Ribonuclease t2

Overview
NameRibonuclease t2
Smed IDSMED30020534
Length (bp)994
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ribonuclease t2 (SMED30020534) t-SNE clustered cells

Violin plots show distribution of expression levels for Ribonuclease t2 (SMED30020534) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ribonuclease t2 (SMED30020534) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ribonuclease t2 (SMED30020534) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020534

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30020534SMESG000048912.1 Contig5956newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30020534SMESG000048912.1 Contig5956uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30020534SMESG000048912.1 SMESG000020005.1 dd_Smed_v4_172_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020534SMESG000048912.1 SMESG000020005.1 dd_Smed_v4_172_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020534SMESG000048912.1 SMESG000020005.1 dd_Smed_v6_172_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ribonuclease t2 vs. Ensembl Human
Match: RNASET2 (ribonuclease T2 [Source:HGNC Symbol;Acc:HGNC:21686])

HSP 1 Score: 97.4413 bits (241), Expect = 4.091e-23
Identity = 55/165 (33.33%), Postives = 95/165 (57.58%), Query Frame = 3
Query:  144 DWDYLVMAVEWPPSFCYTFPKKIQ--CCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEW----NPLGNCSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQC 620
            +W  L+M   WP + C    +KIQ  C D      W +HGLWP  S+G     C  +  ++ +++K ++ ++   W    +   N S+ FWKHEW+ HGTCA+    L+++ +YF  ++++ + +DL ++L +  +KP  N  Y+V+DF + + +VY V PK+QC
Sbjct:   33 EWKKLIMVQHWPETVC----EKIQNDCRDPPDY--WTIHGLWPDKSEG-----CNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSR-FWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSIN-YYQVADFKDALARVYGVIPKIQC 184          
BLAST of Ribonuclease t2 vs. Ensembl Human
Match: RNASET2 (ribonuclease T2 [Source:HGNC Symbol;Acc:HGNC:21686])

HSP 1 Score: 97.4413 bits (241), Expect = 4.383e-23
Identity = 55/165 (33.33%), Postives = 95/165 (57.58%), Query Frame = 3
Query:  144 DWDYLVMAVEWPPSFCYTFPKKIQ--CCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEW----NPLGNCSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQC 620
            +W  L+M   WP + C    +KIQ  C D      W +HGLWP  S+G     C  +  ++ +++K ++ ++   W    +   N S+ FWKHEW+ HGTCA+    L+++ +YF  ++++ + +DL ++L +  +KP  N  Y+V+DF + + +VY V PK+QC
Sbjct:   33 EWKKLIMVQHWPETVC----EKIQNDCRDPPDY--WTIHGLWPDKSEG-----CNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSR-FWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSIN-YYQVADFKDALARVYGVIPKIQC 184          
BLAST of Ribonuclease t2 vs. Ensembl Human
Match: RNASET2 (ribonuclease T2 [Source:HGNC Symbol;Acc:HGNC:21686])

HSP 1 Score: 97.4413 bits (241), Expect = 4.383e-23
Identity = 55/165 (33.33%), Postives = 95/165 (57.58%), Query Frame = 3
Query:  144 DWDYLVMAVEWPPSFCYTFPKKIQ--CCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEW----NPLGNCSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQC 620
            +W  L+M   WP + C    +KIQ  C D      W +HGLWP  S+G     C  +  ++ +++K ++ ++   W    +   N S+ FWKHEW+ HGTCA+    L+++ +YF  ++++ + +DL ++L +  +KP  N  Y+V+DF + + +VY V PK+QC
Sbjct:   33 EWKKLIMVQHWPETVC----EKIQNDCRDPPDY--WTIHGLWPDKSEG-----CNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSR-FWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSIN-YYQVADFKDALARVYGVIPKIQC 184          
BLAST of Ribonuclease t2 vs. Ensembl Human
Match: RNASET2 (ribonuclease T2 [Source:HGNC Symbol;Acc:HGNC:21686])

HSP 1 Score: 91.6633 bits (226), Expect = 2.733e-21
Identity = 53/159 (33.33%), Postives = 91/159 (57.23%), Query Frame = 3
Query:  162 MAVEWPPSFCYTFPKKIQ--CCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEW----NPLGNCSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQC 620
            M   WP + C    +KIQ  C D      W +HGLWP  S+G     C  +  ++ +++K ++ ++   W    +   N S+ FWKHEW+ HGTCA+    L+++ +YF  ++++ + +DL ++L +  +KP  N  Y+V+DF + + +VY V PK+QC
Sbjct:    1 MVQHWPETVC----EKIQNDCRDPPDY--WTIHGLWPDKSEG-----CNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSR-FWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSIN-YYQVADFKDALARVYGVIPKIQC 146          
BLAST of Ribonuclease t2 vs. Ensembl Human
Match: AL159163.1 (novel protein)

HSP 1 Score: 81.6481 bits (200), Expect = 7.475e-18
Identity = 52/181 (28.73%), Postives = 93/181 (51.38%), Query Frame = 3
Query:  144 DWDYLVMAVEWPPSFCYTFPKKIQ--CCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEW----NPLGNCSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTHYKGKIYILAMEFCF 668
            +W  L+M   WP + C    +KIQ  C D      W +HGLWP  S+G     C  +  ++ +++K ++ ++   W    +   N S+ FWKHEW+ HGTCA+    L+++ +YF  ++++ + +DL ++L +  +KP  N      + +N+      VEP  + T  +  I++L     F
Sbjct:   14 EWKKLIMVQHWPETVC----EKIQNDCRDPPDY--WTIHGLWPDKSEG-----CNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSR-FWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQTTEEDLNL-----DVEPTTEDTAEEVTIHVLLHSALF 177          
BLAST of Ribonuclease t2 vs. Ensembl Celegans
Match: rnst-2 (pep chromosome:WBcel235:V:1061595:1067908:1 gene:WBGene00019624.1 transcript:K10C9.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:rnst-2)

HSP 1 Score: 97.4413 bits (241), Expect = 2.514e-23
Identity = 72/233 (30.90%), Postives = 106/233 (45.49%), Query Frame = 3
Query:  141 EDWDYLVMAVEWPPSFCYTFPKKI--QCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASA-YDEKKLKPIMEDLLKEWNPL--GNCSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEP-KLQCTH-YKGKIYILA-MEFCFDTKLNIIMCPKRHKSEDHLSR-HRNKCRKPRNSTNPIHIPCTTGFLYQP 812
            E +DYL+    +P + C      +   C   S    W++HGLWP+   GS P  C+     +DE  +K I + L+  W  L      + FWKHE+  HGTCA   KL  +EL YF E +++   +D+   L   +V P + K    SD  N +  V   +  +  C    K K ++L  +  C +  L I  CP   K  + +SR  R+  R  R    P   PC   F+Y P
Sbjct:   21 EPFDYLMFTTIYPTAVCRADDDSVPESCEIPSGTPQWSIHGLWPNFENGSYPQNCRGTPRHFDENLIKSIEDRLVVVWPNLYPKKTIQSFWKHEYDKHGTCAQSEKLFESELAYFTEVMKVFDSIDVAGGL--KSVGP-SEKPITSSDLKNALSGVTSGKTFQFHCLRDKKTKQFLLGDIRLCLNKDLTIRDCPTDGKHPNRVSRFERSIGRNRRGPPLPSFQPCPAEFIYLP 250          
BLAST of Ribonuclease t2 vs. Ensembl Fly
Match: RNaseX25 (gene:FBgn0010406 transcript:FBtr0076752)

HSP 1 Score: 101.293 bits (251), Expect = 3.235e-24
Identity = 60/196 (30.61%), Postives = 95/196 (48.47%), Query Frame = 3
Query:  132 MKDEDWDYLVMAVEWPPSFCYTFPKK---IQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCSKD--FWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTHYKGK---IYILAMEFCFDTKLNIIMC 695
            ++D +WD L+   +WP + CY + ++    +C        W +HG+WP+      P  C N++ +D  KL PI + L   W  L         WKHEW+ HGTCA   + L  EL+YF + +  ++   ++ IL  +++ PD+N    V+   N I K     P + C  Y GK    Y+  +  CF   L +I C
Sbjct:   71 VQDHNWDVLIFTQQWPVTTCYHWREENPDQECSLPQKKEFWTIHGIWPTKLHQMGPNFCNNSANFDPSKLNPIEDRLETFWPDLKGMDSTEWLWKHEWQKHGTCAMLVEELDNELKYFEQGLTWREEYIMSRILDASDIHPDSNN--TVAAINNAIVKALGKNPSIHCL-YDGKHGISYLSEIRICFSKSLELIDC 263          
BLAST of Ribonuclease t2 vs. Ensembl Zebrafish
Match: rnaset2 (ribonuclease T2 [Source:NCBI gene;Acc:791890])

HSP 1 Score: 102.449 bits (254), Expect = 2.994e-25
Identity = 62/196 (31.63%), Postives = 105/196 (53.57%), Query Frame = 3
Query:  144 DWDYLVMAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEW-NPLGNCSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTH--YKGKIYILA-MEFCFDTKLNIIMCPKRHKSED 719
            +W  L++   WP +FC     K++ C T   + W LHGLWP++      + C  +  ++   ++ I+ ++ K W + L   S  FW +EW  HGTCA+ ++ L++E +YF + +++    DL ++L +N + P + K Y + D    I   Y V+PK+QC H    G++ IL  +E C D    ++ C K   SED
Sbjct:   26 EWTKLILTQHWPQTFC-----KMEHCKTD-FSYWTLHGLWPNTG-----VRCNTSWHFNASLIEDILPEMEKFWPDLLEPSSPKFWNYEWTKHGTCAAKSESLNSEHKYFGKALELYHKFDLNSVLLKNQIVP-SEKHYTLEDVEEAITSAYGVKPKIQCVHPGQGGQVQILGQIEICVDRDFQLMGCEK--SSED 207          
BLAST of Ribonuclease t2 vs. Ensembl Zebrafish
Match: rnaset2 (ribonuclease T2 [Source:NCBI gene;Acc:791890])

HSP 1 Score: 102.449 bits (254), Expect = 2.994e-25
Identity = 62/196 (31.63%), Postives = 105/196 (53.57%), Query Frame = 3
Query:  144 DWDYLVMAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEW-NPLGNCSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTH--YKGKIYILA-MEFCFDTKLNIIMCPKRHKSED 719
            +W  L++   WP +FC     K++ C T   + W LHGLWP++      + C  +  ++   ++ I+ ++ K W + L   S  FW +EW  HGTCA+ ++ L++E +YF + +++    DL ++L +N + P + K Y + D    I   Y V+PK+QC H    G++ IL  +E C D    ++ C K   SED
Sbjct:   26 EWTKLILTQHWPQTFC-----KMEHCKTD-FSYWTLHGLWPNTG-----VRCNTSWHFNASLIEDILPEMEKFWPDLLEPSSPKFWNYEWTKHGTCAAKSESLNSEHKYFGKALELYHKFDLNSVLLKNQIVP-SEKHYTLEDVEEAITSAYGVKPKIQCVHPGQGGQVQILGQIEICVDRDFQLMGCEK--SSED 207          
BLAST of Ribonuclease t2 vs. Ensembl Zebrafish
Match: rnaset2 (ribonuclease T2 [Source:NCBI gene;Acc:791890])

HSP 1 Score: 102.449 bits (254), Expect = 2.994e-25
Identity = 62/196 (31.63%), Postives = 105/196 (53.57%), Query Frame = 3
Query:  144 DWDYLVMAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEW-NPLGNCSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTH--YKGKIYILA-MEFCFDTKLNIIMCPKRHKSED 719
            +W  L++   WP +FC     K++ C T   + W LHGLWP++      + C  +  ++   ++ I+ ++ K W + L   S  FW +EW  HGTCA+ ++ L++E +YF + +++    DL ++L +N + P + K Y + D    I   Y V+PK+QC H    G++ IL  +E C D    ++ C K   SED
Sbjct:   26 EWTKLILTQHWPQTFC-----KMEHCKTD-FSYWTLHGLWPNTG-----VRCNTSWHFNASLIEDILPEMEKFWPDLLEPSSPKFWNYEWTKHGTCAAKSESLNSEHKYFGKALELYHKFDLNSVLLKNQIVP-SEKHYTLEDVEEAITSAYGVKPKIQCVHPGQGGQVQILGQIEICVDRDFQLMGCEK--SSED 207          
BLAST of Ribonuclease t2 vs. Ensembl Zebrafish
Match: rnaset2 (ribonuclease T2 [Source:NCBI gene;Acc:791890])

HSP 1 Score: 102.449 bits (254), Expect = 2.994e-25
Identity = 62/196 (31.63%), Postives = 105/196 (53.57%), Query Frame = 3
Query:  144 DWDYLVMAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEW-NPLGNCSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTH--YKGKIYILA-MEFCFDTKLNIIMCPKRHKSED 719
            +W  L++   WP +FC     K++ C T   + W LHGLWP++      + C  +  ++   ++ I+ ++ K W + L   S  FW +EW  HGTCA+ ++ L++E +YF + +++    DL ++L +N + P + K Y + D    I   Y V+PK+QC H    G++ IL  +E C D    ++ C K   SED
Sbjct:   26 EWTKLILTQHWPQTFC-----KMEHCKTD-FSYWTLHGLWPNTG-----VRCNTSWHFNASLIEDILPEMEKFWPDLLEPSSPKFWNYEWTKHGTCAAKSESLNSEHKYFGKALELYHKFDLNSVLLKNQIVP-SEKHYTLEDVEEAITSAYGVKPKIQCVHPGQGGQVQILGQIEICVDRDFQLMGCEK--SSED 207          
BLAST of Ribonuclease t2 vs. Ensembl Zebrafish
Match: rnaset2 (ribonuclease T2 [Source:NCBI gene;Acc:791890])

HSP 1 Score: 102.449 bits (254), Expect = 2.994e-25
Identity = 62/196 (31.63%), Postives = 105/196 (53.57%), Query Frame = 3
Query:  144 DWDYLVMAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEW-NPLGNCSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTH--YKGKIYILA-MEFCFDTKLNIIMCPKRHKSED 719
            +W  L++   WP +FC     K++ C T   + W LHGLWP++      + C  +  ++   ++ I+ ++ K W + L   S  FW +EW  HGTCA+ ++ L++E +YF + +++    DL ++L +N + P + K Y + D    I   Y V+PK+QC H    G++ IL  +E C D    ++ C K   SED
Sbjct:   26 EWTKLILTQHWPQTFC-----KMEHCKTD-FSYWTLHGLWPNTG-----VRCNTSWHFNASLIEDILPEMEKFWPDLLEPSSPKFWNYEWTKHGTCAAKSESLNSEHKYFGKALELYHKFDLNSVLLKNQIVP-SEKHYTLEDVEEAITSAYGVKPKIQCVHPGQGGQVQILGQIEICVDRDFQLMGCEK--SSED 207          
BLAST of Ribonuclease t2 vs. Ensembl Xenopus
Match: rnaset2 (ribonuclease T2 [Source:NCBI gene;Acc:780173])

HSP 1 Score: 67.0106 bits (162), Expect = 2.260e-12
Identity = 41/134 (30.60%), Postives = 75/134 (55.97%), Query Frame = 3
Query:  192 YTFPKKIQCCDTSHVTG----WNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCSKD-FWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVN 578
            + FP   Q  D SH       W LHGLWP  ++      C N+  ++  +++ I+ +L   W  + + +K   WKHEW+ HGTCA+  + L+T+ +YF++ +++   VDL ++L ++ + P + K Y+V  ++ 
Sbjct:   40 FVFPLASQM-DHSHCKNPPKYWTLHGLWPDKAQ-----MCNNSWPFEYSEIQDILPELNHYWPDILHPNKSQLWKHEWQKHGTCAASLECLNTQHKYFSKGLELYTKVDLNSVLEKSGIVP-STKYYQVRCYLG 166          
BLAST of Ribonuclease t2 vs. Ensembl Mouse
Match: Rnaset2a (ribonuclease T2A [Source:MGI Symbol;Acc:MGI:1915445])

HSP 1 Score: 102.449 bits (254), Expect = 6.212e-25
Identity = 64/235 (27.23%), Postives = 120/235 (51.06%), Query Frame = 3
Query:  129 WMKDEDWDYLVMAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCSKD---FWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCT---HYKGKIYILAMEFCFDTK-LNIIMCPKRHKSEDHLSRHRNKCRKPRNSTNPIHIPCTTGFLYQP 812
            W    +W  L++   WPP+ C    K++  C  S +  W +HGLWP  ++      C  +  ++  ++K ++ D+   W  + + S +   FWKHEW  HGTCA+    L++E +YF +++ + K +DL ++L +  +KP  N  Y+++DF + + ++Y V PK+QC      +    +  +E CF  + L++  C    +  + LS  +        ST+ + + C  G ++ P
Sbjct:   33 WSGSHEWKKLILTQHWPPTVC----KEVNSCQDS-LDYWTIHGLWPDRAED-----CNQSWHFNLDEIKDLLRDMKIYWPDVIHRSSNRSQFWKHEWVKHGTCAAQVDALNSEKKYFGKSLDLYKQIDLNSVLQKFGIKPSIN-YYQLADFKDALTRIYGVVPKIQCLMPEQGESVQTVGQIELCFTKEDLHLRNCT---EPGEQLSSRQEAWLAMEASTHGMMV-CEDGPIFYP 252          
BLAST of Ribonuclease t2 vs. Ensembl Mouse
Match: Rnaset2a (ribonuclease T2A [Source:MGI Symbol;Acc:MGI:1915445])

HSP 1 Score: 102.449 bits (254), Expect = 6.212e-25
Identity = 64/235 (27.23%), Postives = 120/235 (51.06%), Query Frame = 3
Query:  129 WMKDEDWDYLVMAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCSKD---FWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCT---HYKGKIYILAMEFCFDTK-LNIIMCPKRHKSEDHLSRHRNKCRKPRNSTNPIHIPCTTGFLYQP 812
            W    +W  L++   WPP+ C    K++  C  S +  W +HGLWP  ++      C  +  ++  ++K ++ D+   W  + + S +   FWKHEW  HGTCA+    L++E +YF +++ + K +DL ++L +  +KP  N  Y+++DF + + ++Y V PK+QC      +    +  +E CF  + L++  C    +  + LS  +        ST+ + + C  G ++ P
Sbjct:   33 WSGSHEWKKLILTQHWPPTVC----KEVNSCQDS-LDYWTIHGLWPDRAED-----CNQSWHFNLDEIKDLLRDMKIYWPDVIHRSSNRSQFWKHEWVKHGTCAAQVDALNSEKKYFGKSLDLYKQIDLNSVLQKFGIKPSIN-YYQLADFKDALTRIYGVVPKIQCLMPEQGESVQTVGQIELCFTKEDLHLRNCT---EPGEQLSSRQEAWLAMEASTHGMMV-CEDGPIFYP 252          
BLAST of Ribonuclease t2 vs. Ensembl Mouse
Match: Gm49673 (predicted gene, 49673 [Source:MGI Symbol;Acc:MGI:6215117])

HSP 1 Score: 102.449 bits (254), Expect = 6.212e-25
Identity = 64/235 (27.23%), Postives = 120/235 (51.06%), Query Frame = 3
Query:  129 WMKDEDWDYLVMAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCSKD---FWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCT---HYKGKIYILAMEFCFDTK-LNIIMCPKRHKSEDHLSRHRNKCRKPRNSTNPIHIPCTTGFLYQP 812
            W    +W  L++   WPP+ C    K++  C  S +  W +HGLWP  ++      C  +  ++  ++K ++ D+   W  + + S +   FWKHEW  HGTCA+    L++E +YF +++ + K +DL ++L +  +KP  N  Y+++DF + + ++Y V PK+QC      +    +  +E CF  + L++  C    +  + LS  +        ST+ + + C  G ++ P
Sbjct:   33 WSGSHEWKKLILTQHWPPTVC----KEVNSCQDS-LDYWTIHGLWPDRAED-----CNQSWHFNLDEIKDLLRDMKIYWPDVIHRSSNRSQFWKHEWVKHGTCAAQVDALNSEKKYFGKSLDLYKQIDLNSVLQKFGIKPSIN-YYQLADFKDALTRIYGVVPKIQCLMPEQGESVQTVGQIELCFTKEDLHLRNCT---EPGEQLSSRQEAWLAMEASTHGMMV-CEDGPIFYP 252          
BLAST of Ribonuclease t2 vs. Ensembl Mouse
Match: Gm49721 (predicted gene, 49721 [Source:MGI Symbol;Acc:MGI:6215195])

HSP 1 Score: 102.449 bits (254), Expect = 6.212e-25
Identity = 64/235 (27.23%), Postives = 120/235 (51.06%), Query Frame = 3
Query:  129 WMKDEDWDYLVMAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCSKD---FWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCT---HYKGKIYILAMEFCFDTK-LNIIMCPKRHKSEDHLSRHRNKCRKPRNSTNPIHIPCTTGFLYQP 812
            W    +W  L++   WPP+ C    K++  C  S +  W +HGLWP  ++      C  +  ++  ++K ++ D+   W  + + S +   FWKHEW  HGTCA+    L++E +YF +++ + K +DL ++L +  +KP  N  Y+++DF + + ++Y V PK+QC      +    +  +E CF  + L++  C    +  + LS  +        ST+ + + C  G ++ P
Sbjct:   33 WSGSHEWKKLILTQHWPPTVC----KEVNSCQDS-LDYWTIHGLWPDRAED-----CNQSWHFNLDEIKDLLRDMKIYWPDVIHRSSNRSQFWKHEWVKHGTCAAQVDALNSEKKYFGKSLDLYKQIDLNSVLQKFGIKPSIN-YYQLADFKDALTRIYGVVPKIQCLMPEQGESVQTVGQIELCFTKEDLHLRNCT---EPGEQLSSRQEAWLAMEASTHGMMV-CEDGPIFYP 252          
BLAST of Ribonuclease t2 vs. Ensembl Mouse
Match: Rnaset2b (ribonuclease T2B [Source:MGI Symbol;Acc:MGI:3702087])

HSP 1 Score: 102.449 bits (254), Expect = 6.212e-25
Identity = 64/235 (27.23%), Postives = 120/235 (51.06%), Query Frame = 3
Query:  129 WMKDEDWDYLVMAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCSKD---FWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCT---HYKGKIYILAMEFCFDTK-LNIIMCPKRHKSEDHLSRHRNKCRKPRNSTNPIHIPCTTGFLYQP 812
            W    +W  L++   WPP+ C    K++  C  S +  W +HGLWP  ++      C  +  ++  ++K ++ D+   W  + + S +   FWKHEW  HGTCA+    L++E +YF +++ + K +DL ++L +  +KP  N  Y+++DF + + ++Y V PK+QC      +    +  +E CF  + L++  C    +  + LS  +        ST+ + + C  G ++ P
Sbjct:   33 WSGSHEWKKLILTQHWPPTVC----KEVNSCQDS-LDYWTIHGLWPDRAED-----CNQSWHFNLDEIKDLLRDMKIYWPDVIHRSSNRSQFWKHEWVKHGTCAAQVDALNSEKKYFGKSLDLYKQIDLNSVLQKFGIKPSIN-YYQLADFKDALTRIYGVVPKIQCLMPEQGESVQTVGQIELCFTKEDLHLRNCT---EPGEQLSSRQEAWLAMEASTHGMMV-CEDGPIFYP 252          
BLAST of Ribonuclease t2 vs. UniProt/SwissProt
Match: sp|B8XY56|RNT2_DANRE (Ribonuclease T2 OS=Danio rerio OX=7955 GN=rnaset2 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.260e-24
Identity = 62/196 (31.63%), Postives = 105/196 (53.57%), Query Frame = 3
Query:  144 DWDYLVMAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEW-NPLGNCSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTH--YKGKIYILA-MEFCFDTKLNIIMCPKRHKSED 719
            +W  L++   WP +FC     K++ C T   + W LHGLWP++      + C  +  ++   ++ I+ ++ K W + L   S  FW +EW  HGTCA+ ++ L++E +YF + +++    DL ++L +N + P + K Y + D    I   Y V+PK+QC H    G++ IL  +E C D    ++ C K   SED
Sbjct:   26 EWTKLILTQHWPQTFC-----KMEHCKTD-FSYWTLHGLWPNTG-----VRCNTSWHFNASLIEDILPEMEKFWPDLLEPSSPKFWNYEWTKHGTCAAKSESLNSEHKYFGKALELYHKFDLNSVLLKNQIVP-SEKHYTLEDVEEAITSAYGVKPKIQCVHPGQGGQVQILGQIEICVDRDFQLMGCEK--SSED 207          
BLAST of Ribonuclease t2 vs. UniProt/SwissProt
Match: sp|C0HKG6|RNT2B_MOUSE (Ribonuclease T2-B OS=Mus musculus OX=10090 GN=Rnaset2b PE=1 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 4.345e-24
Identity = 64/235 (27.23%), Postives = 120/235 (51.06%), Query Frame = 3
Query:  129 WMKDEDWDYLVMAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCSKD---FWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCT---HYKGKIYILAMEFCFDTK-LNIIMCPKRHKSEDHLSRHRNKCRKPRNSTNPIHIPCTTGFLYQP 812
            W    +W  L++   WPP+ C    K++  C  S +  W +HGLWP  ++      C  +  ++  ++K ++ D+   W  + + S +   FWKHEW  HGTCA+    L++E +YF +++ + K +DL ++L +  +KP  N  Y+++DF + + ++Y V PK+QC      +    +  +E CF  + L++  C    +  + LS  +        ST+ + + C  G ++ P
Sbjct:   33 WSGSHEWKKLILTQHWPPTVC----KEVNSCQDS-LDYWTIHGLWPDRAED-----CNQSWHFNLDEIKDLLRDMKIYWPDVIHRSSNRSQFWKHEWVKHGTCAAQVDALNSEKKYFGKSLDLYKQIDLNSVLQKFGIKPSIN-YYQLADFKDALTRIYGVVPKIQCLMPEQGESVQTVGQIELCFTKEDLHLRNCT---EPGEQLSSRQEAWLAMEASTHGMMV-CEDGPIFYP 252          
BLAST of Ribonuclease t2 vs. UniProt/SwissProt
Match: sp|C0HKG5|RNT2A_MOUSE (Ribonuclease T2-A OS=Mus musculus OX=10090 GN=Rnaset2a PE=1 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 4.345e-24
Identity = 64/235 (27.23%), Postives = 120/235 (51.06%), Query Frame = 3
Query:  129 WMKDEDWDYLVMAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCSKD---FWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCT---HYKGKIYILAMEFCFDTK-LNIIMCPKRHKSEDHLSRHRNKCRKPRNSTNPIHIPCTTGFLYQP 812
            W    +W  L++   WPP+ C    K++  C  S +  W +HGLWP  ++      C  +  ++  ++K ++ D+   W  + + S +   FWKHEW  HGTCA+    L++E +YF +++ + K +DL ++L +  +KP  N  Y+++DF + + ++Y V PK+QC      +    +  +E CF  + L++  C    +  + LS  +        ST+ + + C  G ++ P
Sbjct:   33 WSGSHEWKKLILTQHWPPTVC----KEVNSCQDS-LDYWTIHGLWPDRAED-----CNQSWHFNLDEIKDLLRDMKIYWPDVIHRSSNRSQFWKHEWVKHGTCAAQVDALNSEKKYFGKSLDLYKQIDLNSVLQKFGIKPSIN-YYQLADFKDALTRIYGVVPKIQCLMPEQGESVQTVGQIELCFTKEDLHLRNCT---EPGEQLSSRQEAWLAMEASTHGMMV-CEDGPIFYP 252          
BLAST of Ribonuclease t2 vs. UniProt/SwissProt
Match: sp|Q7M456|RNOY_CRAGI (Ribonuclease Oy OS=Crassostrea gigas OX=29159 PE=1 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 4.470e-24
Identity = 57/202 (28.22%), Postives = 95/202 (47.03%), Query Frame = 3
Query:  144 DWDYLVMAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSS-SKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCSK--DFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTHYKGKI---YILAMEFCFDTKLNIIMCPKRHKSEDHLSR 731
            DW+Y   A +WP + C    +   C     V GW +HGLWPSS ++   P  C  +  +D   + P++ +L K W  L   +K   FW+HEW  HGTCA+       EL+YF   +++    +++ IL    + P     Y +++    +K+   V+  ++C + K K     +  +  C   +  +I C K+  SE    R
Sbjct:    2 DWNYFTFAQQWPIAVC---AEHKSCFIPDSVVGWGIHGLWPSSDTESKGPENCNGSWPFDINNVMPLVPELKKYWPNLYPDTKANSFWEHEWSKHGTCATSLPATSNELKYFGMGLKLHAKYNISRILVNQGILPSKTAGYMINETEAAVKRELGVDAVIECVYDKEKTKKQLLYEISICLTKEFELISCNKKEVSETTCPR 200          
BLAST of Ribonuclease t2 vs. UniProt/SwissProt
Match: sp|P42815|RNS3_ARATH (Ribonuclease 3 OS=Arabidopsis thaliana OX=3702 GN=RNS3 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.094e-23
Identity = 60/196 (30.61%), Postives = 99/196 (50.51%), Query Frame = 3
Query:  141 EDWDYLVMAVEWPPSFCYTFPKKIQCC---DTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCSKD---FWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQC---THYKGKIYILAMEFCFDTKLN-IIMCP 698
            +D+D+    ++WP ++C +   +  CC          + +HGLWP+   G  P  C   S +D+ ++  +M DL +EW  L   S D   FW HEW+ HGTCA      H    YF   +++K+  +L + L    +KPD +K Y++ D  N IK+V    P ++C   + +  ++Y + +  C DT  +  I CP
Sbjct:   20 QDFDFFYFVLQWPGAYCDS---RHSCCYPQTGKPAADFGIHGLWPNYKTGGWPQNCNPDSRFDDLRVSDLMSDLQREWPTLSCPSNDGMKFWTHEWEKHGTCAESELDQH---DYFEAGLKLKQKANLLHALTNAGIKPD-DKFYEMKDIENTIKQVVGFAPGIECNKDSSHNSQLYQIYL--CVDTSASKFINCP 206          
BLAST of Ribonuclease t2 vs. TrEMBL
Match: A0A0B7A509 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF94146 PE=3 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 7.925e-37
Identity = 70/195 (35.90%), Postives = 106/195 (54.36%), Query Frame = 3
Query:  132 MKDEDWDYLVMAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCSKD---FWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTHYKGKIYILAMEFCFDTKLNIIMCPKRH 707
            +KDE WD+L++A  WP + C  F +  +C       GW +HGLWPS   G  P  C  +  +D  +++P+  +L K+W P  N S D    WKHEW  HGTCA    +L  EL YFN T+Q+   +D+ + L   N+ P  + +Y ++D    +   Y   P++ C H K K Y+  +  C++  LN+I CP+ H
Sbjct:   27 VKDESWDFLLLAQFWPGASCIYFDEYTECPVPQGQVGWIIHGLWPSVFSGQQPRMCDPSMTFDITEIQPLRTELDKQW-PYLNKSGDSTFLWKHEWDEHGTCAYTLPILQGELSYFNVTLQLHSTLDIFSALSTANIVPTTDNLYSLTDIWTAVVNKYTKLPQIACLHSKHKYYLDQIYLCYNKSLNLIDCPETH 220          
BLAST of Ribonuclease t2 vs. TrEMBL
Match: T1FNC2 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20210319 PE=3 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 2.564e-35
Identity = 77/219 (35.16%), Postives = 113/219 (51.60%), Query Frame = 3
Query:  141 EDWDYLVMAVEWPPSFCYTFPKK--IQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPL--GNCSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTHYKGKI----------YILAMEFCFDTKLNIIMCPKRHKSEDHLSRHRNKCRKP 755
            E+WD+ + ++ WP S C    +     C      T W +HGLWP+++    P+CCK A A++   L PI + L   W  L  G  + +FWKHEWK HGTCA+  + L+T+L+YFN T+ + +  ++ + L Q N+ P +N  Y VSDF      +Y V PK+ C     K           YI  +EFC D + + I CP++       SR R  C  P
Sbjct:   36 EEWDHFIFSMHWPQSICVERNETGIFNCSIPRETTSWIIHGLWPTNNTSEKPVCCKGA-AFNRSLLDPIKDQLDVHWPNLFIGQTAGEFWKHEWKKHGTCAASMESLNTQLKYFNVTLSILEKFNIASGLAQFNIVPSDNTFYTVSDFQRAFNSLYNVSPKMLCFPSSRKSKNDPKRSAYQYISEIEFCMDKQFSNIECPRKIHPN---SRPRPFCLHP 250          
BLAST of Ribonuclease t2 vs. TrEMBL
Match: Q7M439 (Ribonuclease T2 OS=Todarodes pacificus OX=6637 PE=1 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 3.274e-35
Identity = 82/235 (34.89%), Postives = 113/235 (48.09%), Query Frame = 3
Query:  135 KDEDWDYLVMAVEWPPSFCYTFPKKIQCCDT-SHVTGWNLHGLWPSS-SKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCSKD--FWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTHYKGKI--YILAMEFCFDTKLNIIMCPKRHKSEDHLSRHRNKCRKPRNSTNPIHIPCTTGFLYQPFSP 821
            KD  +D+ V   +WPP+ C         C   S V GW +HGLWPS  +    P  C N  ++DE K+KPI  ++ K W  L   S D  FWKHEWK HGTC+  +KL   E  YFN  + + K  ++T+IL  + V P+    Y+V+DF   ++    + P + C + K     YI+ +E C D +LN I CP  H      S  RN              P + G  Y P  P
Sbjct:    1 KDTHFDFFVFTQQWPPAVCVEAQAHGHLCSIPSDVKGWVVHGLWPSRKTDRMGPFFCNNTYSFDENKIKPIEAEMRKYWPNLFADSPDLSFWKHEWKKHGTCSLSDKLTPDEFGYFNTALNLFKKYNITSILGHSGVIPNTYTAYEVNDFSTAVENALNIVPVITCIYDKMSKHHYIMQVEICIDKELNAISCPDDHSEA---SSARN-------------CPASKGIWYPPIIP 219          
BLAST of Ribonuclease t2 vs. TrEMBL
Match: L8GFB8 (Ribonuclease, T2 family OS=Acanthamoeba castellanii str. Neff OX=1257118 GN=ACA1_257540 PE=3 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 8.088e-34
Identity = 64/194 (32.99%), Postives = 105/194 (54.12%), Query Frame = 3
Query:  135 KDEDWDYLVMAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPL--GNCSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQC----THYKGKIYILAMEFCFDTKLNIIMCP 698
            +   WD+L++  +W P  C T   K QC   S+V  W LHG+WP++  GS P  C ++ +++ ++L+PI + L   W  L   N  + FW+HE++ HGTCA+ +  L TEL YFN T+  +   D++    +  ++P +NK Y +      I+  Y   P +QC    +  +G   + ++ FC  + L II CP
Sbjct:  108 QSTSWDFLLLVQQWGPGVCATSRGK-QCVIPSYVRYWTLHGMWPNNFDGSYPANCPDSESFNMQRLEPIRKSLTAYWPTLYPSNTLESFWEHEFEKHGTCAASDPTLATELAYFNATLTARATFDISVAFSKAGIQPSSNKAYSIDTISKAIQSAYGGVPLVQCSRESSRARGPEALTSIGFCISSSLTIIDCP 300          
BLAST of Ribonuclease t2 vs. TrEMBL
Match: V4APT3 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_76871 PE=3 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 2.206e-29
Identity = 61/189 (32.28%), Postives = 102/189 (53.97%), Query Frame = 3
Query:  141 EDWDYLVMAVEWPPSFCYTF-PKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCSK--DFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYK-VEPKLQCTHYKGKIYILAMEFCFDTKLNIIMC 695
            E++D+  ++  WP + C     +K+ C +T  V GW +HGLWPS   G +P  C +   ++ K L P+M DLLK W  L   S     W+HEW  HGTCA  +    TE  +F + + + K ++++ ++   N+ P + K+Y V      +KK +  +EP + C   K K Y+  ++ C+D + N++ C
Sbjct:    3 EEFDFFTLSSAWPKTVCLEGQTEKLYCNNTLDVAGWTIHGLWPSRIDGKEPKSCGHIK-FNLKTLDPLMGDLLKLWPNLFKYSSLDSLWRHEWNKHGTCAVSDNNTATEFLFFKKALDVFKKINISRVMKNLNIVPSDTKLYSVRTISRGLKKHFSGIEPIIMCLDIKNKTYLHQIQVCYDKEFNMVDC 190          
BLAST of Ribonuclease t2 vs. Ensembl Cavefish
Match: rnaset2 (ribonuclease T2 [Source:NCBI gene;Acc:103036121])

HSP 1 Score: 92.0485 bits (227), Expect = 2.731e-21
Identity = 53/190 (27.89%), Postives = 98/190 (51.58%), Query Frame = 3
Query:  144 DWDYLVMAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEW-NPLGNCSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTHYKGKIYILA---MEFCFDTKLNIIMCPK 701
            DW  L++   WP +FC       QC  T++ + W LHG WP+         C ++  ++   ++ ++ ++   W + L   S  FWKHEW+ HGTCA+ ++ L ++ +YF++ +++   +DL  +L ++ + P + K YK++D    I   + V PK+QC     +  +     +E C D +  +  C K
Sbjct:   25 DWTKLILTHHWPKTFCMI----DQC--TTNFSYWTLHGFWPNVGN-----MCNSSWHFNASLIEDLLPEMKTYWPDLLKPASTQFWKHEWEKHGTCAAKDEDLDSQHKYFSKALELYHKLDLDGVLKKSQIVP-SEKYYKLADLEESIVSSFGVTPKIQCVLEAKRAEVQTVGQIEICVDKQFQLTDCEK 202          
BLAST of Ribonuclease t2 vs. Ensembl Cavefish
Match: rnaset2l (ribonuclease Oy-like [Source:NCBI gene;Acc:103022964])

HSP 1 Score: 74.3294 bits (181), Expect = 5.524e-15
Identity = 40/141 (28.37%), Postives = 69/141 (48.94%), Query Frame = 3
Query:  144 DWDYLVMAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPL--GNCSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYK 560
            +W  ++  ++WP SFC +   +  C    ++  W +HGLWP  + G    CC     + +  L+ +  +L + W  L     +  FWK EW  HGTCA+  + + +   YF  +++++   D+ N L    +KP  N  YK
Sbjct:   43 NWTCMIFTIQWPGSFCLSLENRNICRIPENIHNWTIHGLWPIRTYG----CCFCWPVF-QSHLQDLEPELSQLWPSLIKSKSNFSFWKDEWFKHGTCAACVESMGSPAHYFRTSLKLRTLFDVDNALANTGIKPSCNISYK 178          
BLAST of Ribonuclease t2 vs. Ensembl Sea Lamprey
Match: rnaset2 (ribonuclease T2 [Source:NCBI gene;Acc:791890])

HSP 1 Score: 100.138 bits (248), Expect = 5.305e-25
Identity = 63/235 (26.81%), Postives = 108/235 (45.96%), Query Frame = 3
Query:  141 EDWDYLVMAVEWPPSFCYT-FPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNC-SKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQC--------THYKGKIYILAMEFCFDTKLNIIMCPKRHKSEDHLSRHRNKCRKPRNS-----TNPIHIPCTTGF 800
            EDW  L++   WP SFC + + +K  C   S V  W++HGLW +         C  +  +D K+++ ++  L + W  L      D WKHEW  HGTCA+  + L+++  YF++T+++ + +D++  L    V P N   YK    +      + V+ KLQC        T   G+I     + C+  + +++ C +  ++   +    +K   P N         IH P    F
Sbjct:   27 EDWSQLILTQHWPQSFCMSQWSEKHNCTIPSSVKSWSIHGLWTNHRT-----FCNKSWHFDVKEIEDLLPQLDQFWPDLEKTNGTDLWKHEWIRHGTCAATLEALNSQHNYFSKTMELYQKLDISKALSDAGVTPSNTVFYKEEQILEAFSTAFGVKAKLQCLTVPQEENTQLLGQI-----QMCWSREFSLVNCSRHAEAGIPVPNSYSKSFTPSNDIVCDPAKIIHYPLIGKF 251          
BLAST of Ribonuclease t2 vs. Ensembl Nematostella
Match: EDO48543 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ98])

HSP 1 Score: 98.2117 bits (243), Expect = 4.997e-24
Identity = 59/217 (27.19%), Postives = 94/217 (43.32%), Query Frame = 3
Query:  132 MKDEDWDYLVMAVEWPPSFCY-------------TFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCSK----DFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTHYKGKIYILA-MEFCFDTKL---NIIMCPKRHKSED 719
            ++   WDY V +  WP S CY             T       C  + VT W LHGLWP+    ++P+ C ++  + E +++ + + +++ W    + SK    D W HEWK HGTCA+       E  YF+  + +  +  L   L   N+ P +++MY V      I   Y  + ++ C        +LA +  C D      N I     H S+D
Sbjct:   22 LESHKWDYFVFSQWWPQSQCYYRNGQTMDDKWRFTSGNARNDCVPADVTTWTLHGLWPTVGGKAEPVNCNSSWPFVESEIQDLEDRMMQRWLAFPDSSKSSARDLWSHEWKKHGTCATDLAQTSNEHSYFSMALALNSNCGLLRALASENIIPSDDQMYTVKQVERAISNKYGAKGRVICLRGPDDQQLLAGIRICLDKSFRPRNCIQTYPEHCSDD 238          
BLAST of Ribonuclease t2 vs. Ensembl Nematostella
Match: EDO48544 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ99])

HSP 1 Score: 94.7449 bits (234), Expect = 1.116e-22
Identity = 50/175 (28.57%), Postives = 80/175 (45.71%), Query Frame = 3
Query:  147 WDYLVMAVEWPPSFCY-------------TFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCSK----DFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQC 620
            WDY V +  WP S CY             T       C  + VT W LHGLWP+    ++P+ C ++  + E +++ + + +++ W    + SK    D W HEWK HGTCA+       E  YF+  + +  +  L   L   N+ P +++MY V      I   Y  + ++ C
Sbjct:   20 WDYFVFSQWWPQSQCYYRNGQTMDDKWRFTSGNARNDCVPADVTTWTLHGLWPTVGGKAEPVNCNSSWPFVESEIQDLEDRMMQRWLAFPDSSKSSARDLWSHEWKKHGTCATDLAETSNEHSYFSMALALNSNCGLLRALASENIIPSDDQMYTVKQVERAISNKYGAKGRVIC 194          
BLAST of Ribonuclease t2 vs. Ensembl Medaka
Match: rnaset2 (ribonuclease T2 [Source:NCBI gene;Acc:101163650])

HSP 1 Score: 102.449 bits (254), Expect = 3.300e-25
Identity = 61/194 (31.44%), Postives = 108/194 (55.67%), Query Frame = 3
Query:  147 WDYLVMAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGN-CSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTH-YKGKIY--ILAMEFCFDTKLNIIMCPKRHKSE 716
            W  L++   WP +FC      ++ C  + ++ W LHGLWP   KG D   C ++  ++   ++ ++ D+ K W  L N  S  FWK+EW  HGTCA+  + L+++ +YF++ +++   +DL+++L +  + P ++K Y  S     I+ VY  +PK+QC H  KG  +  +  +E CFD+   ++ C K+   E
Sbjct:   27 WSKLILTHHWPNTFC-----SMEHCHPN-ISYWTLHGLWPD--KGMD---CNSSWHFNPSLIEDLLPDMNKSWPDLRNRSSVSFWKYEWHKHGTCAAKAESLNSQHKYFSKALELYHKLDLSSVLVKFGITP-SDKYYPFSQVEGAIENVYGFKPKIQCVHSSKGGDFQSLGQIEICFDSDFTLMDCEKQSAKE 208          
BLAST of Ribonuclease t2 vs. Ensembl Medaka
Match: rnaset2 (ribonuclease T2 [Source:NCBI gene;Acc:101163650])

HSP 1 Score: 102.449 bits (254), Expect = 3.300e-25
Identity = 61/194 (31.44%), Postives = 108/194 (55.67%), Query Frame = 3
Query:  147 WDYLVMAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGN-CSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTH-YKGKIY--ILAMEFCFDTKLNIIMCPKRHKSE 716
            W  L++   WP +FC      ++ C  + ++ W LHGLWP   KG D   C ++  ++   ++ ++ D+ K W  L N  S  FWK+EW  HGTCA+  + L+++ +YF++ +++   +DL+++L +  + P ++K Y  S     I+ VY  +PK+QC H  KG  +  +  +E CFD+   ++ C K+   E
Sbjct:   27 WSKLILTHHWPNTFC-----SMEHCHPN-ISYWTLHGLWPD--KGMD---CNSSWHFNPSLIEDLLPDMNKSWPDLRNRSSVSFWKYEWHKHGTCAAKAESLNSQHKYFSKALELYHKLDLSSVLVKFGITP-SDKYYPFSQVEGAIENVYGFKPKIQCVHSSKGGDFQSLGQIEICFDSDFTLMDCEKQSAKE 208          
BLAST of Ribonuclease t2 vs. Ensembl Medaka
Match: rnaset2l (ribonuclease Oy [Source:NCBI gene;Acc:101170531])

HSP 1 Score: 78.9518 bits (193), Expect = 1.563e-16
Identity = 39/164 (23.78%), Postives = 80/164 (48.78%), Query Frame = 3
Query:  138 DEDWDYLVMAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPL--GNCSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCT 623
            D  W  ++  ++WP  FC +   +  C     VT W +HGLWP  ++      C N     +  ++ + ++L++ W  L     S  FW+ EW  HG CA+  +  ++  +YF  +++++K  ++  +L    + P   + YKV++  +++      + ++QC 
Sbjct:   46 DCAWRCIIFTLQWPGGFCASLYNQTLCRIPDTVTDWTIHGLWPLHAQR-----CCNCWPMFQSDVQELKDELVENWPSLLKTKSSFQFWEQEWAKHGACAACVEGFNSPQKYFQISLKLRKWFEIQRVLEDAGIAPSCERRYKVAEVQSILTPHVGDQYEIQCV 204          
BLAST of Ribonuclease t2 vs. Ensembl Medaka
Match: rnaset2l (ribonuclease Oy [Source:NCBI gene;Acc:101170531])

HSP 1 Score: 78.9518 bits (193), Expect = 1.563e-16
Identity = 39/164 (23.78%), Postives = 80/164 (48.78%), Query Frame = 3
Query:  138 DEDWDYLVMAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPL--GNCSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCT 623
            D  W  ++  ++WP  FC +   +  C     VT W +HGLWP  ++      C N     +  ++ + ++L++ W  L     S  FW+ EW  HG CA+  +  ++  +YF  +++++K  ++  +L    + P   + YKV++  +++      + ++QC 
Sbjct:   46 DCAWRCIIFTLQWPGGFCASLYNQTLCRIPDTVTDWTIHGLWPLHAQR-----CCNCWPMFQSDVQELKDELVENWPSLLKTKSSFQFWEQEWAKHGACAACVEGFNSPQKYFQISLKLRKWFEIQRVLEDAGIAPSCERRYKVAEVQSILTPHVGDQYEIQCV 204          
BLAST of Ribonuclease t2 vs. Planmine SMEST
Match: SMESG000048912.1 (SMESG000048912.1)

HSP 1 Score: 494.197 bits (1271), Expect = 1.396e-178
Identity = 250/250 (100.00%), Postives = 250/250 (100.00%), Query Frame = 3
Query:   72 MFPIKYFXXXXXXXXXXXXWMKDEDWDYLVMAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTHYKGKIYILAMEFCFDTKLNIIMCPKRHKSEDHLSRHRNKCRKPRNSTNPIHIPCTTGFLYQPFSP 821
            MFPIKYFLLIILSIYTSSIWMKDEDWDYLVMAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTHYKGKIYILAMEFCFDTKLNIIMCPKRHKSEDHLSRHRNKCRKPRNSTNPIHIPCTTGFLYQPFSP
Sbjct:    1 MFPIKYFLLIILSIYTSSIWMKDEDWDYLVMAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTHYKGKIYILAMEFCFDTKLNIIMCPKRHKSEDHLSRHRNKCRKPRNSTNPIHIPCTTGFLYQPFSP 250          
BLAST of Ribonuclease t2 vs. Planmine SMEST
Match: SMESG000048912.1 (SMESG000048912.1)

HSP 1 Score: 479.174 bits (1232), Expect = 5.738e-173
Identity = 230/230 (100.00%), Postives = 230/230 (100.00%), Query Frame = 3
Query:  132 MKDEDWDYLVMAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTHYKGKIYILAMEFCFDTKLNIIMCPKRHKSEDHLSRHRNKCRKPRNSTNPIHIPCTTGFLYQPFSP 821
            MKDEDWDYLVMAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTHYKGKIYILAMEFCFDTKLNIIMCPKRHKSEDHLSRHRNKCRKPRNSTNPIHIPCTTGFLYQPFSP
Sbjct:    1 MKDEDWDYLVMAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTHYKGKIYILAMEFCFDTKLNIIMCPKRHKSEDHLSRHRNKCRKPRNSTNPIHIPCTTGFLYQPFSP 230          
BLAST of Ribonuclease t2 vs. Planmine SMEST
Match: SMESG000048912.1 (SMESG000048912.1)

HSP 1 Score: 457.988 bits (1177), Expect = 1.050e-164
Identity = 220/220 (100.00%), Postives = 220/220 (100.00%), Query Frame = 3
Query:  162 MAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTHYKGKIYILAMEFCFDTKLNIIMCPKRHKSEDHLSRHRNKCRKPRNSTNPIHIPCTTGFLYQPFSP 821
            MAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTHYKGKIYILAMEFCFDTKLNIIMCPKRHKSEDHLSRHRNKCRKPRNSTNPIHIPCTTGFLYQPFSP
Sbjct:    1 MAVEWPPSFCYTFPKKIQCCDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTHYKGKIYILAMEFCFDTKLNIIMCPKRHKSEDHLSRHRNKCRKPRNSTNPIHIPCTTGFLYQPFSP 220          
BLAST of Ribonuclease t2 vs. Planmine SMEST
Match: SMESG000016389.1 (SMESG000016389.1)

HSP 1 Score: 114.775 bits (286), Expect = 1.032e-30
Identity = 63/162 (38.89%), Postives = 87/162 (53.70%), Query Frame = 3
Query:  144 DWDYLVMAVEWPPSFCYTFPKKIQC-CDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCS--KDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQC 620
            +WDYL   + WP +FC    K  QC  D + VTGWN+HGLWPS+  G DP  CK    ++   L  I  DL+ +W  L   +   +FW HEW  HG CA    L   EL YF+ ++Q+K+ V L  IL  N+++P ++K Y        +     V PKL+C
Sbjct:   18 NWDYLTYTLLWPQTFC----KYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCK-GDPFNINDLNSIFPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDSVSKSVSSKLGVLPKLEC 174          
BLAST of Ribonuclease t2 vs. Planmine SMEST
Match: SMESG000046228.1 (SMESG000046228.1)

HSP 1 Score: 102.834 bits (255), Expect = 1.045e-25
Identity = 55/154 (35.71%), Postives = 82/154 (53.25%), Query Frame = 3
Query:  243 WNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCSK--DFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTHYKGKIY-ILAMEFCFDTKLNIIMC 695
            WN+HGLWP    G+D   C       +  L  I E+LL  W  L N SK   FW +EW  HGTC+  +KL   E  YF  T+++KK++ +  +L  +N+ P+N+K Y +    N IK    + P LQC   +   + +L++  CFD  +N+  C
Sbjct:   20 WNIHGLWPYKIHGNDTFNCDGEPFQRQLVLISIYEELLLNWANLKNFSKPEKFWGYEWHKHGTCSIKDKLFSNEFGYFYHTLRLKKNISMKKLLSNHNILPNNDKAYNIQQIHNAIKVELGIIPMLQCFQKQDNEWNLLSIGICFDRSMNLKDC 173          
The following BLAST results are available for this feature:
BLAST of Ribonuclease t2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RNASET24.091e-2333.33ribonuclease T2 [Source:HGNC Symbol;Acc:HGNC:21686... [more]
RNASET24.383e-2333.33ribonuclease T2 [Source:HGNC Symbol;Acc:HGNC:21686... [more]
RNASET24.383e-2333.33ribonuclease T2 [Source:HGNC Symbol;Acc:HGNC:21686... [more]
RNASET22.733e-2133.33ribonuclease T2 [Source:HGNC Symbol;Acc:HGNC:21686... [more]
AL159163.17.475e-1828.73novel protein[more]
back to top
BLAST of Ribonuclease t2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rnst-22.514e-2330.90pep chromosome:WBcel235:V:1061595:1067908:1 gene:W... [more]
back to top
BLAST of Ribonuclease t2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RNaseX253.235e-2430.61gene:FBgn0010406 transcript:FBtr0076752[more]
back to top
BLAST of Ribonuclease t2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnaset22.994e-2531.63ribonuclease T2 [Source:NCBI gene;Acc:791890][more]
rnaset22.994e-2531.63ribonuclease T2 [Source:NCBI gene;Acc:791890][more]
rnaset22.994e-2531.63ribonuclease T2 [Source:NCBI gene;Acc:791890][more]
rnaset22.994e-2531.63ribonuclease T2 [Source:NCBI gene;Acc:791890][more]
rnaset22.994e-2531.63ribonuclease T2 [Source:NCBI gene;Acc:791890][more]
back to top
BLAST of Ribonuclease t2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rnaset22.260e-1230.60ribonuclease T2 [Source:NCBI gene;Acc:780173][more]
back to top
BLAST of Ribonuclease t2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rnaset2a6.212e-2527.23ribonuclease T2A [Source:MGI Symbol;Acc:MGI:191544... [more]
Rnaset2a6.212e-2527.23ribonuclease T2A [Source:MGI Symbol;Acc:MGI:191544... [more]
Gm496736.212e-2527.23predicted gene, 49673 [Source:MGI Symbol;Acc:MGI:6... [more]
Gm497216.212e-2527.23predicted gene, 49721 [Source:MGI Symbol;Acc:MGI:6... [more]
Rnaset2b6.212e-2527.23ribonuclease T2B [Source:MGI Symbol;Acc:MGI:370208... [more]
back to top
BLAST of Ribonuclease t2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B8XY56|RNT2_DANRE2.260e-2431.63Ribonuclease T2 OS=Danio rerio OX=7955 GN=rnaset2 ... [more]
sp|C0HKG6|RNT2B_MOUSE4.345e-2427.23Ribonuclease T2-B OS=Mus musculus OX=10090 GN=Rnas... [more]
sp|C0HKG5|RNT2A_MOUSE4.345e-2427.23Ribonuclease T2-A OS=Mus musculus OX=10090 GN=Rnas... [more]
sp|Q7M456|RNOY_CRAGI4.470e-2428.22Ribonuclease Oy OS=Crassostrea gigas OX=29159 PE=1... [more]
sp|P42815|RNS3_ARATH2.094e-2330.61Ribonuclease 3 OS=Arabidopsis thaliana OX=3702 GN=... [more]
back to top
BLAST of Ribonuclease t2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B7A5097.925e-3735.90Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
T1FNC22.564e-3535.16Uncharacterized protein OS=Helobdella robusta OX=6... [more]
Q7M4393.274e-3534.89Ribonuclease T2 OS=Todarodes pacificus OX=6637 PE=... [more]
L8GFB88.088e-3432.99Ribonuclease, T2 family OS=Acanthamoeba castellani... [more]
V4APT32.206e-2932.28Uncharacterized protein (Fragment) OS=Lottia gigan... [more]
back to top
BLAST of Ribonuclease t2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rnaset22.731e-2127.89ribonuclease T2 [Source:NCBI gene;Acc:103036121][more]
rnaset2l5.524e-1528.37ribonuclease Oy-like [Source:NCBI gene;Acc:1030229... [more]
back to top
BLAST of Ribonuclease t2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rnaset25.305e-2526.81ribonuclease T2 [Source:NCBI gene;Acc:791890][more]
back to top
BLAST of Ribonuclease t2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribonuclease t2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO485434.997e-2427.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485441.116e-2228.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ribonuclease t2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rnaset23.300e-2531.44ribonuclease T2 [Source:NCBI gene;Acc:101163650][more]
rnaset23.300e-2531.44ribonuclease T2 [Source:NCBI gene;Acc:101163650][more]
rnaset2l1.563e-1623.78ribonuclease Oy [Source:NCBI gene;Acc:101170531][more]
rnaset2l1.563e-1623.78ribonuclease Oy [Source:NCBI gene;Acc:101170531][more]
back to top
BLAST of Ribonuclease t2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048912.11.396e-178100.00SMESG000048912.1[more]
SMESG000048912.15.738e-173100.00SMESG000048912.1[more]
SMESG000048912.11.050e-164100.00SMESG000048912.1[more]
SMESG000016389.11.032e-3038.89SMESG000016389.1[more]
SMESG000046228.11.045e-2535.71SMESG000046228.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020534 ID=SMED30020534|Name=Ribonuclease t2|organism=Schmidtea mediterranea sexual|type=transcript|length=994bp
CGAATGTTTATGAAAATATTTGAACTATATCAATATATTAGCCATTCGAT
AAACATTCATTTGAATTAAAAATGTTTCCAATCAAATATTTTTTATTGAT
CATATTGTCGATTTATACATCATCTATTTGGATGAAGGATGAAGACTGGG
ACTACCTAGTGATGGCTGTGGAATGGCCGCCTTCATTTTGCTACACTTTC
CCAAAGAAAATTCAATGCTGTGACACGTCTCATGTGACCGGATGGAACCT
TCACGGATTATGGCCATCAAGTTCGAAGGGATCAGATCCTCTTTGCTGCA
AGAATGCCAGTGCGTATGACGAGAAGAAGTTAAAGCCAATAATGGAAGAT
TTACTGAAAGAATGGAATCCTTTGGGGAATTGTTCGAAAGATTTCTGGAA
ACACGAATGGAAATTTCATGGGACTTGTGCTTCTCACAACAAGCTTCTCC
ATACGGAGCTCCAATACTTCAATGAGACCATTCAAATGAAGAAACATGTA
GATTTGACAAACATTTTACATCAGAATAATGTCAAGCCCGATAATAACAA
AATGTATAAGGTCTCGGATTTTGTCAACGTCATCAAAAAAGTGTACAAAG
TGGAGCCGAAATTGCAATGTACGCATTATAAAGGTAAAATATACATTCTT
GCCATGGAATTCTGCTTCGACACGAAACTGAACATTATAATGTGTCCAAA
GCGACATAAATCAGAGGACCATCTAAGTCGCCATAGAAACAAATGCCGCA
AACCTCGAAACAGTACAAATCCCATACATATTCCTTGCACCACAGGATTC
CTGTACCAGCCATTCAGTCCATGACATCATCATGTGTTACCATCACAGAC
ATCGGAATTTATTCATAACTGATTTATCACATTCAATATAGTAAAACACC
AGATGATTTATTTTTATTATTATTTCATTGATTCTATCATAGTGTAAATT
TCCAATTTAAATCGCGTATTACTAATACGAATATTAATAATACG
back to top

protein sequence of SMED30020534-orf-1

>SMED30020534-orf-1 ID=SMED30020534-orf-1|Name=SMED30020534-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=251bp
MFPIKYFLLIILSIYTSSIWMKDEDWDYLVMAVEWPPSFCYTFPKKIQCC
DTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNP
LGNCSKDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILH
QNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTHYKGKIYILAMEFCFD
TKLNIIMCPKRHKSEDHLSRHRNKCRKPRNSTNPIHIPCTTGFLYQPFSP
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036430RNase_T2-like_sf
IPR033697Ribonuclease_T2_eukaryotic
IPR001568RNase_T2-like
IPR018188RNase_T2_His_AS_1
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0033897ribonuclease T2 activity
Vocabulary: biological process
TermDefinition
GO:0090502RNA phosphodiester bond hydrolysis, endonucleolytic
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001568Ribonuclease T2-likePFAMPF00445Ribonuclease_T2coord: 26..208
e-value: 2.2E-44
score: 151.9
IPR001568Ribonuclease T2-likePANTHERPTHR11240RIBONUCLEASE T2coord: 8..228
IPR036430Ribonuclease T2-like superfamilyGENE3DG3DSA:3.90.730.10coord: 22..228
e-value: 5.5E-51
score: 175.3
IPR036430Ribonuclease T2-like superfamilySUPERFAMILYSSF55895Ribonuclease Rh-likecoord: 23..214
NoneNo IPR availablePANTHERPTHR11240:SF22RIBONUCLEASE T2coord: 8..228
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.728
IPR018188Ribonuclease T2, His active site 1PROSITEPS00530RNASE_T2_1coord: 58..65
IPR033697Ribonuclease T2, eukaryoticCDDcd01061RNase_T2_eukcoord: 26..214
e-value: 5.57586E-48
score: 155.568