVEVRDGAGLVLHHGQGQIYIGGERR--TCLLDGEAELVPGTMRATGDVGRVAGRLVYYVGRSDGLVKRHGQQLDPLLLQQTAECLAAVETCAAV--MTPGQTLLLLFVVPASCNVSLAVEREELASLLPSHA---------------------RPDSVML--IPTLPLT---------SHGK-----------------VSSAELLALYEVENAHISRVGKPWEPDQLIRTLWACWQEALGRGVSAEAADLAASFLRVGGDSLGVVRLSGDVERRLGASLPGLPDLLLQYSSSSGIAENTGHSTNTNSENSGKEPRKILKRKVEGDIP-EQEAPEGKRTVM 478          
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Nematostella
Match: EDO29940 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T272])

HSP 1 Score: 93.5893 bits (231), Expect = 1.263e-19
Identity = 139/550 (25.27%), Postives = 227/550 (41.27%), Query Frame = 1
Query:  217 YEHCNNLATYFEMNCLNDCRKDNPNHIAAIHNDS-FLTYSMLNTKANIVAKNLI-RSCNLEIPMNECLVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIIIHKKCSDIDLLSNDNSIQTVLMDTLLDESKIIDSFNLLPREYNPP--QSREKTVVLLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNY--SDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSIN-----DVRMNSKNKFLSVGTPISNNQVFFESNSDN------EGEVIVIGKNVS-----------------PTCGLA------FQTGDVGF-IADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNCYTIQLIISGRPQ-LVSFF-----TTKTEIGNKTKTKMEINNILMNHSLNVCLPRLEYIKSIPIQPQSMKPDKKML 1725
            YE    L   F    L       P   A + +D   L +S LN   +I+A NL  + C       + +VG+ ++   E   + ++ LK G  ++PL  +   +LLK I +  +   II        L S   S+  +++    DE    ++  L    Y PP   S +    ++++SG++G PK I            W++ N P+K  E V     F++     E L  +L  + + ++      D   L   +QK+ ++ IL  PSL +  L    NY   DI + LSSL  V   GE++  +L  + +    +   KL+NLY  +E C DV    L ++        +  +K KF  VG  +   Q+               GE+ V G  ++                 P    A      + TGD G+ ++   L ICGR D MVK+ G  I  + +  A++    ++ C  + L   G  + LV++       TK +I    KT++    I  +  L         ++SIP+ P S K DKK L
Sbjct:    3 YEKYGCLHEIFTRQALK-----TPEKTAVVCDDGRHLNFSELNRLTDILASNLRHKGCG-----KDKVVGIYMERCLEYPIAYISALKAGGAYMPLELSYPENLLKSIFEDSSPVAIITTDELKSRLPS---SVPVLVLSKGWDERLQKENKEL---GYLPPVESSLDDLAYVVYSSGTTGKPKGIACPHRGAVFSYTWRFTNYPYKDGERVACNVFFVW-----EMLRSLLVGIPLYVIPDDIIYDPPLLLRFLQKHKITRILFTPSLFEAIL----NYEEEDINSYLSSLQVVWLCGEVVTSALRDRAMRAIPQ--IKLLNLYSISE-CHDVAVADLTNMKFQEELPEKDENKRKFCPVGKLLPGVQIVIMDKKMKPLPVGLPGEIFVGGPTLARGYLNRPELNKERFISRPASVPASVGERLYSTGDWGYMLSSGALEICGRCDSMVKIRGYSIEIQAVEAALLQLPMINACVVLALGEEGTDKYLVAYVVPEGKVTKKDIRATLKTRLPFYMIPAHFVL---------LQSIPVAP-SGKLDKKRL 514          
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Nematostella
Match: EDO25952 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TDA1])

HSP 1 Score: 76.2554 bits (186), Expect = 3.708e-15
Identity = 71/283 (25.09%), Postives = 120/283 (42.40%), Query Frame = 1
Query:  721 LLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNKFLSVGTPISNNQVFFESNSDN------EGEVIVIGKNVS-------------------PTCGLAFQTGDVG-FIADKKLFICGRIDDMVKVNGKKIFTKDISTAV 1491
            +++TSGS+G PK   I    + NRLFW          + +  +T + F  ++ E    ++    +V   P    D   L ++I+   ++ +  VPS+LQ +L+             S+  V  SGE L   L ++   +F  +S +L NLYG TE   DV           +    +  + +G P++N Q++   N  N       GE+ + G  V+                      G  ++TGD+G  + D  +   GRID  VK+ G +I   +I  A+
Sbjct:    4 MIYTSGSTGKPKGAMIEHRSIVNRLFWMQDEYKVDKTDKILQKTPYSFDVSVWEFFLPLMQGAQLVFAKPEGHKDPGYLIDLIESEKITILHFVPSMLQVFLE-----VKTKLQCKSIKKVFCSGEALPFELVQRFFKSF--DSAELHNLYGPTEAAVDVTYW------HCKREDSSGIIPIGFPVANTQIYVLDNYGNIVPDGVIGEIHIGGIQVARGYHNKESLTNEKFVKDPFSEHGKLYKTGDLGRRLKDGSVEYKGRIDFQVKIRGMRIELGEIEAAL 273          
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Nematostella
Match: EDO33420 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS95])

HSP 1 Score: 68.1662 bits (165), Expect = 1.525e-11
Identity = 104/461 (22.56%), Postives = 190/461 (41.21%), Query Frame = 1
Query:  286 PNHIAAIHNDSFLTYSMLNTKANIVAKNLIRSCNLEIPMNECLVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIIIHKKCSDIDLLSNDNSIQTVLMDTLLDESKIIDSFNLLPREYNPPQSREKTVV-------LLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKC---LATFNRNSCKLVNLYGSTE--VCGDVCCQTLYSINDVRMNSKNKFLSVGTPISN-NQVFFESN-----SDNEGEVIVIGKNVSPTC-----------------GLAFQTGD-VGFIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNCYTIQLIISGRPQLV 1560
            PN+IA    +  ++Y  L+ K+N  A+ LI    +++   E +V +LL    E   ++++ LK G  +V +        L  I+   N   +I  K  + +   +D     +   ++LD    I S  L  +  + P +   TVV       +++TSGS+G PK ++I    + N +  +    P  S + +C      F  ++ E      +  T+V   P        L + +++  ++ + TVP+LL+          D+     +   ++  G        + C   L  +  +   L+N YG TE  V    C        +++   + K +++G P+ N N    +SN      + EGE+ + GK ++                    G  ++TGD V +  D ++   GRIDD VK+ G ++    I T +    +V     + L  S   QLV
Sbjct:   42 PNNIAVELKNRQMSYEALDQKSNRFARLLIEKFGIKVE-EERVVAILLPRCPELYLTMLSVLKAGGAYVCIDPQHQISRLPYILQDTNAVALITTKQVESEFGLSD-----LTKVSILD----IQSRALNTQIASKPSNALATVVPSSHLCYIIYTSGSTGQPKGVEIEHRTVVNFIKGELEIFPVWSQDRICQGFSPSFDASVEEIWLAFGTGATLVAAPPEVMQSGPDLPDHLEQLRITVLSTVPTLLRT--------VDVTDTKLNRLKLIILG-------GEACGEDLVAWA-DGRMLINSYGPTETTVVATTC--------EIK---RGKKITIGRPLGNYNAHILDSNLVDVEGEKEGELCISGKCLARGYRNLPEKTKQQFVDHQLHGRIYRTGDLVRWTPDGEIEYLGRIDDQVKIRGFRVEIGSIETHLQRQENVKMAAVVVLSPSPGQQLV 465          
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Medaka
Match: aasdh (aminoadipate-semialdehyde dehydrogenase [Source:NCBI gene;Acc:101171235])

HSP 1 Score: 57.7658 bits (138), Expect = 6.123e-8
Identity = 100/465 (21.51%), Postives = 183/465 (39.35%), Query Frame = 1
Query:  721 LLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVIQK-YSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNKF-LSVGTPISNNQVFFESN-----SDNEGEVIVIGKN----------VSPTCGLAFQTGDVGFIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNCYTIQLIISGRPQLVSFFTTKTEIGNKTKTKMEINNI-------------------LMNHSLNVCLPR------LEYIKSIPIQPQSMKPDKKMLCKIAKKILSENRRMKTKLTHGKHXXXXXXXXXXXXXXXXXXNSQKHYIYEILAKHLSLLPD-EIDDSMKFYDIGGDSLTIVICIADLN 1986
            +LHTSG++G PKT+++    +   +      L   ++++V   +   F  ++V+    + S   ++IV         +LA ++ K + V+ +   PSLL ++  +     + L+  SSL  +   GE   P    +        +C + NLYG TEV    CC   Y I +  + S +   + +G P+ + +V          ++ EG++ + G +          V P  G    TGD   I D++L   GR D  +K NGK++    +   ++   +V  C    L +    +L++F  +      +  +  E++ +                    +   L+V LP       LE + ++P+ P   K D      +A   L E +R       G+                   +  K  +  +    L L  D ++D+   F   GGDSL  V    D+ 
Sbjct:  188 VLHTSGTTGPPKTVRVPHTCIVPNILHLRSLLQMSASDVVFLASPLTFDPSVVDIFLALSSGAQLLIVPSLIKKTPRRLAGLLFKDHKVTVLQVTPSLLLRFGHRTLK-EEALSPGSSLRVLALGGEACPPPALLRSWKHQENKTC-IFNLYGITEVSCWACC---YKIPETLLQSSDPGEVPLGAPLMDTEVEVRDELGRVVTEGEGQLFLGGGDRVCLLDGESTVVP--GTMRATGDWVKIRDQQLHYQGRKDRTIKRNGKRVNLDRLQQLLLGLPEVAAC---ALGLHSSSRLLAFVVSAGAAERRCSSSAELDLLSSVRQQSEEVRGAGGDGKRRILEQLSVLLPSHGIPDTLELLPALPVTPHG-KVD-----MVALMTLYERQREHLGFPRGE------------------AHKLKQRLQALWKDALGLPGDADLDEQSNFLQSGGDSLKAVRLCEDIG 618          
BLAST of Ss-alanyl conjugating enzyme vs. Planmine SMEST
Match: SMESG000023215.1 (SMESG000023215.1)

HSP 1 Score: 1680.61 bits (4351), Expect = 0.000e+0
Identity = 857/867 (98.85%), Postives = 861/867 (99.31%), Query Frame = 1
Query:  157 MKVMNQLSNTSHCLYGENDSYEHCNNLATYFEMNCLNDCRKDNPNHIAAIHNDSFLTYSMLNTKANIVAKNLIRSCNLEIPMNECLVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIIIHKKCSDIDLLSNDNSIQTVLMDTLLDESKIIDSFNLLPREYNPPQSREKTVVLLHTSGSSGTPKTIKITSAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNYSDIXXXXXXXXXXXXXGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNKFLSVGTPISNNQVFFESNSDNEGEVIVIGKNVSPTCGLAFQTGDVGFIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSDVDNCYTIQLIISGRPQLVSFFTTKTEIGNKTKTKMEINNILMNHSLNVCLPRLEYIKSIPIQPQSMKPDKKMLCKIAKKILSENRRMKTKLTHGKHXXXXXXXXXXXXXXXXXXNSQKHYIYEILAKHLSLLPDEIDDSMKFYDIGGDSLTIVICIADLNRKGFSCTTEVFFHNHSIGELVECILEQSNSKIRNNSDYKLFKYDMKNDFTVEQIQYENKTEIIEFLVENFYTKELVVRYLNTPVKVFVEVVSEIFDLSLRSGCSFCIRNSISKSIVGLQLSEDSSYEIPNTSQLYKLDEENSLDCFLQNCKPRIAEFLKTPKLNVSVVALSGTLNKSIVIQLLYFIEKHTIDLAQCKNYKTIETINTSEATKKICSELNYRLIKSTSMSHFLNESQCQYLRSLSMSDVYGHYMVLDL 2757
            MKVMNQLSNTSHCLYGENDSYEHCNNLATYFEMNCLNDCRKDNPNHIAAIHNDSFLTYSMLNTKANIVAKNLIRSCNLEIP+NECLVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIIIHKKCSDIDLLSNDNSIQTVLMDTLLDESKIIDSFNLLPREYNPPQSREKTVVLLHTSGSSGTPK IKITSAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNYSDILALLSSLSTVVSSGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNKFLSVGTPISNNQVFFESNSDNEGEVIVIGKNVSPTCGLAFQTGDVGFIADKKL+ICGR+DDMVKVNGKKIFTKDISTAVMVHSDVDNCYTIQLIISGRPQLVSFFTTKTEIGNKTKTKMEINNILMNHSLNVCLPRLEYIKSIPIQPQSMKPDKKMLCKIAKKILSENRRMKTKLTHGKHLLSSQTTLDLTDGLIDDI SQK YIYEILAKHLSLLPDEIDDSM FYDIGGDSLTIVICIADLNRKGFSCTTEVFFHNHSIGELVECILEQSNSKIRNNSDYKLFKYDMKNDFTVEQIQYENKTEIIEFLVENFYTKELVVRYLNTPVKVFVEVVSEIFDLSLRSGCSFCIRNSISKSIVGLQLSEDSSYEIPNTSQLYKLDEENSLDCFLQNCKPRIAEFLKTPKLNVSVVALSGTLNKSIVIQLLYFIEKHTIDLAQCKNYKTIETINTSEATKKICSELNYRLIKSTS+SHFLNE QCQYLRSLSM DVYGHYMVLDL
Sbjct:    1 MKVMNQLSNTSHCLYGENDSYEHCNNLATYFEMNCLNDCRKDNPNHIAAIHNDSFLTYSMLNTKANIVAKNLIRSCNLEIPINECLVGVLLDEGFERLYSIMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIIIHKKCSDIDLLSNDNSIQTVLMDTLLDESKIIDSFNLLPREYNPPQSREKTVVLLHTSGSSGTPKAIKITSAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSCILSTVTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNYSDILALLSSLSTVVSSGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCCQTLYSINDVRMNSKNKFLSVGTPISNNQVFFESNSDNEGEVIVIGKNVSPTCGLAFQTGDVGFIADKKLYICGRVDDMVKVNGKKIFTKDISTAVMVHSDVDNCYTIQLIISGRPQLVSFFTTKTEIGNKTKTKMEINNILMNHSLNVCLPRLEYIKSIPIQPQSMKPDKKMLCKIAKKILSENRRMKTKLTHGKHLLSSQTTLDLTDGLIDDIKSQKRYIYEILAKHLSLLPDEIDDSMNFYDIGGDSLTIVICIADLNRKGFSCTTEVFFHNHSIGELVECILEQSNSKIRNNSDYKLFKYDMKNDFTVEQIQYENKTEIIEFLVENFYTKELVVRYLNTPVKVFVEVVSEIFDLSLRSGCSFCIRNSISKSIVGLQLSEDSSYEIPNTSQLYKLDEENSLDCFLQNCKPRIAEFLKTPKLNVSVVALSGTLNKSIVIQLLYFIEKHTIDLAQCKNYKTIETINTSEATKKICSELNYRLIKSTSISHFLNECQCQYLRSLSMLDVYGHYMVLDL 867          
The following BLAST results are available for this feature:
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AASDH2.127e-1121.17aminoadipate-semialdehyde dehydrogenase [Source:HG... [more]
AASDH2.217e-1121.17aminoadipate-semialdehyde dehydrogenase [Source:HG... [more]
AASDH3.797e-1121.17aminoadipate-semialdehyde dehydrogenase [Source:HG... [more]
AASDH1.438e-925.26aminoadipate-semialdehyde dehydrogenase [Source:HG... [more]
AASDH2.051e-925.26aminoadipate-semialdehyde dehydrogenase [Source:HG... [more]
back to top
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
acs-111.197e-621.63Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
acs-111.197e-621.63Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
back to top
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
e3.451e-3821.57gene:FBgn0000527 transcript:FBtr0084106[more]
back to top
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
aasdh1.335e-623.89aminoadipate-semialdehyde dehydrogenase [Source:NC... [more]
aasdh1.386e-623.89aminoadipate-semialdehyde dehydrogenase [Source:NC... [more]
back to top
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rapsn5.071e-1221.15receptor associated protein of the synapse [Source... [more]
rapsn1.137e-1020.77receptor associated protein of the synapse [Source... [more]
rapsn1.228e-919.92receptor associated protein of the synapse [Source... [more]
rapsn1.312e-721.88receptor associated protein of the synapse [Source... [more]
back to top
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Aasdh2.088e-1622.54aminoadipate-semialdehyde dehydrogenase [Source:MG... [more]
Aasdh6.435e-1622.79aminoadipate-semialdehyde dehydrogenase [Source:MG... [more]
Aasdh6.435e-1622.79aminoadipate-semialdehyde dehydrogenase [Source:MG... [more]
Aasdh1.888e-923.56aminoadipate-semialdehyde dehydrogenase [Source:MG... [more]
back to top
BLAST of Ss-alanyl conjugating enzyme vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O68006|BACA_BACLI1.104e-2023.06Bacitracin synthase 1 OS=Bacillus licheniformis OX... [more]
sp|P39581|DLTA_BACSU3.248e-2025.41D-alanine--D-alanyl carrier protein ligase OS=Baci... [more]
sp|D4AU31|SWNK_ARTBC3.827e-2026.26Reducing polyketide synthase swnK OS=Arthroderma b... [more]
sp|P94459|PPSD_BACSU4.405e-2021.94Plipastatin synthase subunit D OS=Bacillus subtili... [more]
sp|F4K1G2|AEE19_ARATH6.257e-2025.00Putative acyl-activating enzyme 19 OS=Arabidopsis ... [more]
back to top
BLAST of Ss-alanyl conjugating enzyme vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
N1PB611.964e-5225.29Carrier domain-containing protein OS=Capitella tel... [more]
A0A2H1VGR81.695e-4823.05SFRICE_007321 OS=Spodoptera frugiperda OX=7108 GN=... [more]
A0A2A4J0M64.979e-4823.01Uncharacterized protein (Fragment) OS=Heliothis vi... [more]
A0A0R3SIC45.780e-4827.76Carrier domain-containing protein OS=Hymenolepis d... [more]
A0A564ZE137.729e-4827.76Carrier domain-containing protein (Fragment) OS=Hy... [more]
back to top
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
aasdh5.281e-921.17aminoadipate-semialdehyde dehydrogenase [Source:NC... [more]
back to top
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
aasdh1.502e-922.32aminoadipate-semialdehyde dehydrogenase [Source:NC... [more]
aasdh2.247e-920.52aminoadipate-semialdehyde dehydrogenase [Source:NC... [more]
back to top
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO299401.263e-1925.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO259523.708e-1525.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334201.525e-1122.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ss-alanyl conjugating enzyme vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
aasdh6.123e-821.51aminoadipate-semialdehyde dehydrogenase [Source:NC... [more]
back to top
BLAST of Ss-alanyl conjugating enzyme vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000023215.10.000e+098.85SMESG000023215.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020538 ID=SMED30020538|Name=Ss-alanyl conjugating enzyme|organism=Schmidtea mediterranea sexual|type=transcript|length=2768bp
AACTGGTCAACTGGTCAACTGGTCAACTGATCAGCCGGCCGACTGCATTT
TGAAACACAATCAAGTTGATGCAGTCCGCATCTGTAATTGTGTTACATAA
ACTTGGAATCGCCTATTTAAGGACGTCAAAAGAGTTGGCTAAATAAATTT
GTCTGAATGAAAGTTATGAATCAATTATCAAATACTTCTCACTGCCTTTA
TGGTGAAAATGATAGCTATGAGCACTGCAATAATCTGGCTACGTATTTTG
AAATGAACTGCCTAAATGATTGCCGCAAGGACAACCCTAATCACATCGCC
GCAATTCATAACGATTCATTCCTAACTTATAGCATGTTGAATACCAAGGC
TAATATTGTGGCAAAGAATCTTATCAGATCCTGTAACTTGGAGATTCCGA
TGAATGAATGTCTAGTAGGAGTTCTACTGGATGAAGGCTTTGAGAGGCTT
TATTCGATAATGGCCTGTTTGAAATTGGGTCTCGTATTCGTTCCATTGGC
GAAAAACAGAAATTCTGACCTTCTCAAACGAATCATTGACAAGTGCAATT
TATCGATAATAATCCACAAAAAGTGCTCAGACATCGATCTGTTATCAAAC
GACAACAGCATTCAAACGGTGCTAATGGACACATTGCTAGACGAGTCGAA
AATTATTGACTCATTTAACCTTCTTCCGCGAGAATATAATCCTCCGCAAT
CCCGGGAGAAAACCGTGGTTTTGTTACATACTTCCGGCAGTTCCGGTACT
CCGAAAACGATAAAGATCACTAGTGCACAATTATTTAATCGCCTATTTTG
GCAATGGAGAAATTTACCTTTTAAAAGTAATGAAATCGTTTGCCACAGAA
CAGGATTTATGTTTGTTGATAACATTGTGGAGTGTCTGAGTTGTATCCTT
TCGACCGTGACAATGGTCATTGTGTCTCCAACTGAGGCTTGCGATATCGT
CAAGCTGGCAGAAGTCATCCAGAAATATTCAGTCAGTTGGATTCTGACTG
TTCCTTCGTTGTTGCAAAAATGGTTAAAACAGTTGGATAATTATTCGGAT
ATCCTTGCATTATTGTCTTCTTTGTCGACTGTCGTAAGCAGCGGTGAAAT
GCTTTTCCCGTCGTTGGCGAAAAAATGCCTCGCGACCTTCAATCGAAACA
GTTGCAAGTTAGTGAATCTTTACGGCTCAACGGAAGTTTGCGGAGACGTT
TGTTGTCAGACTCTTTACAGTATCAATGACGTTAGAATGAACTCGAAAAA
TAAATTTTTATCCGTTGGCACACCCATTTCAAACAATCAAGTATTTTTTG
AATCCAACTCGGATAACGAAGGAGAGGTTATCGTAATTGGAAAGAACGTA
TCACCGACTTGTGGACTGGCTTTCCAAACTGGAGATGTCGGTTTTATAGC
TGATAAAAAACTATTTATTTGCGGCCGAATCGATGACATGGTGAAGGTAA
ATGGGAAGAAGATATTCACTAAAGATATCAGTACAGCCGTTATGGTCCAC
TCTGACGTTGACAACTGCTATACAATTCAACTGATTATAAGTGGGAGACC
CCAATTGGTTTCGTTTTTTACAACCAAGACTGAAATTGGAAATAAAACAA
AAACCAAGATGGAAATCAACAATATCCTTATGAATCATTCTTTGAACGTT
TGTCTACCAAGATTGGAATACATCAAAAGTATCCCGATTCAGCCTCAGTC
TATGAAACCAGACAAAAAGATGCTCTGTAAGATTGCGAAGAAGATTTTGT
CAGAAAATCGTCGAATGAAAACGAAATTAACTCATGGGAAGCATTTGCTC
TCATCCCAAACCACTCTAGACCTAACCGACGGCCTAATCGACGACATTAA
TTCTCAAAAACACTATATCTATGAGATTTTAGCTAAGCATCTCAGCCTCT
TGCCAGATGAAATCGACGATTCCATGAAATTCTACGATATTGGTGGTGAC
TCTTTAACCATTGTCATATGCATCGCTGACCTCAACCGAAAAGGATTCAG
TTGCACTACAGAAGTGTTCTTTCACAACCATTCCATCGGTGAGTTGGTCG
AATGCATTCTCGAACAGTCAAATTCGAAAATCCGAAACAATTCCGATTAT
AAACTCTTCAAGTATGACATGAAGAACGATTTTACTGTCGAACAAATCCA
ATATGAAAACAAAACAGAAATCATTGAGTTTTTAGTTGAAAACTTCTACA
CAAAAGAGCTCGTCGTTAGATATTTAAACACCCCTGTGAAAGTTTTCGTT
GAAGTAGTTTCGGAAATCTTTGATTTATCATTGCGATCCGGGTGCTCGTT
TTGCATAAGAAATTCCATTTCAAAATCTATTGTTGGCCTCCAACTATCGG
AGGATAGCTCCTATGAAATTCCTAACACCAGTCAGTTGTACAAGTTGGAT
GAGGAAAATTCTTTGGACTGCTTTCTTCAGAACTGTAAACCAAGAATTGC
GGAATTTCTCAAAACTCCAAAGCTAAACGTGTCGGTTGTGGCGCTTTCAG
GAACTCTGAACAAATCAATCGTCATTCAATTGTTGTATTTCATTGAAAAG
CACACAATCGATTTAGCACAGTGTAAAAATTACAAAACTATCGAGACAAT
CAACACGTCTGAAGCAACGAAGAAAATCTGCAGTGAACTCAACTACAGAC
TTATCAAATCTACCTCTATGAGCCATTTTCTAAACGAGTCTCAATGTCAA
TATTTGCGCTCACTTTCAATGTCGGATGTTTATGGACACTATATGGTTTT
AGATTTGTGAATTTTGCA
back to top

protein sequence of SMED30020538-orf-1

>SMED30020538-orf-1 ID=SMED30020538-orf-1|Name=SMED30020538-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=868bp
MKVMNQLSNTSHCLYGENDSYEHCNNLATYFEMNCLNDCRKDNPNHIAAI
HNDSFLTYSMLNTKANIVAKNLIRSCNLEIPMNECLVGVLLDEGFERLYS
IMACLKLGLVFVPLAKNRNSDLLKRIIDKCNLSIIIHKKCSDIDLLSNDN
SIQTVLMDTLLDESKIIDSFNLLPREYNPPQSREKTVVLLHTSGSSGTPK
TIKITSAQLFNRLFWQWRNLPFKSNEIVCHRTGFMFVDNIVECLSCILST
VTMVIVSPTEACDIVKLAEVIQKYSVSWILTVPSLLQKWLKQLDNYSDIL
ALLSSLSTVVSSGEMLFPSLAKKCLATFNRNSCKLVNLYGSTEVCGDVCC
QTLYSINDVRMNSKNKFLSVGTPISNNQVFFESNSDNEGEVIVIGKNVSP
TCGLAFQTGDVGFIADKKLFICGRIDDMVKVNGKKIFTKDISTAVMVHSD
VDNCYTIQLIISGRPQLVSFFTTKTEIGNKTKTKMEINNILMNHSLNVCL
PRLEYIKSIPIQPQSMKPDKKMLCKIAKKILSENRRMKTKLTHGKHLLSS
QTTLDLTDGLIDDINSQKHYIYEILAKHLSLLPDEIDDSMKFYDIGGDSL
TIVICIADLNRKGFSCTTEVFFHNHSIGELVECILEQSNSKIRNNSDYKL
FKYDMKNDFTVEQIQYENKTEIIEFLVENFYTKELVVRYLNTPVKVFVEV
VSEIFDLSLRSGCSFCIRNSISKSIVGLQLSEDSSYEIPNTSQLYKLDEE
NSLDCFLQNCKPRIAEFLKTPKLNVSVVALSGTLNKSIVIQLLYFIEKHT
IDLAQCKNYKTIETINTSEATKKICSELNYRLIKSTSMSHFLNESQCQYL
RSLSMSDVYGHYMVLDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000208testis
Vocabulary: INTERPRO
TermDefinition
IPR042099AMP-dep_Synthh-like_sf
IPR036736ACP-like_sf
IPR009081PP-bd_ACP
IPR000873AMP-dep_Synth/Lig
IPR020845AMP-binding_CS
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000873AMP-dependent synthetase/ligasePFAMPF00501AMP-bindingcoord: 41..431
e-value: 3.3E-46
score: 157.8
NoneNo IPR availableGENE3DG3DSA:3.40.630.30coord: 659..863
e-value: 3.5E-14
score: 55.1
NoneNo IPR availableGENE3DG3DSA:3.30.300.30coord: 426..525
e-value: 7.0E-5
score: 25.5
NoneNo IPR availablePANTHERPTHR43171FAMILY NOT NAMEDcoord: 47..714
NoneNo IPR availablePANTHERPTHR43171:SF1EBONYcoord: 47..714
NoneNo IPR availableCDDcd05930A_NRPScoord: 44..476
e-value: 4.3685E-46
score: 169.631
NoneNo IPR availableSUPERFAMILYSSF56801Acetyl-CoA synthetase-likecoord: 30..530
IPR042099AMP-dependent synthetase-like superfamilyGENE3DG3DSA:3.40.50.12780coord: 33..425
e-value: 2.6E-56
score: 193.0
IPR009081Phosphopantetheine binding ACP domainPFAMPF00550PP-bindingcoord: 570..634
e-value: 8.3E-10
score: 38.9
IPR009081Phosphopantetheine binding ACP domainPROSITEPS50075CARRIERcoord: 565..638
score: 10.604
IPR036736ACP-like superfamilyGENE3DG3DSA:1.10.1200.10coord: 562..645
e-value: 1.2E-7
score: 33.3
IPR036736ACP-like superfamilySUPERFAMILYSSF47336ACP-likecoord: 568..638
IPR020845AMP-binding, conserved sitePROSITEPS00455AMP_BINDINGcoord: 189..200