Dynein intermediate chain 2, ciliary

Overview
NameDynein intermediate chain 2, ciliary
Smed IDSMED30020525
Uniprot Best hitDynein intermediate chain 2, ciliary OS=Heliocidaris crassispina OX=1043166 PE=2 SV=1 (E=0)
Length (bp)2146
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynein intermediate chain 2, ciliary (SMED30020525) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein intermediate chain 2, ciliary (SMED30020525) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynein intermediate chain 2, ciliary (SMED30020525) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynein intermediate chain 2, ciliary (SMED30020525) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020525

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30020525SMESG000001839.1 SMESG000001830.1 SmedASXL_006772SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30020525SMESG000001839.1 SMESG000001830.1 dd_Smed_v4_4753_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30020525SMESG000001839.1 SMESG000001830.1 dd_Smed_v4_4753_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30020525SMESG000001839.1 SMESG000001830.1 dd_Smed_v4_4753_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30020525SMESG000001839.1 SMESG000001830.1 dd_Smed_v4_4753_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30020525SMESG000001839.1 SMESG000001830.1 dd_Smed_v4_4753_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30020525SMESG000001839.1 SMESG000001830.1 dd_Smed_v6_4753_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30020525SMESG000001839.1 SMESG000001830.1 dd_Smed_v4_4753_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30020525SMESG000001839.1 SMESG000001830.1 dd_Smed_v4_4753_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30020525SMESG000001839.1 SMESG000001830.1 dd_Smed_v4_4753_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Human
Match: DNAI1 (dynein axonemal intermediate chain 1 [Source:HGNC Symbol;Acc:HGNC:2954])

HSP 1 Score: 735.717 bits (1898), Expect = 0.000e+0
Identity = 374/690 (54.20%), Postives = 498/690 (72.17%), Query Frame = 2
Query:   77 GRRRSKIEEDI-PEAGPQDDLGDFMHSK-IVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQGKLIDDLKEDKEPGEGETETEDL-------------SSQKETPV--------EPEV------SEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKATFGTKVEEKSKK----KLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAPKEKKGLDVPKGPEIEIQKLEKILALV 2047
            GR   K +ED   E G   D  ++  SK  V+P DQ++LT+ ELKEEFTRILTA NPHAPQNIVR++FKE  YKPI  V+QLAVH++  GNL+ +DSDEGRRQ  +   +    +  +E  +  +ET +L              SQ + P         E E+       E+KLTNQFNF ERASQTYNNP RDR   TEPPPR+NFS    QW IYDAY+E+ EKQ+++KEK+    T V +KS K    KLTS+E+  D++ K+++  KI+ERMVNQNT+D+I+QDFKYY+D +DEYRDQ GTLLPLW+F  DKAK+++VTAL W+PKY DLFAVG+GSYDFMKQS G++  Y+LKNPS+PEY+F + SGV+ LD+H   P+++ VG YDG V +YN+ +  S P + S+A++GKH+DPVW+VKWQ++D D NLNF+SVS+DGR+ SWTL+K            +V  DVI++K+     + P+G  L  +  GT F F+ + +++FL+GTEEG ++KCSK+YS+QFLDTY AH+M+V  V+WN +H+ +F++CS+DWT++IWDH+ K P+F++DL S VGDV WAPYSSTVFAA T +G  +++DL+INKYE IC Q +A+ KK +LTHV FN  +PI+I+GDDRG I SLKLSPNLRK PKEKKG +V KGP +EI KL+K+L LV
Sbjct:   21 GRGTRKRDEDSGTEVGEGTD--EWAQSKATVRPPDQLELTDAELKEEFTRILTANNPHAPQNIVRYSFKEGTYKPIGFVNQLAVHYTQVGNLIPKDSDEGRRQHYRDELVAVSYQGSQESVKVISETGNLEEDEEPKELETEPGSQTDVPAAGAAEKVTEEELMTPKQPKERKLTNQFNFSERASQTYNNPVRDRECQTEPPPRTNFSATANQWEIYDAYVEELEKQEKTKEKEKA-KTPVAKKSGKMAMRKLTSMESQTDDLIKLSQAAKIMERMVNQNTYDDIAQDFKYYDDAADEYRDQVGTLLPLWKFQNDKAKRLSVTALCWNPKYRDLFAVGYGSYDFMKQSRGMLLLYSLKNPSFPEYMFSSNSGVMCLDIHVDHPYLVAVGHYDGNVAIYNLKKPHSQPSFCSSAKSGKHSDPVWQVKWQKDDMDQNLNFFSVSSDGRIVSWTLVKR----------KLVHIDVIKLKVEGSTTEVPEGLQLHPVGCGTAFDFHKEIDYMFLVGTEEGKIYKCSKSYSSQFLDTYDAHNMSVDTVSWNPYHTKVFMSCSSDWTVKIWDHTIKTPMFIYDLNSAVGDVAWAPYSSTVFAAVTTDGKAHIFDLAINKYEAICNQPVAA-KKNRLTHVQFNLIHPIIIVGDDRGHIISLKLSPNLRKMPKEKKGQEVQKGPAVEIAKLDKLLNLV 696          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Human
Match: DNAI1 (dynein axonemal intermediate chain 1 [Source:HGNC Symbol;Acc:HGNC:2954])

HSP 1 Score: 735.332 bits (1897), Expect = 0.000e+0
Identity = 377/691 (54.56%), Postives = 502/691 (72.65%), Query Frame = 2
Query:   77 GRRRSKIEEDI-PEAGPQDDLGDFMHSK-IVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQ----------------MAKQGKLIDDLKEDK---EPGE---------GETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKATFGTKVEEKSKK----KLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAPKEKKGLDVPKGPEIEIQKLEKILALV 2047
            GR   K +ED   E G   D  ++  SK  V+P DQ++LT+ ELKEEFTRILTA NPHAPQNIVR++FKE  YKPI  V+QLAVH++  GNL+ +DSDEGRRQ                +++ G L +D +  +   EPG           E  TE+   +  TP +P+  E+KLTNQFNF ERASQTYNNP RDR   TEPPPR+NFS    QW IYDAY+E+ EKQ+++KEK+    T V +KS K    KLTS+E+  D++ K+++  KI+ERMVNQNT+D+I+QDFKYY+D +DEYRDQ GTLLPLW+F  DKAK+++VTAL W+PKY DLFAVG+GSYDFMKQS G++  Y+LKNPS+PEY+F + SGV+ LD+H   P+++ VG YDG V +YN+ +  S P + S+A++GKH+DPVW+VKWQ++D D NLNF+SVS+DGR+ SWTL+K            +V  DVI++K+     + P+G  L  +  GT F F+ + +++FL+GTEEG ++KCSK+YS+QFLDTY AH+M+V  V+WN +H+ +F++CS+DWT++IWDH+ K P+F++DL S VGDV WAPYSSTVFAA T +G  +++DL+INKYE IC Q +A+ KK +LTHV FN  +PI+I+GDDRG I SLKLSPNLRK PKEKKG +V KGP +EI KL+K+L LV
Sbjct:   21 GRGTRKRDEDSGTEVGEGTD--EWAQSKATVRPPDQLELTDAELKEEFTRILTANNPHAPQNIVRYSFKEGTYKPIGFVNQLAVHYTQVGNLIPKDSDEGRRQHYRDELVAGSQESVKVISETGNLEEDEEPKELETEPGSQTDVPAAGAAEKVTEE---ELMTPKQPK--ERKLTNQFNFSERASQTYNNPVRDRECQTEPPPRTNFSATANQWEIYDAYVEELEKQEKTKEKEKA-KTPVAKKSGKMAMRKLTSMESQTDDLIKLSQAAKIMERMVNQNTYDDIAQDFKYYDDAADEYRDQVGTLLPLWKFQNDKAKRLSVTALCWNPKYRDLFAVGYGSYDFMKQSRGMLLLYSLKNPSFPEYMFSSNSGVMCLDIHVDHPYLVAVGHYDGNVAIYNLKKPHSQPSFCSSAKSGKHSDPVWQVKWQKDDMDQNLNFFSVSSDGRIVSWTLVKR----------KLVHIDVIKLKVEGSTTEVPEGLQLHPVGCGTAFDFHKEIDYMFLVGTEEGKIYKCSKSYSSQFLDTYDAHNMSVDTVSWNPYHTKVFMSCSSDWTVKIWDHTIKTPMFIYDLNSAVGDVAWAPYSSTVFAAVTTDGKAHIFDLAINKYEAICNQPVAA-KKNRLTHVQFNLIHPIIIVGDDRGHIISLKLSPNLRKMPKEKKGQEVQKGPAVEIAKLDKLLNLV 692          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Human
Match: WDR78 (WD repeat domain 78 [Source:HGNC Symbol;Acc:HGNC:26252])

HSP 1 Score: 246.514 bits (628), Expect = 5.702e-70
Identity = 126/361 (34.90%), Postives = 204/361 (56.51%), Query Frame = 2
Query:  902 LWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLN-----FYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQ-------GPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDP-LFVFDLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKL 1945
            LW F+ D  K + V++L+W+    DL AVG+G + F +Q  GL C +++KNP +PE I+++  GV ++D     P++L VG+++G + +YN+    + P+  S+    KH  PVW+++W  +D     +       S+SADGR++ W +I++G+           C+D++ +K +              D A +   + G CFAF+P+  +I+L GTEEG +HKCS +Y+ Q+LDTY  H   VYKV WN F  D+F++CSADW + IW      P L  +   S V DV W+P SS +FAAA  N  + ++DL I+  +P+   +  +    K T + F  +   L++GD  GQ++  +L
Sbjct:  475 LWSFSCDLTKGLNVSSLAWNKTNPDLLAVGYGHFGFKEQKRGLACCWSIKNPMWPERIYQSPYGVTAVDFSIGAPNLLAVGYHNGTIAIYNVRSNSNVPVLDSSESPQKHLGPVWQLQWIEQDRGTTGDGKREILVSISADGRISKW-VIRKGLD----------CYDLMRLKRTTAASNKKGGEKEKKDEALISRQAPGMCFAFHPKDTNIYLAGTEEGHIHKCSCSYNEQYLDTYRGHKGPVYKVTWNPFCHDVFLSCSADWGVIIWQQENVKPSLSFYPATSVVYDVAWSPKSSYIFAAANEN-RVEIWDLHISTLDPLI--VNTANPGIKFTTILFAKQTDCLLVGDSDGQVSVYEL 821          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Human
Match: DNAI1 (dynein axonemal intermediate chain 1 [Source:HGNC Symbol;Acc:HGNC:2954])

HSP 1 Score: 214.157 bits (544), Expect = 2.230e-63
Identity = 135/260 (51.92%), Postives = 175/260 (67.31%), Query Frame = 2
Query:  161 VKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQ----------------MAKQGKLIDDLKEDK---EPG-----------EGETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKATFGTKVEEKSKK----KLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQ 838
            V+P DQ++LT+ ELKEEFTRILTA NPHAPQNIVR++FKE  YKPI  V+QLAVH++  GNL+ +DSDEGRRQ                +++ G L +D +  +   EPG           E  TE E +     TP +P+  E+KLTNQFNF ERASQTYNNP RDR   TEPPPR+NFS    QW IYDAY+E+ EKQ+++KEK+    T V +KS K    KLTS+E+  D++ K+++  KI+ERMVNQNT+D+I+Q
Sbjct:   38 VRPPDQLELTDAELKEEFTRILTANNPHAPQNIVRYSFKEGTYKPIGFVNQLAVHYTQVGNLIPKDSDEGRRQHYRDELVAGSQESVKVISETGNLEEDEEPKELETEPGSQTDVPAAGAAEKVTEEELM-----TPKQPK--ERKLTNQFNFSERASQTYNNPVRDRECQTEPPPRTNFSATANQWEIYDAYVEELEKQEKTKEKEKAK-TPVAKKSGKMAMRKLTSMESQTDDLIKLSQAAKIMERMVNQNTYDDIAQ 289          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Human
Match: DNAI1 (dynein axonemal intermediate chain 1 [Source:HGNC Symbol;Acc:HGNC:2954])

HSP 1 Score: 188.348 bits (477), Expect = 3.450e-55
Identity = 84/178 (47.19%), Postives = 125/178 (70.22%), Query Frame = 2
Query: 1004 DFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHK 1537
            DFMKQS G++  Y+LKNPS+PEY+F + SGV+ LD+H   P+++ VG YDG V +YN+ +  S P + S+A++GKH+DPVW+VKWQ++D D NLNF+SVS+DGR+ SWTL+K            +V  DVI++K+     + P+G  L  +  GT F F+ + +++FL+GTEEG ++K
Sbjct:    2 DFMKQSRGMLLLYSLKNPSFPEYMFSSNSGVMCLDIHVDHPYLVAVGHYDGNVAIYNLKKPHSQPSFCSSAKSGKHSDPVWQVKWQKDDMDQNLNFFSVSSDGRIVSWTLVKR----------KLVHIDVIKLKVEGSTTEVPEGLQLHPVGCGTAFDFHKEIDYMFLVGTEEGKIYK 169          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Celegans
Match: dyci-1 (DYnein Chain, light Intermediate [Source:UniProtKB/TrEMBL;Acc:O45087])

HSP 1 Score: 108.997 bits (271), Expect = 1.705e-24
Identity = 112/444 (25.23%), Postives = 198/444 (44.59%), Query Frame = 2
Query:  668 QQQSKEKKATFGTKVEEKSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDK---AKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSY-PEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYN--ITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLS----LSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFL---DTYHAHH------MAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSP---VGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICE-QLIASKKKTKLTHVSFNPKYPILIIGDDRGQI 1930
            +Q+++EKK      V   S ++   +    + +    +  K++ R +N+    EI     Y +DP  E       LL L +   D+   AK++ VT +++S  Y DL AV +G  D   +  G+I  +  K+     E+I   QS + S+   R   H+L  G   G + V++  +T RK  P+  S   T  HT  V  +        N  NF S+S DGR+ SW +                          D++ Q  DG  L++     +S T  +F   +   F++GT+ G++   S+  +   +   D  +  H      +  ++ +  +  S +FI+ S DWT+++W  S KD    F   S    V DV W+P    VFA+  A+G+I+V++L+ +   P+   +  A  +   +  + ++P    + +GDD G++
Sbjct:  198 RQETEEKKTQTVQIVPPLSDEEKYRLTLDPEFLDSFNRSCKVISRALNE----EIDICINYTKDPY-EKAIASDDLLHLAQVYQDETWTAKRL-VTGMAFSEHYPDLLAVSYGPCDIPNEPPGVIVVWNTKSKRMTAEFIVYCQSEIQSVAFARFHAHLLLAGCESGQICVWDNRLTSRKL-PINRSPLTTQAHTYTVSCLAVV--GTKNAHNFVSLSRDGRICSWNV--------------------------DNLTQPVDGKELMTKEGKAASATRMSFPIGEMQTFVVGTDTGEILAASRNGADPAVIKTDVCYKGHSGTLTGIEFHRASGVVDFSHLFISSSHDWTVKLW--STKDANLKFSFESHPDLVLDVAWSPVHPAVFASIDADGNIFVWNLNEDVEGPVARLRAGAEGESVYMNRLIWSPDGKHVFVGDDEGRV 604          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Fly
Match: CG9313 (gene:FBgn0034566 transcript:FBtr0071521)

HSP 1 Score: 516.924 bits (1330), Expect = 4.376e-174
Identity = 250/554 (45.13%), Postives = 368/554 (66.43%), Query Frame = 2
Query:  413 KEDKEPGEGETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKATFGTKVEEKSK----KKLTSIETAADEMSK-IAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSN-GLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLR---KAPKEKKGLDVPKGPEIEIQKLEKILALV 2047
            +ED EP     +   +SS+K          +KL NQFN+CER + TY NP R+    T PPPRS F  N+ QWVIYD+Y+E+F + Q+        GTK EE+ +    KK       A++++K   K  +I+ERM+NQN +D+I+ D++Y+EDP+DE+R+ +G LLPLW+F +DK KK+ VT + ++P Y+DLFAV  GS+DFMKQ+N G +C +T+KNPS+P+YI +T  GV+  D+H + P +  +G YDG V VYN+ +    PLY+S     KH + VW++KW  +  D  +NF+SVS+DGRV +W L++          N +    +I +   + +  GPDG  +   S G+C  F+P    IFL+GTE G ++KCS A+S+++L TY+AH+M+VY++ +N F+S+IF++C ADW +++W+  + DPLF+FDLG+ VGDV WAPYSSTVFAA T  G ++V+DL++NKY+ IC Q +  K+K KLT +SFN K   +++GD++G  TSLKLSPNLR   K PK++  LD      ++I KLEK+L+LV
Sbjct:  200 QEDDEPAH---QAAAVSSKK----------RKLINQFNYCERGALTYTNPKRNVDTQTIPPPRSQFGANVLQWVIYDSYMENFAESQKD-------GTKKEERKRGKREKKFRDKSAIAEQLNKKYLKCWQILERMINQNIYDDIAHDYRYWEDPADEFREGEGNLLPLWKFQYDKTKKMNVTDILFNPSYYDLFAVCFGSHDFMKQTNEGYLCLFTVKNPSFPDYIIQTDCGVMCCDIHPTYPFLAVIGLYDGNVAVYNLREDCKEPLYVSRGVNCKHGECVWQIKWGLDMADGEVNFFSVSSDGRVFNWILMQ----------NKLWVTTIITLYRENGLVDGPDGTKVTLKSGGSCMVFHPVDNKIFLVGTECGYIYKCSTAFSSKYLMTYYAHNMSVYRIDFNRFNSNIFVSCGADWMVKVWEDMRPDPLFIFDLGAAVGDVKWAPYSSTVFAAVTTEGKVHVFDLNVNKYKAICIQAVVPKRKNKLTRLSFNEKLAFIVVGDEKGVTTSLKLSPNLRMMVKPPKKQLYLD---QNTLQIGKLEKLLSLV 720          

HSP 2 Score: 70.4774 bits (171), Expect = 3.573e-12
Identity = 36/81 (44.44%), Postives = 52/81 (64.20%), Query Frame = 2
Query:  143 FMHSK-IVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQM 382
            +M S+ ++KP+DQ+ LTE EL EE T++LT TN +  +N+V ++FKE  + P           +  GN LH DSDEGRRQ+
Sbjct:   39 WMKSRQLLKPDDQLDLTEAELGEEITKVLTPTNTNIVRNLVVYSFKEGEFVPAPLPGNTVTLIAFAGNSLHVDSDEGRRQI 119          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Fly
Match: CG9313 (gene:FBgn0034566 transcript:FBtr0345666)

HSP 1 Score: 516.924 bits (1330), Expect = 4.376e-174
Identity = 250/554 (45.13%), Postives = 368/554 (66.43%), Query Frame = 2
Query:  413 KEDKEPGEGETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKATFGTKVEEKSK----KKLTSIETAADEMSK-IAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSN-GLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLR---KAPKEKKGLDVPKGPEIEIQKLEKILALV 2047
            +ED EP     +   +SS+K          +KL NQFN+CER + TY NP R+    T PPPRS F  N+ QWVIYD+Y+E+F + Q+        GTK EE+ +    KK       A++++K   K  +I+ERM+NQN +D+I+ D++Y+EDP+DE+R+ +G LLPLW+F +DK KK+ VT + ++P Y+DLFAV  GS+DFMKQ+N G +C +T+KNPS+P+YI +T  GV+  D+H + P +  +G YDG V VYN+ +    PLY+S     KH + VW++KW  +  D  +NF+SVS+DGRV +W L++          N +    +I +   + +  GPDG  +   S G+C  F+P    IFL+GTE G ++KCS A+S+++L TY+AH+M+VY++ +N F+S+IF++C ADW +++W+  + DPLF+FDLG+ VGDV WAPYSSTVFAA T  G ++V+DL++NKY+ IC Q +  K+K KLT +SFN K   +++GD++G  TSLKLSPNLR   K PK++  LD      ++I KLEK+L+LV
Sbjct:  200 QEDDEPAH---QAAAVSSKK----------RKLINQFNYCERGALTYTNPKRNVDTQTIPPPRSQFGANVLQWVIYDSYMENFAESQKD-------GTKKEERKRGKREKKFRDKSAIAEQLNKKYLKCWQILERMINQNIYDDIAHDYRYWEDPADEFREGEGNLLPLWKFQYDKTKKMNVTDILFNPSYYDLFAVCFGSHDFMKQTNEGYLCLFTVKNPSFPDYIIQTDCGVMCCDIHPTYPFLAVIGLYDGNVAVYNLREDCKEPLYVSRGVNCKHGECVWQIKWGLDMADGEVNFFSVSSDGRVFNWILMQ----------NKLWVTTIITLYRENGLVDGPDGTKVTLKSGGSCMVFHPVDNKIFLVGTECGYIYKCSTAFSSKYLMTYYAHNMSVYRIDFNRFNSNIFVSCGADWMVKVWEDMRPDPLFIFDLGAAVGDVKWAPYSSTVFAAVTTEGKVHVFDLNVNKYKAICIQAVVPKRKNKLTRLSFNEKLAFIVVGDEKGVTTSLKLSPNLRMMVKPPKKQLYLD---QNTLQIGKLEKLLSLV 720          

HSP 2 Score: 70.4774 bits (171), Expect = 3.573e-12
Identity = 36/81 (44.44%), Postives = 52/81 (64.20%), Query Frame = 2
Query:  143 FMHSK-IVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQM 382
            +M S+ ++KP+DQ+ LTE EL EE T++LT TN +  +N+V ++FKE  + P           +  GN LH DSDEGRRQ+
Sbjct:   39 WMKSRQLLKPDDQLDLTEAELGEEITKVLTPTNTNIVRNLVVYSFKEGEFVPAPLPGNTVTLIAFAGNSLHVDSDEGRRQI 119          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Fly
Match: CG9313 (gene:FBgn0034566 transcript:FBtr0342788)

HSP 1 Score: 516.924 bits (1330), Expect = 4.562e-174
Identity = 250/554 (45.13%), Postives = 368/554 (66.43%), Query Frame = 2
Query:  413 KEDKEPGEGETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKATFGTKVEEKSK----KKLTSIETAADEMSK-IAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSN-GLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLR---KAPKEKKGLDVPKGPEIEIQKLEKILALV 2047
            +ED EP     +   +SS+K          +KL NQFN+CER + TY NP R+    T PPPRS F  N+ QWVIYD+Y+E+F + Q+        GTK EE+ +    KK       A++++K   K  +I+ERM+NQN +D+I+ D++Y+EDP+DE+R+ +G LLPLW+F +DK KK+ VT + ++P Y+DLFAV  GS+DFMKQ+N G +C +T+KNPS+P+YI +T  GV+  D+H + P +  +G YDG V VYN+ +    PLY+S     KH + VW++KW  +  D  +NF+SVS+DGRV +W L++          N +    +I +   + +  GPDG  +   S G+C  F+P    IFL+GTE G ++KCS A+S+++L TY+AH+M+VY++ +N F+S+IF++C ADW +++W+  + DPLF+FDLG+ VGDV WAPYSSTVFAA T  G ++V+DL++NKY+ IC Q +  K+K KLT +SFN K   +++GD++G  TSLKLSPNLR   K PK++  LD      ++I KLEK+L+LV
Sbjct:  201 QEDDEPAH---QAAAVSSKK----------RKLINQFNYCERGALTYTNPKRNVDTQTIPPPRSQFGANVLQWVIYDSYMENFAESQKD-------GTKKEERKRGKREKKFRDKSAIAEQLNKKYLKCWQILERMINQNIYDDIAHDYRYWEDPADEFREGEGNLLPLWKFQYDKTKKMNVTDILFNPSYYDLFAVCFGSHDFMKQTNEGYLCLFTVKNPSFPDYIIQTDCGVMCCDIHPTYPFLAVIGLYDGNVAVYNLREDCKEPLYVSRGVNCKHGECVWQIKWGLDMADGEVNFFSVSSDGRVFNWILMQ----------NKLWVTTIITLYRENGLVDGPDGTKVTLKSGGSCMVFHPVDNKIFLVGTECGYIYKCSTAFSSKYLMTYYAHNMSVYRIDFNRFNSNIFVSCGADWMVKVWEDMRPDPLFIFDLGAAVGDVKWAPYSSTVFAAVTTEGKVHVFDLNVNKYKAICIQAVVPKRKNKLTRLSFNEKLAFIVVGDEKGVTTSLKLSPNLRMMVKPPKKQLYLD---QNTLQIGKLEKLLSLV 721          

HSP 2 Score: 70.4774 bits (171), Expect = 3.638e-12
Identity = 36/81 (44.44%), Postives = 52/81 (64.20%), Query Frame = 2
Query:  143 FMHSK-IVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQM 382
            +M S+ ++KP+DQ+ LTE EL EE T++LT TN +  +N+V ++FKE  + P           +  GN LH DSDEGRRQ+
Sbjct:   40 WMKSRQLLKPDDQLDLTEAELGEEITKVLTPTNTNIVRNLVVYSFKEGEFVPAPLPGNTVTLIAFAGNSLHVDSDEGRRQI 120          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Fly
Match: Dic61B (gene:FBgn0263988 transcript:FBtr0072538)

HSP 1 Score: 132.494 bits (332), Expect = 8.260e-32
Identity = 105/402 (26.12%), Postives = 182/402 (45.27%), Query Frame = 2
Query:  923 KAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQ---SNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQRE----DFDNNLN-FYSVSADGRVTSWTLIKEG---------VGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLF-VFDLGSPVGDVVWAPYSSTVFAAA---TANGSIYVYDLSINKYEPICEQLIASKKKT--KLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAPKEKKGLDVPKGPEIEIQKLEK-ILALVG*D 2056
            K ++ AV+ + +     D+ AV +G Y F  Q   ++G +  +++KNP  PE  +     V +++    LP +L +G YDG+V V +++  +  P+ +S   T   + PV  ++W ++    D + +++ F S+S DG VT + +IK           + +    P  I  H    I      C+       LS+++      +P  + I+ + T+EG +HKCS  Y  Q+L+    H   V  + ++ +   +F+TC  DW +RIW      PL  + D  +PV    W+P  ST+       TAN    V+D   N   P+ +  + S   T  + +H         L+IG++RG      L+             D+P  P  +  +LEK I   +G D
Sbjct:  294 KDERKAVSDIDFCRSNGDILAVAYGLYSFSSQHVPTSGSVFLWSIKNPGEPERAYYYDVPVTAINFSPFLPSLLAIGLYDGSVEVRDVSSLQDTPVAVSQRSTSPGSSPVVAIRWIKQVSDDDHETDIDPFLSLSQDGSVTRFRIIKSPFLLGFTQMILERVEGHPEGIFVHPSSRIP-----CESNRHPQGLSITT------HPLHKDIYYVLTDEGCIHKCSINYQHQYLEVLRCHDGGVTVMEFSPWSPKLFLTCGNDWFVRIWVDGITRPLLELLDEMTPVHWAKWSPTHSTIIVTVNRETAN----VWDFRRNLLRPMSKHKMDSSFNTVARFSHCG-----RTLVIGNERGNTLFNALN-------------DMPFSPHFQYDELEKAIFKAIGND 662          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Fly
Match: Dic61B (gene:FBgn0263988 transcript:FBtr0072539)

HSP 1 Score: 132.88 bits (333), Expect = 1.004e-31
Identity = 106/402 (26.37%), Postives = 185/402 (46.02%), Query Frame = 2
Query:  923 KAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQ---SNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQRE----DFDNNLN-FYSVSADGRVTSWTLIK--------EGVGKKHEC-PNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLF-VFDLGSPVGDVVWAPYSSTVFAAA---TANGSIYVYDLSINKYEPICEQLIASKKKT--KLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAPKEKKGLDVPKGPEIEIQKLEK-ILALVG*D 2056
            K ++ AV+ + +     D+ AV +G Y F  Q   ++G +  +++KNP  PE  +     V +++    LP +L +G YDG+V V +++  +  P+ +S   T   + PV  ++W ++    D + +++ F S+S DG VT + +IK        + + ++ E  P  I  H    I      C+       LS+++      +P  + I+ + T+EG +HKCS  Y  Q+L+    H   V  + ++ +   +F+TC  DW +RIW      PL  + D  +PV    W+P  ST+       TAN    V+D   N   P+ +  + S   T  + +H         L+IG++RG      L+             D+P  P  +  +LEK I   +G D
Sbjct:  374 KDERKAVSDIDFCRSNGDILAVAYGLYSFSSQHVPTSGSVFLWSIKNPGEPERAYYYDVPVTAINFSPFLPSLLAIGLYDGSVEVRDVSSLQDTPVAVSQRSTSPGSSPVVAIRWIKQVSDDDHETDIDPFLSLSQDGSVTRFRIIKSPFLLGFTQMILERVEGHPEGIFVHPSSRIP-----CESNRHPQGLSITT------HPLHKDIYYVLTDEGCIHKCSINYQHQYLEVLRCHDGGVTVMEFSPWSPKLFLTCGNDWFVRIWVDGITRPLLELLDEMTPVHWAKWSPTHSTIIVTVNRETAN----VWDFRRNLLRPMSKHKMDSSFNTVARFSHCG-----RTLVIGNERGNTLFNALN-------------DMPFSPHFQYDELEKAIFKAIGND 742          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Zebrafish
Match: dnai1.2 (dynein, axonemal, intermediate chain 1, paralog 2 [Source:ZFIN;Acc:ZDB-GENE-070112-1302])

HSP 1 Score: 717.613 bits (1851), Expect = 0.000e+0
Identity = 340/639 (53.21%), Postives = 468/639 (73.24%), Query Frame = 2
Query:  131 DLGDFMHSK-IVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQGKLIDDLKEDKEPGEGETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKAT-FGTKVEEKSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAPKEKKGLDVPKGPEIEIQKLEKILA 2041
            D  ++M  K +VKP DQ+ LTE+ELKEE TR+LTA NP+APQN+VR++FKE CYK I  VDQ+A+HF +EGNL+H++SDEGRR MAK          ++E   G+   E++      P++P   E+K+TNQFNF +RASQT NN  R+    TEPPPR+NFS    QW IYD Y+E+ +++++SKEK+ + F  K E++SKKK+   E  +D++S++AKP KI+ERMVNQN FDE++QDF Y+ED +DE+R ++GTLLPLW+F +DKAK ++VTAL W+  Y DLFAVG GSY+F +Q  G++ FYTLKNPS+PE+IF T SGV+ +D+H  L +++ VG YDG V VY++ ++   P+Y S A +GKHT  VW+VKWQ++D D+N NF+SVS DGRV SWTL+K          ++IV  D+I++   D V   PD    +  ++GT   F+ Q++H FL+GTE G +HK SK YS++FL+ Y AH M V  V WN FH ++FI+C  DW ++IWDH+   P+F F+L S V DV W+PYSSTVFAA TA+G ++V+DLSINKYE +C+Q + S KKT+L H+ FNP +PI+I+GDDRG++ SLKLSPNLRK PKEKKG ++PKGPE+EI K+E++L+
Sbjct:   47 DGEEWMQGKTLVKPPDQLDLTEEELKEEITRVLTANNPNAPQNVVRYSFKEGCYKTIVFVDQMAIHFELEGNLVHKESDEGRRLMAKHT--------EREDCGGDERLENV------PIKPGKREQKVTNQFNFIDRASQTLNNLPREISCQTEPPPRANFSATANQWEIYDFYVEELQRREKSKEKQESQFPNKEEDRSKKKMIQAEAQSDDISQLAKPAKIIERMVNQNIFDEVAQDFMYFEDAADEFRGEKGTLLPLWKFQYDKAKGLSVTALCWNHIYSDLFAVGLGSYEFTQQERGMLLFYTLKNPSFPEFIFNTDSGVMCVDIHEQLSYLVAVGLYDGCVSVYDLRKKSDQPMYNSIASSGKHTGAVWQVKWQKDDLDSNHNFFSVSTDGRVVSWTLVK----------HEIVFTDIIKLPPVDKV---PDDLKNVVATAGTSLDFHKQKDHHFLVGTEAGKIHKGSKYYSSKFLEMYDAHFMTVSCVRWNPFHPNVFISCGWDWMVKIWDHTINSPVFTFELKSSVTDVAWSPYSSTVFAAVTADGKVHVFDLSINKYEALCQQKVVS-KKTRLLHIEFNPVHPIIIVGDDRGRVISLKLSPNLRKKPKEKKGQELPKGPEVEIAKMEQLLS 657          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Zebrafish
Match: dnai1.1 (dynein, axonemal, intermediate chain 1, paralog 1 [Source:ZFIN;Acc:ZDB-GENE-040910-7])

HSP 1 Score: 465.307 bits (1196), Expect = 4.487e-156
Identity = 253/635 (39.84%), Postives = 375/635 (59.06%), Query Frame = 2
Query:  164 KPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQGKLIDDLKEDKEPGEGETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPP-RSNFSDNITQWVIYDAYLEDFEKQQQS-----KEKKATFGTKVEEKSKKKLTSIETAAD-EMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAPKEKKGLDVPKGPEIEIQKLEKILALV 2047
            +P+++  L+E+ +     R+  AT+     +++RF+FKE C+KP+A    +     +EG+L+H+DS+EG+   A                                 E EV  K  T  F+    A+QT  NP R+    TE  P   N+S    QW IYD Y E+ +K+  S     KE +   G +    +   L      +D +++ ++   K++E  VN+N   +I  DFK++ED +DE+R  +GTLLPLW F ++K K + V+AL W+ KY+DLFAVG GS+ F +   G++ FYT +N ++PE++F T SGV+ +D+H    H++ VG ++G V VYN+  +   P+Y S A +GKH+  VW+VKW  +D   N  F+SVSADGRV SWTL K           ++   ++I++   D V   PD  N + +++G    F+ Q+ + FL+GTE G +HK S  Y T+F+ TY AH   V  V WN F+  +FITC  DW + IWD +   P+F FDL S V DV WAPYSSTVFAA TA+G ++V+DLSIN++E +C+Q + S K+  LT + FNP +PI+I+G+DRG++ SLKLSPNLRK PKE+KG +   G E+EI K+EK+L L+
Sbjct:    6 QPQNESNLSEKTVVLRRARLNAATS-----SLMRFSFKECCFKPVADEPDI----EIEGSLVHKDSEEGQILCA---------------------------------EKEVGRKSKT-LFSCITTATQTTINPPREVACQTESQPLLVNYSATANQWEIYDFYQEELQKRTSSTKKDEKENEIAEGAEGVHGNLSLLRDFTDKSDHDLAMLSTAAKLLEYAVNENINGDIIADFKHFEDEADEFRGDKGTLLPLWEFQYNKVKSLHVSALCWNKKYNDLFAVGLGSHKFTELECGMLLFYTWRNNNHPEFLFNTDSGVMCVDIHEQKSHLVAVGLFNGNVCVYNLMAKDDQPIYNSMASSGKHSGTVWQVKWWEDDLYGNHTFFSVSADGRVVSWTLGKY----------ELFSTNIIKLPPMDKV---PDDLNNVIVTAGLTLDFHKQKPYHFLVGTEAGKIHKGSTHY-TRFIKTYEAHFRMVSCVRWNPFNPKVFITCGMDWRVNIWDETTDSPVFTFDLKSSVMDVAWAPYSSTVFAAVTADGKVHVFDLSINRFEALCQQRVVSTKR-HLTCIEFNPVHPIIIVGNDRGRVISLKLSPNLRKNPKEEKGKEPSTGAEVEIAKMEKLLILM 582          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Zebrafish
Match: dnai1.1 (dynein, axonemal, intermediate chain 1, paralog 1 [Source:ZFIN;Acc:ZDB-GENE-040910-7])

HSP 1 Score: 456.833 bits (1174), Expect = 3.372e-153
Identity = 245/606 (40.43%), Postives = 362/606 (59.74%), Query Frame = 2
Query:  260 VRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQGKLIDDLKEDKEPGEGETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPP-RSNFSDNITQWVIYDAYLEDFEKQQQSKEKKATFGTKVEE-----KSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEI----SQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAPKEKKGLDVPKGPEIEIQKLEKILALV 2047
            +RF+FKE C+KP+A    +     +EG+L+H+DS+EG+   A                                 E EV  K  T  F+    A+QT  NP R+    TE  P   N+S    QW IYD Y E+ +K+  S  KK +  + +++     ++K  +     +  +++ ++   K++E  VN+N   +I    + DFK++ED +DE+R  +GTLLPLW F ++K K + V+AL W+ KY+DLFAVG GS+ F +   G++ FYT +N ++PE++F T SGV+ +D+H    H++ VG ++G V VYN+  +   P+Y S A +GKH+  VW+VKW  +D   N  F+SVSADGRV SWTL K           ++   ++I++   D V   PD  N + +++G    F+ Q+ + FL+GTE G +HK S  Y T+F+ TY AH   V  V WN F+  +FITC  DW + IWD +   P+F FDL S V DV WAPYSSTVFAA TA+G ++V+DLSIN++E +C+Q + S K+  LT + FNP +PI+I+G+DRG++ SLKLSPNLRK PKE+KG +   G E+EI K+EK+L L+
Sbjct:    1 MRFSFKECCFKPVADEPDI----EIEGSLVHKDSEEGQILCA---------------------------------EKEVGRKSKT-LFSCITTATQTTINPPREVACQTESQPLLVNYSATANQWEIYDFYQEELQKRTSST-KKCSHNSNIQKIQQIARNKNSIFGRIMSDHDLAMLSTAAKLLEYAVNENINGDIIAAQTSDFKHFEDEADEFRGDKGTLLPLWEFQYNKVKSLHVSALCWNKKYNDLFAVGLGSHKFTELECGMLLFYTWRNNNHPEFLFNTDSGVMCVDIHEQKSHLVAVGLFNGNVCVYNLMAKDDQPIYNSMASSGKHSGTVWQVKWWEDDLYGNHTFFSVSADGRVVSWTLGKY----------ELFSTNIIKLPPMDKV---PDDLNNVIVTAGLTLDFHKQKPYHFLVGTEAGKIHKGSTHY-TRFIKTYEAHFRMVSCVRWNPFNPKVFITCGMDWRVNIWDETTDSPVFTFDLKSSVMDVAWAPYSSTVFAAVTADGKVHVFDLSINRFEALCQQRVVSTKR-HLTCIEFNPVHPIIIVGNDRGRVISLKLSPNLRKNPKEEKGKEPSTGAEVEIAKMEKLLILM 552          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Zebrafish
Match: wdr78 (WD repeat domain 78 [Source:ZFIN;Acc:ZDB-GENE-050522-322])

HSP 1 Score: 245.743 bits (626), Expect = 2.656e-70
Identity = 134/413 (32.45%), Postives = 225/413 (54.48%), Query Frame = 2
Query:  770 KIAKPIKIVERMVNQNTFDEISQDFK---YYEDP------------SDEYRDQQGTLLP-LWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKW-QRED---FDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSPVG-DVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKL 1945
            K+ + + ++ER+V  N F      ++     EDP            +++ ++     L  LW F+ +      V+ + W+ K  DL AVG+G  +F   ++GL+C ++LKNP++P+ +F  +SGV +LD   S  + L VG YDG + +YN+   +  P+  S+     HT PVW++ W   ED    D      SVS+DGR++ W   K            + C D++++K+ D   +     ++ SL+ G CF F+P    I+L+GTEEG +HKCS +Y+ Q+L++Y AH   VYKV W+ F SD+F++CS+DWTI++W    + P+  F  G  V  D++W+P+ +TVF A  + G + ++DL ++  +P       +      T + F+P+   +++GD  GQ+T  KL
Sbjct:  358 KLKQDLALMERVVLANVFQPKLAAYRQLPIIEDPDCVQMVMEEESWTEQSKNSHCPFLERLWDFSCELTMGRNVSCMVWNKKNPDLLAVGYGQVEFKNPNSGLVCCWSLKNPTWPDRVFHCESGVTALDFSASNANQLAVGMYDGTIAIYNVQTSEQTPITDSSDCANLHTSPVWQLTWIDHEDGLAADKGEILVSVSSDGRISKWIHYKS-----------MECVDLMKLKIHDLQWK----RHISSLTPGMCFDFHPNDSKIYLVGTEEGHIHKCSSSYNEQYLESYKAHKRPVYKVTWSPFCSDVFLSCSSDWTIQLWRQDLQIPVMGFTSGQRVVFDIMWSPHCATVFGAV-SEGKVEIWDLRVSSLDPTLVNW--TSPGVNPTALLFSPETDCVLVGDSEGQVTVYKL 752          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Zebrafish
Match: wdr78 (WD repeat domain 78 [Source:ZFIN;Acc:ZDB-GENE-050522-322])

HSP 1 Score: 245.743 bits (626), Expect = 2.656e-70
Identity = 134/413 (32.45%), Postives = 225/413 (54.48%), Query Frame = 2
Query:  770 KIAKPIKIVERMVNQNTFDEISQDFK---YYEDP------------SDEYRDQQGTLLP-LWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKW-QRED---FDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSPVG-DVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKL 1945
            K+ + + ++ER+V  N F      ++     EDP            +++ ++     L  LW F+ +      V+ + W+ K  DL AVG+G  +F   ++GL+C ++LKNP++P+ +F  +SGV +LD   S  + L VG YDG + +YN+   +  P+  S+     HT PVW++ W   ED    D      SVS+DGR++ W   K            + C D++++K+ D   +     ++ SL+ G CF F+P    I+L+GTEEG +HKCS +Y+ Q+L++Y AH   VYKV W+ F SD+F++CS+DWTI++W    + P+  F  G  V  D++W+P+ +TVF A  + G + ++DL ++  +P       +      T + F+P+   +++GD  GQ+T  KL
Sbjct:  358 KLKQDLALMERVVLANVFQPKLAAYRQLPIIEDPDCVQMVMEEESWTEQSKNSHCPFLERLWDFSCELTMGRNVSCMVWNKKNPDLLAVGYGQVEFKNPNSGLVCCWSLKNPTWPDRVFHCESGVTALDFSASNANQLAVGMYDGTIAIYNVQTSEQTPITDSSDCANLHTSPVWQLTWIDHEDGLAADKGEILVSVSSDGRISKWIHYKS-----------MECVDLMKLKIHDLQWK----RHISSLTPGMCFDFHPNDSKIYLVGTEEGHIHKCSSSYNEQYLESYKAHKRPVYKVTWSPFCSDVFLSCSSDWTIQLWRQDLQIPVMGFTSGQRVVFDIMWSPHCATVFGAV-SEGKVEIWDLRVSSLDPTLVNW--TSPGVNPTALLFSPETDCVLVGDSEGQVTVYKL 752          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Xenopus
Match: creb5 (cAMP responsive element binding protein 5 [Source:Xenbase;Acc:XB-GENE-950883])

HSP 1 Score: 246.128 bits (627), Expect = 3.605e-70
Identity = 138/420 (32.86%), Postives = 221/420 (52.62%), Query Frame = 2
Query:  761 EMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQG-----------TLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLN-----FYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSD-------DVCQGPDGANLLSLSS-GTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVF-DLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKL 1945
            ++ K  + +  +ER+V +NTF      ++     +D   D+             +L  LW F  D  K   V+++SW+ K  DL AVG+G + F +Q  G+ C ++LKN  +PE IF  + GV ++D     P++L VG Y+G V +YN+   +  P+  S+    KHT PVW++KW   D  N  +       SV ADGR+T W  I++G+           C+D++++K +           +   G   +S  + G CF F P+  +I+L GTEEG +HKCS +Y+ QFLDTY  H   VYK+AW+ F  D+F++CSADW I +W      P+  F +  + V D++W+P S+ +F A T N  + ++DL  +  +P+   +  +    KLT + F      ++IGD  GQ+   +L
Sbjct:  364 KLEKFQQDLFFMERVVVENTFQSRLAAYRQLPVIADHEEDEDKISAVSSNIMSPSLNRLWSFACDVTKGHNVSSISWNKKNSDLLAVGYGQFGFTEQKGGMACCWSLKNIMWPERIFHCECGVTAVDFSAVHPNLLAVGMYNGTVAIYNVQNNEDFPVLDSSDNPNKHTSPVWQLKWIEHDRGNLGDDKGEILVSVCADGRITRWH-IRKGLD----------CNDLMKLKRTGSEKSKKSSNEKEKKGEAFISRQAPGMCFDFLPKDSNIYLAGTEEGHIHKCSCSYNEQFLDTYRGHKGPVYKIAWSPFCPDVFLSCSADWCIHLWQQDVLSPILTFSNTTNAVYDIMWSPSSALMFGAVTEN-RVEIWDLGTSTIDPLI--VNEANPGVKLTSILFAKNTNCVLIGDSDGQVNVYEL 769          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Xenopus
Match: creb5 (cAMP responsive element binding protein 5 [Source:Xenbase;Acc:XB-GENE-950883])

HSP 1 Score: 246.128 bits (627), Expect = 3.612e-70
Identity = 138/420 (32.86%), Postives = 221/420 (52.62%), Query Frame = 2
Query:  761 EMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQG-----------TLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLN-----FYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSD-------DVCQGPDGANLLSLSS-GTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVF-DLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKL 1945
            ++ K  + +  +ER+V +NTF      ++     +D   D+             +L  LW F  D  K   V+++SW+ K  DL AVG+G + F +Q  G+ C ++LKN  +PE IF  + GV ++D     P++L VG Y+G V +YN+   +  P+  S+    KHT PVW++KW   D  N  +       SV ADGR+T W  I++G+           C+D++++K +           +   G   +S  + G CF F P+  +I+L GTEEG +HKCS +Y+ QFLDTY  H   VYK+AW+ F  D+F++CSADW I +W      P+  F +  + V D++W+P S+ +F A T N  + ++DL  +  +P+   +  +    KLT + F      ++IGD  GQ+   +L
Sbjct:  364 KLEKFQQDLFFMERVVVENTFQSRLAAYRQLPVIADHEEDEDKISAVSSNIMSPSLNRLWSFACDVTKGHNVSSISWNKKNSDLLAVGYGQFGFTEQKGGMACCWSLKNIMWPERIFHCECGVTAVDFSAVHPNLLAVGMYNGTVAIYNVQNNEDFPVLDSSDNPNKHTSPVWQLKWIEHDRGNLGDDKGEILVSVCADGRITRWH-IRKGLD----------CNDLMKLKRTGSEKSKKSSNEKEKKGEAFISRQAPGMCFDFLPKDSNIYLAGTEEGHIHKCSCSYNEQFLDTYRGHKGPVYKIAWSPFCPDVFLSCSADWCIHLWQQDVLSPILTFSNTTNAVYDIMWSPSSALMFGAVTEN-RVEIWDLGTSTIDPLI--VNEANPGVKLTSILFAKNTNCVLIGDSDGQVNVYEL 769          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Xenopus
Match: creb5 (cAMP responsive element binding protein 5 [Source:Xenbase;Acc:XB-GENE-950883])

HSP 1 Score: 241.891 bits (616), Expect = 3.821e-69
Identity = 136/407 (33.42%), Postives = 215/407 (52.83%), Query Frame = 2
Query:  782 PIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLP-----LWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLN-----FYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSD-------DVCQGPDGANLLSLSS-GTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVF-DLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKL 1945
            P+ I    V+ N+F        Y+E+  D+       ++      LW F  D  K   V+++SW+ K  DL AVG+G + F +Q  G+ C ++LKN  +PE IF  + GV ++D     P++L VG Y+G V +YN+   +  P+  S+    KHT PVW++KW   D  N  +       SV ADGR+T W  I++G+           C+D++++K +           +   G   +S  + G CF F P+  +I+L GTEEG +HKCS +Y+ QFLDTY  H   VYK+AW+ F  D+F++CSADW I +W      P+  F +  + V D++W+P S+ +F A T N  + ++DL  +  +P+   +  +    KLT + F      ++IGD  GQ+   +L
Sbjct:  327 PVIINPEGVHMNSFLAF-----YHEEDEDKISAVSSNIMSPSLNRLWSFACDVTKGHNVSSISWNKKNSDLLAVGYGQFGFTEQKGGMACCWSLKNIMWPERIFHCECGVTAVDFSAVHPNLLAVGMYNGTVAIYNVQNNEDFPVLDSSDNPNKHTSPVWQLKWIEHDRGNLGDDKGEILVSVCADGRITRWH-IRKGLD----------CNDLMKLKRTGSEKSKKSSNEKEKKGEAFISRQAPGMCFDFLPKDSNIYLAGTEEGHIHKCSCSYNEQFLDTYRGHKGPVYKIAWSPFCPDVFLSCSADWCIHLWQQDVLSPILTFSNTTNAVYDIMWSPSSALMFGAVTEN-RVEIWDLGTSTIDPLI--VNEANPGVKLTSILFAKNTNCVLIGDSDGQVNVYEL 714          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Xenopus
Match: csrnp2 (cysteine-serine-rich nuclear protein 2 [Source:Xenbase;Acc:XB-GENE-983697])

HSP 1 Score: 113.62 bits (283), Expect = 1.546e-25
Identity = 101/403 (25.06%), Postives = 169/403 (41.94%), Query Frame = 2
Query:  788 KIVERMVNQNT---FDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDK--AKKIAVTALSWSPKYHDLFAVGHGSY-DFMKQSNGLICFYTLK-NPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSG----TCFAFNPQQEHIFLIGTEEGDVH-KCSKAYSTQFLDTYHAH---------HMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSP-VGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQI 1930
            +IVER ++++    FD   +D +       E   Q G  L   R  FD+  +K   V+ L WS +Y +L    + +  D   + +G+   + +K     PEY+F  QS V+S    R  P+++  G Y G + +++    K  P+  +      HT PV+ V        N  N  S+S DG++ SW+L                          D + Q  D   L+   S     TC +F     + F++G+EEG V+  C         + +  H         H AV  V +    S +F+T S DWT+++W      PL+ F+  S  V DV+W+P    +FA     G + +++L+ +   P     I  +    L  V +      + +G+  G+I
Sbjct:  199 RIVERALSEHVNIFFDYSGRDLE-----EKEGEIQAGAKLSFNRQFFDERWSKHRVVSCLDWSSQYPELLVASYNNNEDAPHEPDGVALVWNMKYKKMTPEYVFHCQSAVMSAAFARFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPLSAAAHTHPVYCVN--VVGTQNAHNLISISTDGKICSWSL--------------------------DMLSQPQDSMELVHKQSKAVAVTCMSFPVGDVNNFVVGSEEGSVYTACRHGSKAGISEMFEGHQGPITGIHCHSAVGAVDF----SHLFVTSSFDWTVKLWTTKNNKPLYSFEDNSDYVYDVMWSPTHPALFACVDGVGRLDLWNLNNDTEVPTAS--ITVEGNPALNRVRWTHSGREIAVGNSEGEI 562          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Xenopus
Match: csrnp2 (cysteine-serine-rich nuclear protein 2 [Source:Xenbase;Acc:XB-GENE-983697])

HSP 1 Score: 113.235 bits (282), Expect = 2.312e-25
Identity = 101/403 (25.06%), Postives = 169/403 (41.94%), Query Frame = 2
Query:  788 KIVERMVNQNT---FDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDK--AKKIAVTALSWSPKYHDLFAVGHGSY-DFMKQSNGLICFYTLK-NPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSG----TCFAFNPQQEHIFLIGTEEGDVH-KCSKAYSTQFLDTYHAH---------HMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSP-VGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQI 1930
            +IVER ++++    FD   +D +       E   Q G  L   R  FD+  +K   V+ L WS +Y +L    + +  D   + +G+   + +K     PEY+F  QS V+S    R  P+++  G Y G + +++    K  P+  +      HT PV+ V        N  N  S+S DG++ SW+L                          D + Q  D   L+   S     TC +F     + F++G+EEG V+  C         + +  H         H AV  V +    S +F+T S DWT+++W      PL+ F+  S  V DV+W+P    +FA     G + +++L+ +   P     I  +    L  V +      + +G+  G+I
Sbjct:  237 RIVERALSEHVNIFFDYSGRDLE-----EKEGEIQAGAKLSFNRQFFDERWSKHRVVSCLDWSSQYPELLVASYNNNEDAPHEPDGVALVWNMKYKKMTPEYVFHCQSAVMSAAFARFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPLSAAAHTHPVYCVN--VVGTQNAHNLISISTDGKICSWSL--------------------------DMLSQPQDSMELVHKQSKAVAVTCMSFPVGDVNNFVVGSEEGSVYTACRHGSKAGISEMFEGHQGPITGIHCHSAVGAVDF----SHLFVTSSFDWTVKLWTTKNNKPLYSFEDNSDYVYDVMWSPTHPALFACVDGVGRLDLWNLNNDTEVPTAS--ITVEGNPALNRVRWTHSGREIAVGNSEGEI 600          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Mouse
Match: Dnaic1 (dynein, axonemal, intermediate chain 1 [Source:MGI Symbol;Acc:MGI:1916172])

HSP 1 Score: 751.51 bits (1939), Expect = 0.000e+0
Identity = 367/696 (52.73%), Postives = 500/696 (71.84%), Query Frame = 2
Query:   71 TKGRRRSKIEEDIPEAGPQDDLGDFMHSK-IVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQGKLIDDLKEDKE---------------------------------PGEGETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKAT---FGTKVEEKSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAPKEKKGLDVPKGPEIEIQKLEKILALV 2047
            T+G RR + E+   + G   D  ++  SK  V+P DQ++LT+ ELKEEFTRILTA NPHAPQNIVR++FKE  YK I  V+Q+AVHFS  GNL+ +DSDEGRRQ  +   +    +  K                                  P   ET  + +  +   PV+P+  E+KLTNQFNF ERASQT+NNP RDR    EPPPR+NFS    QW IYDAY+++ EKQ+++KEK+        K E+ + +KLTS+E+ +D+++K+ +  KIVERMVNQNT+D+++QDFKYYED +DEYRDQ+GTLLPLW+F  DKAK++AVTAL W+PKY DLFAVGHGSYDFMKQS G++  Y++KNPS+PEY+F ++SG++ LD+H   P+++ VG+YDG V +YN+ +  S P + ST+++GKHTDPVW+VKWQ++D D+NLNF+SVS+DGR+ SWTL+K          +++V  D+I++K      + P+G  L ++  GT F F+ + +++FL+GTEEG ++KCSK+YS+QFLDTY AH+MAV  V WN +H+ +F++CS+DWT++IWDH+ K P+F++DL S VGDV WAPYSSTVFAA T +G  +V+DL++NKYE IC Q + +KKK K+THV FNP +PI+I+GDDRG I  LKLSPNLRK PKEKKG +V KGP +EI KL+K+L LV
Sbjct:   14 TRGARR-RDEDSGTDVGEGTD--EWSQSKATVRPPDQLELTDAELKEEFTRILTANNPHAPQNIVRYSFKEGTYKLIGFVNQMAVHFSQVGNLIPKDSDEGRRQHYRDEMVAGSQESIKVVTSEAENLEEEEEPKEGEGEAEAEAEAGSQTDIPAAAETTEKVIEEELMAPVQPK--ERKLTNQFNFSERASQTFNNPLRDRECQMEPPPRTNFSATANQWEIYDAYVDELEKQEKTKEKEKAKTPVAKKTEKMAMRKLTSMESQSDDITKVTQAAKIVERMVNQNTYDDVAQDFKYYEDTADEYRDQEGTLLPLWKFQNDKAKRLAVTALCWNPKYKDLFAVGHGSYDFMKQSRGMLLLYSMKNPSFPEYMFSSESGIMCLDVHVDHPYLVVVGYYDGNVAIYNLKKPHSQPCFRSTSKSGKHTDPVWQVKWQKDDMDHNLNFFSVSSDGRIVSWTLVK----------SELVHIDIIKLKTEGSTTEIPEGLQLHTVGCGTAFDFHKEIDYMFLVGTEEGKIYKCSKSYSSQFLDTYDAHNMAVDAVLWNPYHTKVFMSCSSDWTVKIWDHTIKTPMFIYDLNSAVGDVAWAPYSSTVFAAVTTDGKAHVFDLAVNKYEAICNQPVVAKKKNKITHVQFNPIHPIIIVGDDRGHIICLKLSPNLRKMPKEKKGQEVQKGPAVEIAKLDKLLNLV 694          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Mouse
Match: Wdr78 (WD repeat domain 78 [Source:MGI Symbol;Acc:MGI:2385328])

HSP 1 Score: 249.98 bits (637), Expect = 1.279e-71
Identity = 134/384 (34.90%), Postives = 214/384 (55.73%), Query Frame = 2
Query:  902 LWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDF-----DNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDV-------CQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVF-DLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAPKEKKG--LDVPKGPE 2008
            LW F+ D  K + V++LSW+    DL AVG+G++ F +Q  G+ C +++KNP +PE I+++  GV S+D   S P++L VG+++G V +YN+    + P+  S+    KH  PVW+V+W  +D      D      S+SADGR++ W +I++G+           CHD++ +K +           +    A +   + G CFAF+P+  +I+L GTEEG +HKCS +Y+ Q+L+TY  H   VYKV WN F  D+F++CSADW + IW      P   F      V DV W+P S+ +FAAA  N  + ++DL I+  +P+   +  +    K T V F  +   L++GD  GQ+   +L  N+  A    +G  +++  GP+
Sbjct:  434 LWSFSCDLTKGLNVSSLSWNKANPDLLAVGYGNFGFREQKKGMACCWSIKNPMWPERIYQSSYGVTSVDFSNSSPNLLAVGYHNGTVAIYNVQSSHNIPVLDSSESPQKHLGPVWQVQWIEQDRGTTGDDKREILVSISADGRISKW-IIRKGLD----------CHDLMRLKRTTATGGKKGGEKEKKGEALISRQAPGMCFAFHPKDTNIYLAGTEEGLIHKCSCSYNEQYLETYRGHKGPVYKVTWNPFCPDVFLSCSADWGVMIWHQDTVKPFLSFYPTTYVVYDVSWSPKSAYIFAAANEN-RVEIWDLQISTLDPLIVNV--ANPGIKFTTVLFAKETDCLLVGDSDGQVAVYELR-NMPTASDTSRGDVINILLGPK 802          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Mouse
Match: Dnaic1 (dynein, axonemal, intermediate chain 1 [Source:MGI Symbol;Acc:MGI:1916172])

HSP 1 Score: 125.176 bits (313), Expect = 1.200e-33
Identity = 56/86 (65.12%), Postives = 70/86 (81.40%), Query Frame = 2
Query: 1790 YVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAPKEKKGLDVPKGPEIEIQKLEKILALV 2047
            +V+DL++NKYE IC Q + +KKK K+THV FNP +PI+I+GDDRG I  LKLSPNLRK PKEKKG +V KGP +EI KL+K+L LV
Sbjct:    3 HVFDLAVNKYEAICNQPVVAKKKNKITHVQFNPIHPIIIVGDDRGHIICLKLSPNLRKMPKEKKGQEVQKGPAVEIAKLDKLLNLV 88          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Mouse
Match: Wdr78 (WD repeat domain 78 [Source:MGI Symbol;Acc:MGI:2385328])

HSP 1 Score: 128.257 bits (321), Expect = 3.592e-32
Identity = 75/240 (31.25%), Postives = 121/240 (50.42%), Query Frame = 2
Query:  902 LWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDF-----DNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDV-------CQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAH 1585
            LW F+ D  K + V++LSW+                              NP +PE I+++  GV S+D   S P++L VG+++G V +YN+    + P+  S+    KH  PVW+V+W  +D      D      S+SADGR++ W +I++G+           CHD++ +K +           +    A +   + G CFAF+P+  +I+L GTEEG +HKCS +Y+ Q+L+TY  H
Sbjct:  111 LWSFSCDLTKGLNVSSLSWNKA----------------------------NP-WPERIYQSSYGVTSVDFSNSSPNLLAVGYHNGTVAIYNVQSSHNIPVLDSSESPQKHLGPVWQVQWIEQDRGTTGDDKREILVSISADGRISKW-IIRKGLD----------CHDLMRLKRTTATGGKKGGEKEKKGEALISRQAPGMCFAFHPKDTNIYLAGTEEGLIHKCSCSYNEQYLETYRGH 310          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Mouse
Match: Wdr78 (WD repeat domain 78 [Source:MGI Symbol;Acc:MGI:2385328])

HSP 1 Score: 129.028 bits (323), Expect = 9.640e-31
Identity = 58/154 (37.66%), Postives = 96/154 (62.34%), Query Frame = 2
Query:  902 LWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDF-----DNNLNFYSVSADGRVTSWTLIKEGV 1348
            LW F+ D  K + V++LSW+    DL AVG+G++ F +Q  G+ C +++KNP +PE I+++  GV S+D   S P++L VG+++G V +YN+    + P+  S+    KH  PVW+V+W  +D      D      S+SADGR++ W +I++G+
Sbjct:  434 LWSFSCDLTKGLNVSSLSWNKANPDLLAVGYGNFGFREQKKGMACCWSIKNPMWPERIYQSSYGVTSVDFSNSSPNLLAVGYHNGTVAIYNVQSSHNIPVLDSSESPQKHLGPVWQVQWIEQDRGTTGDDKREILVSISADGRISKW-IIRKGL 586          
BLAST of Dynein intermediate chain 2, ciliary vs. UniProt
Match: sp|Q16959|DYI2_HELCR (Dynein intermediate chain 2, ciliary OS=Heliocidaris crassispina OX=1043166 PE=2 SV=1)

HSP 1 Score: 813.142 bits (2099), Expect = 0.000e+0
Identity = 393/672 (58.48%), Postives = 518/672 (77.08%), Query Frame = 2
Query:   92 KIEEDIPEAGPQDDLGDFMHSK-IVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQGK-----------------LIDDLKEDKEPGEGETETEDLSSQKETPVEPEV-SEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKATFGTKVEEKSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKD-PLFVFDLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAPKEKKGLDVPKGPEIEIQKLEKILALV 2047
            K ++D  EAG      ++M +K ++KP+DQ++L +QELKEEFTRILTA NPHAPQNIVR++FK+  +K  + VDQLA+HFS++GN++H+DSDE RRQ  + G                    D  ++ +EP EGE   E+      TP   E  S++KLTNQFNF ERASQTYNNP R+RG  TEPPPR+NFS    QW IYDAY+ED EKQ+++KEKKA    K ++KSKKKLT++ET +D+MS+I+   KI+ERMVNQNTFD++SQDFKYYED SDE+RDQ+GTLLPLW+F++DK+K++AVT++ W+PKY DLFAV HGSYDFMKQS G+I FYTLKNPS+PE+++ T SGV+ +D+    P+++CVG+ DG+VGV+N+T   + P++ STA+TGKHTDPVW+V WQ++D DNNLNF+SVS+DGRV +WTL+K          N++   DVI+++L      GP+G  L  L  GTCF F+ Q +++FL+GTEEG +HKCSKAYS+QFLDT+ AHHMAVYKV WN FH  IFI+CSADW+++IWDH+ ++ P+F FDLGS VGDV WAPYSSTVFAA TA+G ++V+DL++NKYEPICEQ +  KKKTKLTH++FNP +PI+++GDDRG ++SLKLSPNLRK PK+KKG  +  GPE EI K++K+LALV
Sbjct:   38 KDDDDATEAGEHGG-EEWMQTKSLIKPDDQLELNDQELKEEFTRILTANNPHAPQNIVRYSFKDCSFKQTSHVDQLAIHFSLDGNMIHKDSDEARRQQQRHGASEAISEQAISEAGEEKKEEDGEQKTEEPKEGEKRDEE-----STPAPAEAKSDQKLTNQFNFSERASQTYNNPYRERGTQTEPPPRANFSSTANQWEIYDAYMEDLEKQEKAKEKKAAPSKKDDDKSKKKLTALETQSDDMSRISHAAKIIERMVNQNTFDDVSQDFKYYEDMSDEFRDQEGTLLPLWKFSYDKSKRLAVTSVCWNPKYKDLFAVAHGSYDFMKQSRGMILFYTLKNPSFPEFVYPTDSGVMCIDIRPEHPYLICVGYCDGSVGVFNVTSTDANPVFQSTAKTGKHTDPVWQVAWQKDDLDNNLNFFSVSSDGRVVAWTLVK----------NELTYTDVIQLQLDSAPQDGPEGTQLTPLGCGTCFDFHKQTDYLFLVGTEEGKIHKCSKAYSSQFLDTFEAHHMAVYKVMWNHFHPKIFISCSADWSVKIWDHTYRNGPMFTFDLGSAVGDVAWAPYSSTVFAAVTADGKVHVFDLNLNKYEPICEQAVVQKKKTKLTHITFNPNFPIVLVGDDRGYVSSLKLSPNLRKVPKDKKGAALNHGPEAEIAKMDKLLALV 693          
BLAST of Dynein intermediate chain 2, ciliary vs. UniProt
Match: sp|Q5XIL8|DNAI1_RAT (Dynein intermediate chain 1, axonemal OS=Rattus norvegicus OX=10116 GN=Dnai1 PE=1 SV=1)

HSP 1 Score: 756.133 bits (1951), Expect = 0.000e+0
Identity = 370/700 (52.86%), Postives = 504/700 (72.00%), Query Frame = 2
Query:   71 TKGRRRSKIEEDIPEAGPQDDLGDFMHSKI-VKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQ------MAKQGKLIDDLKEDKE-------------------------------PGEGETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKAT---FGTKVEEKSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAPKEKKGLDVPKGPEIEIQKLEKILALV 2047
            T+G R+ + E+   + G   D  D+  SK  V+P DQ++LT+ ELKEEFTRILTA NPHAPQNIVR++FKE  YK I  V+Q+A+HFS  GNL+ +DSDEGRRQ      +A   + +  +  D E                               P   ET  + +  +   PV+P+  E+KLTNQFNF ERASQT+NNP RDR    EPPPR+NFS    QW IYDAY+++ EK +++KEK+ T      K E+ + +KLTS+E+ +D+++K+ +  KIVERMVNQNT+D+++QDFKYYED +DEYRDQ+GTLLPLW+F  DKAK++AVTAL W+PKY DLFAVGHGSYDFMKQS G++  Y++KNPS+PEY+F ++SG++ LD+H   P+++ VG+YDG V +YN+ +  S P + ST+++GKHTDPVW+VKWQ++D D+NLNF+SVS+DGR+ SWTL+K          +++V  DVI++K      + P+G  L ++  GT F F+ + +++FL+GTEEG ++KCSK+YS+QFLDTY AH+MAV  V WN +H+ +FI+CS+DWT++IWDH+ K P+F++DL + VGDV WAPYSSTVFAA T +G  +V+DL++NKYE IC Q + +KKK K+THV FNP +PI+I+GDDRG IT LKLSPNLRK PKEKKG +V KGP +EI KL+K+L LV
Sbjct:   14 TRGARKRE-EDSGTDVGEGAD--DWAQSKAAVRPPDQLELTDAELKEEFTRILTANNPHAPQNIVRYSFKERTYKLIGFVNQMAIHFSQVGNLIPKDSDEGRRQHYRDELVAGSQESVKVVTSDTEILEEEEEPKEGEGEGEGEAEGEAEAGSQTDVPAAAETTEKVIEEELMAPVQPK--ERKLTNQFNFSERASQTFNNPLRDRECQMEPPPRTNFSATANQWEIYDAYVDELEKLEKTKEKEKTKTPVAKKTEKMAMRKLTSMESQSDDITKVTQAAKIVERMVNQNTYDDVAQDFKYYEDAADEYRDQEGTLLPLWKFQNDKAKRLAVTALCWNPKYKDLFAVGHGSYDFMKQSRGMLLLYSMKNPSFPEYMFSSESGIMCLDMHMDHPYLVVVGYYDGNVAIYNLKKPHSQPCFRSTSKSGKHTDPVWQVKWQKDDMDHNLNFFSVSSDGRIVSWTLVK----------SELVHIDVIKLKDEGSTTEIPEGLQLHTVGCGTAFDFHKEIDYLFLVGTEEGKIYKCSKSYSSQFLDTYDAHNMAVDAVLWNPYHARVFISCSSDWTVKIWDHAIKTPMFIYDLNAAVGDVAWAPYSSTVFAAVTTDGKAHVFDLAVNKYEAICNQPVVAKKKNKITHVQFNPIHPIIIVGDDRGHITCLKLSPNLRKMPKEKKGQEVQKGPAVEIAKLDKLLNLV 698          
BLAST of Dynein intermediate chain 2, ciliary vs. UniProt
Match: sp|Q8C0M8|DNAI1_MOUSE (Dynein intermediate chain 1, axonemal OS=Mus musculus OX=10090 GN=Dnai1 PE=1 SV=1)

HSP 1 Score: 751.51 bits (1939), Expect = 0.000e+0
Identity = 367/696 (52.73%), Postives = 500/696 (71.84%), Query Frame = 2
Query:   71 TKGRRRSKIEEDIPEAGPQDDLGDFMHSK-IVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQGKLIDDLKEDKE---------------------------------PGEGETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKAT---FGTKVEEKSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAPKEKKGLDVPKGPEIEIQKLEKILALV 2047
            T+G RR + E+   + G   D  ++  SK  V+P DQ++LT+ ELKEEFTRILTA NPHAPQNIVR++FKE  YK I  V+Q+AVHFS  GNL+ +DSDEGRRQ  +   +    +  K                                  P   ET  + +  +   PV+P+  E+KLTNQFNF ERASQT+NNP RDR    EPPPR+NFS    QW IYDAY+++ EKQ+++KEK+        K E+ + +KLTS+E+ +D+++K+ +  KIVERMVNQNT+D+++QDFKYYED +DEYRDQ+GTLLPLW+F  DKAK++AVTAL W+PKY DLFAVGHGSYDFMKQS G++  Y++KNPS+PEY+F ++SG++ LD+H   P+++ VG+YDG V +YN+ +  S P + ST+++GKHTDPVW+VKWQ++D D+NLNF+SVS+DGR+ SWTL+K          +++V  D+I++K      + P+G  L ++  GT F F+ + +++FL+GTEEG ++KCSK+YS+QFLDTY AH+MAV  V WN +H+ +F++CS+DWT++IWDH+ K P+F++DL S VGDV WAPYSSTVFAA T +G  +V+DL++NKYE IC Q + +KKK K+THV FNP +PI+I+GDDRG I  LKLSPNLRK PKEKKG +V KGP +EI KL+K+L LV
Sbjct:   14 TRGARR-RDEDSGTDVGEGTD--EWSQSKATVRPPDQLELTDAELKEEFTRILTANNPHAPQNIVRYSFKEGTYKLIGFVNQMAVHFSQVGNLIPKDSDEGRRQHYRDEMVAGSQESIKVVTSEAENLEEEEEPKEGEGEAEAEAEAGSQTDIPAAAETTEKVIEEELMAPVQPK--ERKLTNQFNFSERASQTFNNPLRDRECQMEPPPRTNFSATANQWEIYDAYVDELEKQEKTKEKEKAKTPVAKKTEKMAMRKLTSMESQSDDITKVTQAAKIVERMVNQNTYDDVAQDFKYYEDTADEYRDQEGTLLPLWKFQNDKAKRLAVTALCWNPKYKDLFAVGHGSYDFMKQSRGMLLLYSMKNPSFPEYMFSSESGIMCLDVHVDHPYLVVVGYYDGNVAIYNLKKPHSQPCFRSTSKSGKHTDPVWQVKWQKDDMDHNLNFFSVSSDGRIVSWTLVK----------SELVHIDIIKLKTEGSTTEIPEGLQLHTVGCGTAFDFHKEIDYMFLVGTEEGKIYKCSKSYSSQFLDTYDAHNMAVDAVLWNPYHTKVFMSCSSDWTVKIWDHTIKTPMFIYDLNSAVGDVAWAPYSSTVFAAVTTDGKAHVFDLAVNKYEAICNQPVVAKKKNKITHVQFNPIHPIIIVGDDRGHIICLKLSPNLRKMPKEKKGQEVQKGPAVEIAKLDKLLNLV 694          
BLAST of Dynein intermediate chain 2, ciliary vs. UniProt
Match: sp|Q32KS2|DNAI1_BOVIN (Dynein intermediate chain 1, axonemal OS=Bos taurus OX=9913 GN=DNAI1 PE=2 SV=1)

HSP 1 Score: 750.74 bits (1937), Expect = 0.000e+0
Identity = 374/691 (54.12%), Postives = 500/691 (72.36%), Query Frame = 2
Query:   77 GRRRSKIEEDI-PEAGPQDDLGDFMHSK-IVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQGKLIDDLKEDK-----------------------------EPGEGETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKAT---FGTKVEEKSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAPKEKKGLDVPKGPEIEIQKLEKILALV 2047
            GR   K +ED   E G   D  +++ SK  VKP DQ+ LT+ ELKEEFTRILTA NPHAPQNIVR++FKE  YK I  VDQLAVHF+  GNL+ +DSDEGRRQ  +        +  K                             E  E   E E +     TP +P+  E+KLTN+FNF ERASQT+NNP RDR    EPPPR+NFS    QW IYDAY+E+ EKQ+++KEK+ T      K+ + + +K+TS+E+ +D+++K+ +  KIVERMVNQNT+D+++QDFKYYED +DEYRDQ+GTLLPLW+F  DKAK++AVTAL W+PKY+DLFAVGHGSYDFMKQS G++  Y++KNPS+PEYIF ++SG++ LD+H   P+++ VG YDG V +YN+ +  S P + S+A++GKHTDPVW+V+WQ++D D+NLNF+SVS+DGR+ SWTL+K          +++V  DVI++K+     +G +G  + ++  GT F F+ + +++FL+GTEEG ++KCSK+YS+QFLDTY AH+MAV  V+WN +H+ +F++CS+DWT++IWDH+ K P+F++DL S VGDV WAPYSSTVFAA T NG  +V+DLSINKYE IC Q + +KKK KLTHV FNP +PI+I+GDDRG +T LKLSPNLRK PKEKKG +V KGP +EI KL+K+L LV
Sbjct:   24 GRGARKRDEDSGTEVGEGTD--EWVQSKATVKPPDQLDLTDAELKEEFTRILTANNPHAPQNIVRYSFKEGTYKLIGFVDQLAVHFTQVGNLIPKDSDEGRRQHYRDELAASSQESAKVVISETEILEEEEEPKEVEAGSQTDVPIVEASEKMAEEELM-----TPKQPK--ERKLTNKFNFSERASQTFNNPLRDRECQMEPPPRTNFSATANQWEIYDAYMEELEKQEKTKEKEKTKTPVAKKMGKMAMRKMTSMESQSDDITKVTQAAKIVERMVNQNTYDDVAQDFKYYEDAADEYRDQEGTLLPLWKFQNDKAKRLAVTALCWNPKYNDLFAVGHGSYDFMKQSRGMLLLYSMKNPSFPEYIFSSESGIMCLDMHVDHPYLVVVGHYDGNVAIYNLKKPHSQPSFRSSAKSGKHTDPVWQVRWQKDDMDHNLNFFSVSSDGRIVSWTLVK----------SELVHTDVIKLKVEGSTTEGLEGLQIHTVGCGTAFDFHREIDYLFLVGTEEGKIYKCSKSYSSQFLDTYDAHNMAVDAVSWNPYHTKVFMSCSSDWTVKIWDHTIKTPMFIYDLNSAVGDVAWAPYSSTVFAAVTTNGKTHVFDLSINKYEAICNQPVVAKKKNKLTHVQFNPIHPIIIVGDDRGHVTCLKLSPNLRKMPKEKKGQEVQKGPAVEIAKLDKLLNLV 695          
BLAST of Dynein intermediate chain 2, ciliary vs. UniProt
Match: sp|Q9UI46|DNAI1_HUMAN (Dynein intermediate chain 1, axonemal OS=Homo sapiens OX=9606 GN=DNAI1 PE=1 SV=1)

HSP 1 Score: 735.332 bits (1897), Expect = 0.000e+0
Identity = 377/691 (54.56%), Postives = 502/691 (72.65%), Query Frame = 2
Query:   77 GRRRSKIEEDI-PEAGPQDDLGDFMHSK-IVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQ----------------MAKQGKLIDDLKEDK---EPGE---------GETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKATFGTKVEEKSKK----KLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAPKEKKGLDVPKGPEIEIQKLEKILALV 2047
            GR   K +ED   E G   D  ++  SK  V+P DQ++LT+ ELKEEFTRILTA NPHAPQNIVR++FKE  YKPI  V+QLAVH++  GNL+ +DSDEGRRQ                +++ G L +D +  +   EPG           E  TE+   +  TP +P+  E+KLTNQFNF ERASQTYNNP RDR   TEPPPR+NFS    QW IYDAY+E+ EKQ+++KEK+    T V +KS K    KLTS+E+  D++ K+++  KI+ERMVNQNT+D+I+QDFKYY+D +DEYRDQ GTLLPLW+F  DKAK+++VTAL W+PKY DLFAVG+GSYDFMKQS G++  Y+LKNPS+PEY+F + SGV+ LD+H   P+++ VG YDG V +YN+ +  S P + S+A++GKH+DPVW+VKWQ++D D NLNF+SVS+DGR+ SWTL+K            +V  DVI++K+     + P+G  L  +  GT F F+ + +++FL+GTEEG ++KCSK+YS+QFLDTY AH+M+V  V+WN +H+ +F++CS+DWT++IWDH+ K P+F++DL S VGDV WAPYSSTVFAA T +G  +++DL+INKYE IC Q +A+ KK +LTHV FN  +PI+I+GDDRG I SLKLSPNLRK PKEKKG +V KGP +EI KL+K+L LV
Sbjct:   21 GRGTRKRDEDSGTEVGEGTD--EWAQSKATVRPPDQLELTDAELKEEFTRILTANNPHAPQNIVRYSFKEGTYKPIGFVNQLAVHYTQVGNLIPKDSDEGRRQHYRDELVAGSQESVKVISETGNLEEDEEPKELETEPGSQTDVPAAGAAEKVTEE---ELMTPKQPK--ERKLTNQFNFSERASQTYNNPVRDRECQTEPPPRTNFSATANQWEIYDAYVEELEKQEKTKEKEKA-KTPVAKKSGKMAMRKLTSMESQTDDLIKLSQAAKIMERMVNQNTYDDIAQDFKYYDDAADEYRDQVGTLLPLWKFQNDKAKRLSVTALCWNPKYRDLFAVGYGSYDFMKQSRGMLLLYSLKNPSFPEYMFSSNSGVMCLDIHVDHPYLVAVGHYDGNVAIYNLKKPHSQPSFCSSAKSGKHSDPVWQVKWQKDDMDQNLNFFSVSSDGRIVSWTLVKR----------KLVHIDVIKLKVEGSTTEVPEGLQLHPVGCGTAFDFHKEIDYMFLVGTEEGKIYKCSKSYSSQFLDTYDAHNMSVDTVSWNPYHTKVFMSCSSDWTVKIWDHTIKTPMFIYDLNSAVGDVAWAPYSSTVFAAVTTDGKAHIFDLAINKYEAICNQPVAA-KKNRLTHVQFNLIHPIIIVGDDRGHIISLKLSPNLRKMPKEKKGQEVQKGPAVEIAKLDKLLNLV 692          
BLAST of Dynein intermediate chain 2, ciliary vs. TrEMBL
Match: gnl|BL_ORD_ID|22932477 (tr|A0A4S2L4T2|A0A4S2L4T2_OPIFE WD_REPEATS_REGION domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009831 PE=4 SV=1)

HSP 1 Score: 931.784 bits (2407), Expect = 0.000e+0
Identity = 439/660 (66.52%), Postives = 533/660 (80.76%), Query Frame = 2
Query:   74 KGRRRSKIEEDIPEAGPQDDLGDFMHSKIVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQGKLIDDLKEDKEPGEGETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKATFGT-KVEEKSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAPKEKKGLDVPKGPEIEIQKLEKILALVG 2050
            K +RRS+ E +  E   +++L +F    ++KP+DQ+QLTEQELKEE TR+LTATNPHAPQNIVRFNFK+  Y+ I+QVDQ +VHF  EG++L +DSDEGRRQMA+ G L         P  G  E E             +  KKLTNQFNFCER++QTYNNP R+RGN+TEPPPR+ FS N+TQW+IYD Y  D++KQQ+  ++K   G  K E K KKK +  +T  D++S+ A+PIKI+ERM+NQNT DE++QDFKYYEDPSDEYRDQ GTLLPLW FTF+KA+K+AVTAL WSP+Y+DLFAVGHGSYDFMKQSNGLICFYT+KNP YPEYIFET SGVLSLDLH  LPHMLCVGFYDG+VGVYNI Q KSGPLY+STA+TGKHTDPVWEV+WQ  D D NLNF+SVSADGRVTSWTL+KEGVG  HECPND+   D + +K+        + + L++L  GT F F+    H+FL+ TEEG V+KCSKAYS+Q+L +Y AHHM+VY+VAWN FH DIFITCSADWT++IWDH+KKDP+F++DLGSPVGDV WAPYSSTVFAA TA+G ++VYDLS+NKYEP+C QL+ +KKKTKLTH++FNPKY I+I+GDDRGQ+TSLKLSPNLRK PKEKKGLD PKGPE+E++KLEKIL+LVG
Sbjct:    6 KKKRRSQGEGEDAEVIFREELDEFGLRSVIKPDDQLQLTEQELKEEVTRVLTATNPHAPQNIVRFNFKDCQYRQISQVDQASVHFWHEGHMLLKDSDEGRRQMARDGTL---------PTAGPVEEEANKEGAFVETAEGMQPKKLTNQFNFCERSTQTYNNPHRERGNMTEPPPRATFSANVTQWIIYDDYDADYQKQQEKTKEKKVAGGPKYEGKQKKKSSHADTLNDDLSRFAQPIKILERMINQNTHDEVAQDFKYYEDPSDEYRDQNGTLLPLWNFTFEKARKLAVTALCWSPRYNDLFAVGHGSYDFMKQSNGLICFYTMKNPEYPEYIFETDSGVLSLDLHHGLPHMLCVGFYDGSVGVYNINQHKSGPLYMSTAKTGKHTDPVWEVRWQPNDLDANLNFFSVSADGRVTSWTLVKEGVGSMHECPNDMGQFDALVLKMVTSSGDSSEPSQLITLDCGTAFDFHRTLSHLFLVATEEGMVYKCSKAYSSQYLGSYEAHHMSVYRVAWNHFHPDIFITCSADWTVKIWDHNKKDPVFMYDLGSPVGDVAWAPYSSTVFAAVTADGRVHVYDLSVNKYEPLCNQLVTAKKKTKLTHLAFNPKYSIIIVGDDRGQVTSLKLSPNLRKKPKEKKGLDQPKGPEMEVRKLEKILSLVG 656          
BLAST of Dynein intermediate chain 2, ciliary vs. TrEMBL
Match: gnl|BL_ORD_ID|21474507 (tr|A0A075A3K8|A0A075A3K8_9TREM WD_REPEATS_REGION domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_12527 PE=4 SV=1)

HSP 1 Score: 914.45 bits (2362), Expect = 0.000e+0
Identity = 437/699 (62.52%), Postives = 531/699 (75.97%), Query Frame = 2
Query:   74 KGRRRSKIEEDIPEAGPQDDLGDFMHSKIVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQGKLIDDLKEDKEPGEGETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEK-QQQSKEKKATFGTKVEEKSKKKLTSIETAA-----------DEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIK----------------------------EGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAPKEKKGLDVPKGPEIEIQKLEKILALVG 2050
            K +R+S+ + +  E   +++L +F    ++KP+DQ+QLTEQELKEE TR+LTATNPHAPQNIVRFNFK+  Y+ I+QVDQ +VHF  EG++L +DSDEGRRQMA+ G L         P  G  E +             V  KKLTNQFNFCER++QTYNNP R+RGN+TEPPPR+ FS N+TQW+IYD Y  D +K Q+++KEKK     K E K KKK +  +T             D++S+ A+PIKI+ERM+NQNT DE++QDFKYYEDPSDEYRDQ GTLLPLW F F+KA+K+AVTAL WSP+Y+DLFAVGHGSYDFMKQSNGLICFYT+KNP YPEYIFET SGVLSLDLH  LPHMLCVGFYDG+VGVYNI Q KSGPLY+STA+TGKHTDPVWEV+WQ  D D NLNF+SVSADGRVTSWTL+K                            EGVG  HECPND+   D + +K+        + + L++L  GT F F+    H+FL+ TEEG V+KCSKAYS+Q+L +Y AHHM+VY+VAWN FH DIFITCSADWT++IWDH+KKDP+F++DLGSPVGDV WAPYSSTVFAA TA+G ++VYDLS+NKYEP+C QL+ +KKKTKLTH++FNPKY I+I+GDDRGQ+ SLKLSPNLRK PKEKKGLD PKGPE+EI+KLEKIL+LVG
Sbjct:    6 KKKRKSQADGEDAEVVFREELDEFGLRSVIKPDDQLQLTEQELKEEVTRVLTATNPHAPQNIVRFNFKDCQYRQISQVDQASVHFWHEGHMLLKDSDEGRRQMARDGTL---------PIAGSVEEDANKEGALVETAEGVQPKKLTNQFNFCERSTQTYNNPHRERGNMTEPPPRATFSANVTQWIIYDDYEADQQKLQEKTKEKKVAGAQKYEGKQKKKSSHADTLLPITYDYPFQQNDDLSRFAQPIKILERMINQNTHDEVAQDFKYYEDPSDEYRDQNGTLLPLWNFAFEKARKLAVTALCWSPRYNDLFAVGHGSYDFMKQSNGLICFYTMKNPEYPEYIFETDSGVLSLDLHHGLPHMLCVGFYDGSVGVYNINQHKSGPLYMSTAKTGKHTDPVWEVRWQPNDLDANLNFFSVSADGRVTSWTLVKLLKLNDYKLLSVVHFSFVVSITFNTVLQEGVGSMHECPNDMGQFDALVLKMVTSSGDSSEPSQLITLDCGTAFDFHRTLPHLFLVATEEGMVYKCSKAYSSQYLGSYEAHHMSVYRVAWNHFHPDIFITCSADWTVKIWDHNKKDPVFMYDLGSPVGDVAWAPYSSTVFAAVTADGRVHVYDLSVNKYEPLCNQLVTAKKKTKLTHLAFNPKYSIIIVGDDRGQVISLKLSPNLRKKPKEKKGLDQPKGPEMEIRKLEKILSLVG 695          
BLAST of Dynein intermediate chain 2, ciliary vs. TrEMBL
Match: gnl|BL_ORD_ID|22924198 (tr|A0A4S2L493|A0A4S2L493_OPIFE WD_REPEATS_REGION domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009831 PE=4 SV=1)

HSP 1 Score: 905.205 bits (2338), Expect = 0.000e+0
Identity = 431/660 (65.30%), Postives = 525/660 (79.55%), Query Frame = 2
Query:   74 KGRRRSKIEEDIPEAGPQDDLGDFMHSKIVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQGKLIDDLKEDKEPGEGETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKATFGT-KVEEKSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAPKEKKGLDVPKGPEIEIQKLEKILALVG 2050
            K +RRS+ E +  E   +++L +F    ++KP+DQ+QLTEQELKEE TR+LTATNPHAPQNIVRFNFK+  Y+ I+QVDQ +VHF  EG++L +DSDEGRRQMA+ G L         P  G  E E             +  KKLTNQFNFCER++QTYNNP R+RGN+TEPPPR+ FS N+TQW+IYD Y  D++KQQ+  ++K   G  K E K KKK +  +T  D++S+ A+PIKI+ERM+NQNT DE++QDFKYYEDPSDEYRDQ GTLLPLW FTF+KA+K+AVTAL WSP+Y+DLFAVGHGSYDFMKQSNGLICFYT+KNP YPEYIFET SGVLSLDLH  LPHMLCVGFYDG+VGVYNI Q KSGPLY+STA+TGKHTDPVWEV+WQ  D D NLNF+SVSADGRVTSWTL+K          ND+   D + +K+        + + L++L  GT F F+    H+FL+ TEEG V+KCSKAYS+Q+L +Y AHHM+VY+VAWN FH DIFITCSADWT++IWDH+KKDP+F++DLGSPVGDV WAPYSSTVFAA TA+G ++VYDLS+NKYEP+C QL+ +KKKTKLTH++FNPKY I+I+GDDRGQ+TSLKLSPNLRK PKEKKGLD PKGPE+E++KLEKIL+LVG
Sbjct:    6 KKKRRSQGEGEDAEVIFREELDEFGLRSVIKPDDQLQLTEQELKEEVTRVLTATNPHAPQNIVRFNFKDCQYRQISQVDQASVHFWHEGHMLLKDSDEGRRQMARDGTL---------PTAGPVEEEANKEGAFVETAEGMQPKKLTNQFNFCERSTQTYNNPHRERGNMTEPPPRATFSANVTQWIIYDDYDADYQKQQEKTKEKKVAGGPKYEGKQKKKSSHADTLNDDLSRFAQPIKILERMINQNTHDEVAQDFKYYEDPSDEYRDQNGTLLPLWNFTFEKARKLAVTALCWSPRYNDLFAVGHGSYDFMKQSNGLICFYTMKNPEYPEYIFETDSGVLSLDLHHGLPHMLCVGFYDGSVGVYNINQHKSGPLYMSTAKTGKHTDPVWEVRWQPNDLDANLNFFSVSADGRVTSWTLVK----------NDMGQFDALVLKMVTSSGDSSEPSQLITLDCGTAFDFHRTLSHLFLVATEEGMVYKCSKAYSSQYLGSYEAHHMSVYRVAWNHFHPDIFITCSADWTVKIWDHNKKDPVFMYDLGSPVGDVAWAPYSSTVFAAVTADGRVHVYDLSVNKYEPLCNQLVTAKKKTKLTHLAFNPKYSIIIVGDDRGQVTSLKLSPNLRKKPKEKKGLDQPKGPEMEVRKLEKILSLVG 646          
BLAST of Dynein intermediate chain 2, ciliary vs. TrEMBL
Match: gnl|BL_ORD_ID|22824166 (tr|A0A5K4F0L6|A0A5K4F0L6_SCHMA Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 873.233 bits (2255), Expect = 0.000e+0
Identity = 420/676 (62.13%), Postives = 521/676 (77.07%), Query Frame = 2
Query:   47 MKGAKDKKTKGRRRSKIEEDIPE--AGPQDDLGDFMHSKIVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQGKLI-DDLK---EDKEPGEGETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKATFGT--KVEEKSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAPKEKKGLDVPKGPEIEIQKLEKILALVG 2050
            MK    ++T  +++ K ++D  E  +  +++  D+     +KPEDQ+QL+EQELKEE TR+L +TNPHAPQNIVR+NFK+  Y  + QVDQ+A+HF  E  +L  DSDE RRQ+++ G +  +DL+    +KEP     E+ DL          ++ +KK+TNQFNFCER++QTYNNP RDRG +TEPPPR+NFS N+TQW IYD Y+EDFEKQQ+  + K   G   K E K+ K + S ET  DE+S+ A+P+KIVERM+NQNT DEI+QDFKYYEDPSDE+RD QGTLLPLW F+F+KA+KIAVT+L WS +Y DLFAVG+GSYDF+KQSNGLIC YTLKNPSYPEY  ET+SGVLSLDLH SLP++LCVGFYDGAVGVY+I Q KSGPLYLSTA+TGKHTDPVWEV+WQ  D D NLNF+S+SADGRVTSWTLIK  +GK           D + +K+  +  +G      ++L  GT F F+  Q HIFL+ TEEG V KCSKAY++Q+L TY AHHMAVY+VAWNLFH DIFITCSADWT++IWD +K  P+F FDLGSPVGDV WAPYSSTVFAA TA+G ++VYDLSINKY+P+C QLI +KK TKLTH++FNP+Y I+I+GDD GQ+ SLKLSPNLRK PKEKKG +  KGPE+EI+KLEKIL+L G
Sbjct:    1 MKLELKRRTSKKQQRKSQQDAEEFESSLREETDDYGVRAALKPEDQLQLSEQELKEEITRVLKSTNPHAPQNIVRYNFKDGQYTQVPQVDQMAIHFWHESYMLPIDSDEARRQISRDGTMQPEDLQTEEHNKEPATAVKES-DL----------QLPQKKVTNQFNFCERSTQTYNNPQRDRGGMTEPPPRANFSANVTQWSIYDDYIEDFEKQQEKNKDKKLLGMGHKQETKTHKNIISGETQGDELSRFAQPLKIVERMINQNTHDEIAQDFKYYEDPSDEFRDNQGTLLPLWSFSFEKARKIAVTSLCWSSQYSDLFAVGYGSYDFLKQSNGLICAYTLKNPSYPEYHLETESGVLSLDLHPSLPYILCVGFYDGAVGVYSILQHKSGPLYLSTARTGKHTDPVWEVRWQPNDLDANLNFFSISADGRVTSWTLIKNDIGK----------FDAVILKMIANSNEGIGHPRSITLDCGTAFDFHRTQNHIFLVATEEGMVFKCSKAYTSQYLATYEAHHMAVYRVAWNLFHPDIFITCSADWTVKIWDQAKSTPMFTFDLGSPVGDVAWAPYSSTVFAAVTADGRVHVYDLSINKYDPLCNQLIVTKKNTKLTHIAFNPQYSIIIVGDDHGQVNSLKLSPNLRKLPKEKKGAEQVKGPEVEIKKLEKILSLAG 655          
BLAST of Dynein intermediate chain 2, ciliary vs. TrEMBL
Match: gnl|BL_ORD_ID|21435045 (tr|A0A1S8X644|A0A1S8X644_9TREM WD domain, G-beta repeat protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_02167 PE=4 SV=1)

HSP 1 Score: 857.825 bits (2215), Expect = 0.000e+0
Identity = 413/686 (60.20%), Postives = 505/686 (73.62%), Query Frame = 2
Query:   80 RRRSKIEEDIPEAGPQDDLGDFMHSKIVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQGKLIDDLKEDKEPGEGETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEK---------QQQSKEKKATFGTKVEEKSKKKLTSIETAA-----------DEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGS-------YDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIK----------------------------EGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAPK 1972
            +R+S+ + +  E   +++L +F    ++KP+DQ+QLTEQELKEE TR+LTATNPHAPQNIVRFNFK+  Y+ I+QVDQ +VHF  EG++L +DSDEGRRQMA+ G L         P  G  E +             V  KKLTNQFNFCER++QTYNNP R+RGN+TEPPPR+ FS N+TQW+IYD Y  D +K         Q+++KEKK     K E K KKK +  +T             D++S+ A+PIKI+ERM+NQNT DE++QDFKYYEDPSDEYRDQ GTLLPLW F F+KA+K+AVTAL WSP+Y+DLFAVGHGS       +DFMKQSNGLICFYT+KNP YPEYIFET SGVLSLDLH  LPHMLCVGFYDG+VGVYNI Q KSGPLY+STA+TGKHTDPVWEV+WQ  D D NLNF+SVSADGRVTSWTL+K                            EGVG  HECPND+   D + +K+        + + L++L  GT F F+    H+FL+ TEEG V+KCSKAYS+Q+L +Y AHHM+VY+VAWN FH DIFITCSADWT++IWDH+KKDP+F++DLGSPVGDV WAPYSSTVFAA TA+G ++VYDLS+NKYEP+C QL+ +KKKTKLTH++FNPKY I+I+GDDRGQ+ SLKLSPNLRK PK
Sbjct:   86 KRKSQADGEDAEVVFREELDEFGLRSVIKPDDQLQLTEQELKEEVTRVLTATNPHAPQNIVRFNFKDCQYRQISQVDQASVHFWHEGHMLLKDSDEGRRQMARDGTL---------PIAGSVEEDANKEGALVETAEGVQPKKLTNQFNFCERSTQTYNNPHRERGNMTEPPPRATFSANVTQWIIYDDYEADQQKLVSLANPYKQEKTKEKKVAGAQKYEGKQKKKSSHADTLLPITYDYPFQQNDDLSRFAQPIKILERMINQNTHDEVAQDFKYYEDPSDEYRDQNGTLLPLWNFAFEKARKLAVTALCWSPRYNDLFAVGHGSCKFFVQSHDFMKQSNGLICFYTMKNPEYPEYIFETDSGVLSLDLHHGLPHMLCVGFYDGSVGVYNINQHKSGPLYMSTAKTGKHTDPVWEVRWQPNDLDANLNFFSVSADGRVTSWTLVKLLKLNDYKLLSVVHFSFVVSITFNTVLQEGVGSMHECPNDMGQFDALVLKMVTSSGDSSEPSQLITLDCGTAFDFHRTLPHLFLVATEEGMVYKCSKAYSSQYLGSYEAHHMSVYRVAWNHFHPDIFITCSADWTVKIWDHNKKDPVFMYDLGSPVGDVAWAPYSSTVFAAVTADGRVHVYDLSVNKYEPLCNQLVTAKKKTKLTHLAFNPKYSIIIVGDDRGQVISLKLSPNLRKKPK 762          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Cavefish
Match: dnai1.2 (dynein, axonemal, intermediate chain 1, paralog 2 [Source:ZFIN;Acc:ZDB-GENE-070112-1302])

HSP 1 Score: 789.645 bits (2038), Expect = 0.000e+0
Identity = 378/644 (58.70%), Postives = 488/644 (75.78%), Query Frame = 2
Query:  158 IVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQ------GKLI----DDLKED---KEPGEGETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKATF-GTKVEEKSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAPKEKKGLDVPKGPEIEIQKLEKILALV 2047
            +VKP DQ+ L+E ELKEEFTR+LTA NPHAPQNIVR++FKE  YKPI+ VDQLA+HF +EGNLLH+DSDE RRQ AKQ      G L      DL ED    E G GE   + +       V+    E+K+TNQFN+ ERASQT NNP R+RG  TEPPPR+ FS    QW IYDAY+E+ +KQ+QSKEK+ T    K E+K KKK+T +E  +D+++K+AK  KI+ERMV QNTFD+I+QDFKY+ED SDE+R+Q+GTLLPLW+F +DKAK ++VTAL W   Y DLFAVG GSY F KQ  G++ FY+LKN +YPEYIF T SGV+ LD+H+ L  ++ VGFYDG+VGVYN+ +    P+Y STA+ GKHTDPVW+VKWQ++D DNN NF+S+S+DGRV SWTL+K          N++V  D+I + +   +  G +G  L +++ GT F F+ Q +++FLIGTEEG +HKCSK YS+QFL+TY AH+MAV  V WN FH  +FI+CS+DWT++IWDH+ K P+F FDL +PVGDV W+PYSSTVFAA T +G ++V+DLSINKYE IC+Q +A+ KKTKLTH+ FNP YPI+I+GDDRG +TSLKLSPNLR+ PKEKKG ++PKGPE+E+ K+EK+L+L+
Sbjct:    6 LVKPADQLDLSEAELKEEFTRVLTANNPHAPQNIVRYSFKERSYKPISSVDQLAIHFVLEGNLLHKDSDEARRQRAKQEIPEADGVLTCVEQADLTEDTGDAEEGAGEERPDSVD------VKSGKMERKVTNQFNYSERASQTLNNPPRERGCQTEPPPRAKFSATANQWEIYDAYVEELQKQEQSKEKQKTLVSKKEEDKGKKKMTVVENPSDDITKVAKVTKIIERMVTQNTFDDIAQDFKYFEDASDEFREQEGTLLPLWKFQYDKAKHLSVTALCWLCNYKDLFAVGLGSYKFTKQGRGMLLFYSLKNSTYPEYIFTTLSGVMCLDIHKQLSSLVAVGFYDGSVGVYNLKEEGPQPIYKSTAKMGKHTDPVWQVKWQKDDIDNNHNFFSISSDGRVVSWTLVK----------NELVFTDIIRLSVEGSISNGQEGMQLPAMACGTSFDFHQQIDYLFLIGTEEGKIHKCSKCYSSQFLETYAAHNMAVDAVKWNQFHPKVFISCSSDWTVKIWDHTIKSPMFTFDLNAPVGDVAWSPYSSTVFAAVTTDGKVHVFDLSINKYEAICQQAVAA-KKTKLTHIEFNPVYPIIIVGDDRGYVTSLKLSPNLRRKPKEKKGQELPKGPEVEVAKMEKLLSLL 632          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Cavefish
Match: wdr78 (WD repeat domain 78 [Source:NCBI gene;Acc:103046564])

HSP 1 Score: 226.098 bits (575), Expect = 2.668e-63
Identity = 135/411 (32.85%), Postives = 211/411 (51.34%), Query Frame = 2
Query:  770 KIAKPIKIVERMVNQNTFDEISQDFKYYEDPSD-----------EYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLN-------FYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVF-DLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKL 1945
            K  + ++++ER V QN +      ++     +D           E   Q   L  LW F+ +      V+ ++W+ K  DL AVG+   D   Q +GL+C ++LKNP +P+ IF+ +S V SLD   S    L VG +DG++ +YN+   K  P+  S+    KHT PVW+VKW   D + N           SV+ADGRV  W           EC   + C D++++     V +   GA + S + G CF F+    +I+L GT EG +HKCS +Y+ QFLDTY AH   V KV W+ F  D+F++CSADWTI++W      P+  F    + V DV+W+P  +TVF     +  + +++L  +  +P    +  +    KLT + F  +   +++GD  G+++  KL
Sbjct:  360 KFQQDLEVMERAVLQNIYQPKHAAYRLLPILTDSDILKTEKGDLEESSQSPALKHLWAFSCELTVAHDVSCMAWNKKNPDLLAVGYEQLDINDQKSGLVCCWSLKNPQWPDRIFQCESAVTSLDFSASNASQLAVGMHDGSIVIYNVQFTKKTPVIDSSNCDPKHTGPVWQVKWI--DCEQNSAGASEAEMLISVAADGRVCKWFF--------REC---LTCIDLMKLT----VMRNDSGALISSQAPGLCFDFHRNNSNIYLTGTGEGHIHKCSCSYNEQFLDTYKAHKGPVRKVTWSPFCPDVFLSCSADWTIQLWRQDLFTPVLGFTSTQNAVHDVMWSPRWATVFGVINED-RVEIWNLGASTQDPTV--VSVANPGVKLTSLLFASETDCVLVGDSEGRVSVYKL 750          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Cavefish
Match: DYNC1I1 (dynein cytoplasmic 1 intermediate chain 1 [Source:NCBI gene;Acc:103027766])

HSP 1 Score: 117.087 bits (292), Expect = 5.699e-27
Identity = 99/398 (24.87%), Postives = 179/398 (44.97%), Query Frame = 2
Query:  779 KPIKIVERMVNQNT---FDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDK--AKKIAVTALSWSPKYHDLFAVGHGSY-DFMKQSNGLICFYTLK-NPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYS-TQFLDTYHAHHMAVYKVAWN-----LFHSDIFITCSADWTIRIWDHSKKDPLFVF-DLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQI 1930
            + I+++ER + +++   FD   +D    ED   +   Q G+ L   R  +D+  +K   +T L WSP+Y +L    + +  D   + +G+   + +K   + PEYI+  QS V+S+   R  P++L  G Y G + +++    +  P+  +      HT PV+ V        NNL   +VS DGR+ SW+L             D++      ++L           N     + T  AF     + +++G+EEG V+  S+  S     + +  H   V  ++ +     +  S +F+T S DWT+++W      PL+ F D    V DV+W+P    +FAA    G + +++L+ +   P     I  +    L  V +      + +GD  G++
Sbjct:  199 RSIRVMERALAEDSNIFFDYSGRDL---EDKEGDL--QGGSSLSFSRLFYDERWSKHRVITCLDWSPQYPELLVASYNNNEDAPHEPDGVALVWNMKFKKTTPEYIYHCQSPVVSVGFARFHPNLLVGGTYSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPVYCVNVVGTQNANNL--ITVSTDGRMCSWSL-------------DMLSQPQESMELV---------YNKSKPVAVTGMAFPAGDVNNYVVGSEEGTVYTASRHGSKAGICEMFEGHQGPVTGISCHSAVGPVDFSHLFVTSSFDWTVKLWSTKHNKPLYSFEDNADYVYDVMWSPVHPALFAAVDGMGRLDLWNLNNDTEVPTASVTI--EGAPALNRVRWASGGKEVAVGDSEGRV 565          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Cavefish
Match: dync1i2b (dynein, cytoplasmic 1, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-090121-1])

HSP 1 Score: 112.849 bits (281), Expect = 1.416e-25
Identity = 99/397 (24.94%), Postives = 171/397 (43.07%), Query Frame = 2
Query:  788 KIVERMVNQNT---FDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDK--AKKIAVTALSWSPKYHDLFAVGHGSYDFM-KQSNGLICFYTLK-NPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVC--HDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVH-KCSKAYSTQFLDTYHAHHMAV-----YKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSP-VGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQI 1930
            +IVER ++++    FD   +D +  E  +     Q GT L L R   D+  +K   VT L WS +Y +L    + S +    + +G+   + +K   + PEY+F  QS V+S    R  P+++  G Y G + +++    K  P+  +      HT PV+ V        N  N  S+S DG++ SW+L             D++    D +E+         P     +S   G          + F++G+E+G V+  C         + +  HH  V     +  A  +  S +F+T S DWT+++W      PL+ F+  S  V DV+W+P    +FA     G + +++L+     P     +  +    L  V +      + +GD  GQ+
Sbjct:  188 RIVERALSEHVDVCFDYSGRDLQDKEGDT-----QGGTKLSLNRQFMDERWSKHRVVTCLDWSLQYPELLVASYSSNEEAPHEPDGVALVWNMKYKKTTPEYVFHCQSAVMSAAFARFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPLSASAHTHPVYCVSLVGS--QNAHNLISISTDGKMCSWSL-------------DMLSTPQDSLELVFKQ---SKPVAVTSMSFPLGDV--------NNFVVGSEDGTVYTACRHGSKAGISEMFEGHHGPVTGLDCHMAAGPVDFSHLFVTSSFDWTVKLWSTRNTKPLYSFEDNSDYVYDVMWSPAHPALFACVDGVGHLDLWNLNNETEVPTAS--VTVEGNPALNRVRWANSGREVAVGDSEGQV 551          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Cavefish
Match: dync1i2a (dynein cytoplasmic 1 intermediate chain 2 [Source:NCBI gene;Acc:103032060])

HSP 1 Score: 111.694 bits (278), Expect = 3.742e-25
Identity = 97/399 (24.31%), Postives = 170/399 (42.61%), Query Frame = 2
Query:  788 KIVERMVNQNT---FDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDK--AKKIAVTALSWSPKYHDLFAVGHGSYDFM-KQSNGLICFYTLK-NPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSG----TCFAFNPQQEHIFLIGTEEGDVH-KCSKAYSTQFLDTYHAHHMAV-----YKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSP-VGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQI 1930
            +I+ER ++++    FD   +D +       E   Q G  L L R   D+  +K   VT L WSP+Y +L    + + +    + +G+   + +K   + PEY+F  QS V+S    +  P+++  G Y G + +++    K  P+  +      HT PV+ V        N  N  S+S DG++ SW+L                          D + Q  D   L+   S     T  +F     + F++G+E+G V+  C         + +  HH  +     +  A  +  S +F+T S DWT+++W      PL+ F+  S  V DV+W+P    +FA     G + +++L+ +   P     I  +    L  + +      + +GD  GQI
Sbjct:  200 RIIERALSEHVDVFFDYSGRDLE-----EKEGEMQAGAKLSLNRQFMDERWSKHRVVTCLDWSPQYPELLVASYNNNEEAPHEPDGVALVWNMKYKKTTPEYVFHCQSAVMSAAFVKFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPLSASAHTHPVYCVN--VVGTQNAHNLISISTDGKMCSWSL--------------------------DMLSQPQDSMELVFKQSKAVAVTSMSFPLGDVNNFVVGSEDGSVYTACRHGSKAGISEMFEGHHGPITGIHCHTAAGPVDFSHLFLTSSFDWTVKLWSTKNNKPLYSFEDNSDYVYDVMWSPVHPALFACVDGVGHLDLWNLNNDTEVPTAS--ITVEGTPALNRLRWAQSGREIAVGDSDGQI 563          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004773.1 (pep scaffold:Pmarinus_7.0:GL483227:3631:14047:-1 gene:ENSPMAG00000004320.1 transcript:ENSPMAT00000004773.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 645.195 bits (1663), Expect = 0.000e+0
Identity = 298/526 (56.65%), Postives = 403/526 (76.62%), Query Frame = 2
Query:  500 EKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKATFGTKVEE------KSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQ-RKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQ--GPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKK-DPLFVFDLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAPKEKKGLDVPKGPEIEIQKLEKILALV 2047
            E+KLTNQFNF ERASQT+NNP R++ + TEPPPR+NFS  + QW +YDAY E+ ++Q+++KEK+   G           ++ KK T +ET  D+++K+AK  KI+ERMVNQNTFD+I+QDF+Y+ED SDEYR+Q GTLLPLWRF  ++A+++ VTAL W+P YHDLF VG GSY+F KQ  G +  +TLKNPS+PE++F T+SGV+ +D+H + PH++  G YDG V VYN+     + P + S+A++GKHTDPVW+VKWQR+D DNNLNF+SVS+DGRV SWTLIK          N+++C DV+++ + +      G D A L +LSSGT F F+ Q +H+FL+GTE+G + KCSKAYS+QFLDTY AHHMAV  V WN FH+ +F +CSADW+++IW+H+ K  P+F FDLG+ VGDV WAPYSSTVFAA TA+G ++V+D+++NKYE +C Q +++KK TKLTHV+FNP  P+LI+GDDRG ++SLKLSPNLR+ PKEKKG +  +GPE E  KLE++LAL+
Sbjct:    1 EQKLTNQFNFSERASQTFNNPLREKSSQTEPPPRANFSATVNQWEVYDAYGEELKRQEKAKEKQQQKGGGGGRRDEGGPRATKKFTLVETQGDDITKVAKAAKIIERMVNQNTFDDIAQDFRYFEDASDEYREQDGTLLPLWRFQCEQARRLTVTALCWNPCYHDLFVVGFGSYEFQKQGRGALVVFTLKNPSFPEFVFATESGVMGVDVHDARPHLVAAGLYDGTVAVYNLAAPVDAQPSHRSSARSGKHTDPVWQVKWQRDDLDNNLNFFSVSSDGRVASWTLIK----------NELLCMDVVKLSVEEGQAAPLGEDPA-LETLSSGTSFDFHRQIDHMFLVGTEDGTILKCSKAYSSQFLDTYDAHHMAVEAVRWNPFHTRVFASCSADWSLKIWEHTAKWAPVFTFDLGAAVGDVAWAPYSSTVFAAVTADGKVHVFDVNVNKYEALCTQSVSTKKHTKLTHVAFNPSQPVLIVGDDRGVVSSLKLSPNLRRVPKEKKGQEAARGPEAETAKLERLLALI 515          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000105.1 (pep scaffold:Pmarinus_7.0:GL481647:21521:25263:-1 gene:ENSPMAG00000000091.1 transcript:ENSPMAT00000000105.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 146.362 bits (368), Expect = 1.034e-39
Identity = 92/279 (32.97%), Postives = 150/279 (53.76%), Query Frame = 2
Query: 1226 KHTDPVWEVKWQREDF-----DNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDD----VCQGPDG-------ANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGS-PVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYP--ILIIGDDRGQITSLKLSPNLRKAPKEKKGLDVPKGP 2005
            KH   VW+V+W R +      D      S+SADGRVT W + K            + C D++ +K + +       G +G       A +  L+ GTC  F+PQ  +++L GTEEG +H+CS +YS Q L +Y AH   VY+V W+ F  ++F++CS+DW++R+W      P+     GS  V DV W+P+S T+ AA TA  +++V+DLS +  +P+   +   ++   +T V+F+ + P   L++GD  G +T  +L   L+   +  +  +V  GP
Sbjct:    1 KHMGAVWQVQWVRLEQGGGGEDRGETLTSISADGRVTRWAVRK-----------GLDCQDLMRLKRTGEGRTRRTAGVEGQRERKNEALIWRLACGTCVDFHPQDSNVYLAGTEEGFIHRCSCSYSEQHLQSYSAHQGPVYRVLWSPFEPEVFLSCSSDWSVRLWRVDLTSPVLTLQCGSQAVLDVAWSPHSPTLLAALTAE-ALHVWDLSSSTLDPVL--VSPGRRGVHMTRVAFS-RAPGHCLLVGDSDGHVTLYQLKGLLQTKVRSPRPGEVSSGP 264          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009966.1 (pep scaffold:Pmarinus_7.0:GL490051:1079:6069:1 gene:ENSPMAG00000009021.1 transcript:ENSPMAT00000009966.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 129.413 bits (324), Expect = 5.949e-36
Identity = 63/97 (64.95%), Postives = 75/97 (77.32%), Query Frame = 2
Query:   98 EEDIPEAGPQDDLGDFMHSKIVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAK 388
            EE+  E G  DD        +VKPEDQ++LTE ELKEEFTRILTA NPHAPQNIVR++FKE  YKP+  +DQLAVHF+V+GNLLHR+SDE RRQ  +
Sbjct:    3 EEEGTEMGDGDDW--VQPRTLVKPEDQLELTEAELKEEFTRILTANNPHAPQNIVRYSFKERVYKPVGTLDQLAVHFAVDGNLLHRESDEARRQQLR 97          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Sea Lamprey
Match: dync1i2a (dynein, cytoplasmic 1, intermediate chain 2a [Source:ZFIN;Acc:ZDB-GENE-060929-1086])

HSP 1 Score: 115.161 bits (287), Expect = 4.944e-27
Identity = 106/443 (23.93%), Postives = 192/443 (43.34%), Query Frame = 2
Query:  656 DFEKQQQSKEKKATFGTKVEEKSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDK--AKKIAVTALSWSPKYHDLF-AVGHGSYDFMKQSNGLICFYTLK-NPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSG----TCFAFNPQQEHIFLIGTEEGDVH-KCSKAYSTQFLDTYHAHHMAV-----YKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSP-VGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLI---ASKKKTKLTHVSFNPKYPILIIGDDRGQI 1930
            D EKQ+  +  +     ++ E+ K+++     + D ++   +  +I+ER + ++   +I  D+   ++   +     G  L L R  +D+  +K+  +T+L WS +Y +L  A  + + D   + +G+   +  K   + PEY+F  QS V+S    R  P+++  G Y G + +++    +  P+  +      HT PV+ V        N  N  SVS DGR+ SW+L                          D + Q  D   L+   S     TC  F     + F++G+EEG V+  C         + +  H   V     +  A  +  S +F+T S DWTI++W      PL+ F+  S  V DV+W+P   ++FA+    G + +++L+ +   P     I    +  + + TH         L +GD  G +
Sbjct:  153 DLEKQEGKESGEDVHPCELTEEEKEQVLH---SDDFLNFFDRTSRIMERALAEH--QDIFFDYSGRDNEEIDGEVLAGAKLSLNRQFYDERWSKRRVITSLDWSAQYPELLVATYNNNEDSPHEPDGVALVWNTKFKKTTPEYVFHCQSAVMSASFARFHPNLVVGGTYSGQIVLWDNRSNRMTPVQRTPLSAAAHTHPVYCVN--VVGTQNAHNLISVSTDGRMCSWSL--------------------------DMLSQPQDSMELVHKQSKSIAVTCMTFPVGDVNNFVVGSEEGSVYTACRHGSKAGISEVFEGHQGPVTGIHSHSAAGPIDFSHLFLTSSFDWTIKLWTTKNNKPLYSFEDNSDYVYDVMWSPVHPSLFASVDGMGRLDLWNLNSDTEVPAASVTIDGCPALNRVRWTHSGRE-----LAVGDSEGHL 557          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Sea Lamprey
Match: wdr34 (WD repeat domain 34 [Source:ZFIN;Acc:ZDB-GENE-070928-9])

HSP 1 Score: 82.8037 bits (203), Expect = 6.677e-17
Identity = 93/367 (25.34%), Postives = 147/367 (40.05%), Query Frame = 2
Query:  923 KAKKIAVTALSWSPKYHDLFAVGHGSY---DFMKQSNGLICFYTLKN----PSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNN-LNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVC----HDVIEIKLSDDV-CQGPDGANLLSLS--SGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQ--------------FLDTYHAHHMAVYKVAWNLFHS-DIFITCSADWTIRIWDHSKKDPLFVFDLGSP-VGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPI-CEQLIASKKKTKLTHVSFNPKYP-ILIIGDDRG 1924
            K + +A TA+ WS     +  V  G     D+  + N +IC + +      P  P+   +    +L L  H + P ++  G   G V V++ +Q +   L  S      H  PV +V+W      +  L   S   DG V +W   +  +  +   PN+ V     H      LS  V  + P G    SLS  S  C A           G E G V +C      Q               L  +  H   VY V ++ F+   + +    D  +R++     DP+ V    +  V    W+P    V AA+TA G + ++DL+I    P+ C Q  AS   + ++ ++FNPK P +L +G   G
Sbjct:  131 KTRGLAATAVGWS-CTGAMIGVAFGRLNDGDWTVE-NSMICLWNVCRRGLIPDMPDRTLDVPGCLLCLSFHPTWPAVIAGGASSGEVFVWDTSQEEDPLLAHSGVNATTHQQPVTQVQWVHSPGQSRVLLLMSAGLDGCVMTW---RVELSTRKITPNNRVVLLAKHLPSTSTLSKKVQSELPLGITAFSLSEDSSMCVA-----------GLEGGQVVRCLLEPLEQPTRKDQPPLNRKSPALFPFVKHQGPVYAVNFSPFNRRGVSVQAGTDGQVRVFSALLHDPVLVVRAATSYVLAAAWSPARPLVLAASTAEGELLLFDLAIKDSGPVHCIQ--ASPSLSPVSCLAFNPKQPGLLAVGLQSG 479          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Yeast
Match: MSI1 (Subunit of chromatin assembly factor I (CAF-1); chromatin assembly by CAF-1 affects multiple processes including silencing at telomeres, mating type loci, and rDNA; maintenance of kinetochore structure; deactivation of DNA damage checkpoint after DNA repair; chromatin dynamics during transcription; and repression of divergent noncoding transcription; Msi1p localizes to nucleus and cytoplasm and independently regulates the RAS/cAMP pathway via sequestration of Npr1p kinase [Source:SGD;Acc:S000000399])

HSP 1 Score: 50.8322 bits (120), Expect = 4.621e-7
Identity = 36/148 (24.32%), Postives = 69/148 (46.62%), Query Frame = 2
Query: 1559 QFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWD---HSKKDPLFVFDL------GSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTK--LTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAP 1969
            + +DT  A       +AWNL    + ++  ++  +++WD   +S ++P+    L      G+ V DV W P   ++FAA T   ++ + DL   K     E+L ++++K    +    FN K  +++   D     +L    N+ K+P
Sbjct:  191 EAMDTSSADINEATSLAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINSDGTAVNDVTWMPTHDSLFAACTEGNAVSLLDLRTKK-----EKLQSNREKHDGGVNSCRFNYKNSLILASADSNGRLNLWDIRNMNKSP 333          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Nematostella
Match: EDO36198 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJC7])

HSP 1 Score: 761.911 bits (1966), Expect = 0.000e+0
Identity = 371/669 (55.46%), Postives = 497/669 (74.29%), Query Frame = 2
Query:  128 DDLGDFMHSK-IVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQG---KLIDDL--------KEDKEPGEGETETEDLS------------SQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKA--TFGTKVEEKSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQ-SNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKA--PKEKKGLDVPKGPEIEIQKLEKILALV 2047
            DD+ ++M  K ++KP+DQ++L+E ELKEEFTRILTA NPHAP NIVR++FKE CYK  + VDQLA+HF+++GN+LH+DSDE RRQ  +QG    LI            E  E GE + + E+              S+          E+KLTNQFNF ERASQTYNNP R+RG  TEPPPR+NFS +  QW IYDAY+ED E+Q++ KEK++  T   K EE  KKKLT +E   D++++I+KP +IVERMVNQNT+D+I+QDFKY+EDPSDE+R+  GTLLPLW+F+++K+K++AVT+L W+P Y+DLF+V HGSYDF+KQ   G + F++LKNPSYPEY  +T+SGV+ LD+H   PHML  GFYDG+V VY+I+++ + PL+ STA+TGKHTDPVW+VKWQ++D DNNLNF+SVS+DGRV  WT++K          +++   D+I ++L +   +GP+G  + SL  GT F F+    ++FL+GTEEG +HKCSK Y++ +LDT+ AHHM+VY V WN FH   FI+CSADWT++IWDH+  +P+F FDL S VGDV WAPY+STVFAA TA+G I+VYDL++NKYEP+CEQ + +KKK+KLTH++FNP +PILI+GD RG + SLK+SPNLRKA  PKEK      KG E E+ K++K+L+LV
Sbjct:    6 DDMDEWMQPKQLIKPDDQLELSEAELKEEFTRILTANNPHAPSNIVRYSFKERCYKQTSSVDQLAIHFALDGNMLHKDSDEARRQRTRQGLSLVLIYSFISLFLPYEAETSEAGEEDADKENKPEEEKKTDEEKPRSESIIGTGSSKKEQKLTNQFNFSERASQTYNNPYRERGTATEPPPRANFSASANQWEIYDAYVEDLERQEKIKEKESRKTQTLKKEEDKKKKLTQVEMQGDDITRISKPAQIVERMVNQNTYDDIAQDFKYWEDPSDEFREPDGTLLPLWKFSWEKSKRLAVTSLCWNPIYNDLFSVAHGSYDFLKQDGGGAMSFFSLKNPSYPEYGIKTESGVMCLDIHPEHPHMLAAGFYDGSVAVYSISEKMNKPLHQSTAKTGKHTDPVWQVKWQKDDLDNNLNFFSVSSDGRVVQWTIVK----------SELSHTDIINLELPEK-SEGPEGTQIKSLGCGTSFDFHKTINYLFLVGTEEGKIHKCSKTYTSTYLDTFDAHHMSVYSVRWNPFHPKTFISCSADWTVKIWDHTHLEPMFTFDLNSSVGDVQWAPYASTVFAACTADGKIHVYDLNVNKYEPLCEQSVVAKKKSKLTHLAFNPDHPILIVGDSRGYVNSLKVSPNLRKATQPKEKA-----KGVENEVAKMDKLLSLV 658          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Nematostella
Match: EDO34474 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP67])

HSP 1 Score: 195.667 bits (496), Expect = 6.627e-57
Identity = 108/310 (34.84%), Postives = 172/310 (55.48%), Query Frame = 2
Query: 1061 YPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLN-----FYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGAN-------LLS-LSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGS--PVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKL 1945
            YPE +F   +GV +LD   + P++L VG YDG + +YNI      P   S+   GKHT PVW+++W   +   N +       S+SADGRVT W+ I++G              D++++K  +   Q   G         L+S  ++G CF F+P   +I+L GTEEG VHKCS +Y+ Q+L+++H H   +Y+V WN  + + F+TCSADW++R+W   ++ P+  F L S   V D+ W+P  +T+FA    + ++ ++DLS+N  +P+        +  KLT V F      +++GD  GQ+T  +L
Sbjct:    9 YPERVFHLNTGVTALDFSGAHPNLLAVGLYDGTIAIYNIRCTDDSPALDSSESVGKHTSPVWQLQWVDREQGGNGDEHDEILVSISADGRVTKWS-IRKGFESA----------DLMKLKRINVTKQKAGGGGSERKSDALISRFAAGFCFDFSPNDANIYLAGTEEGHVHKCSCSYNEQYLESFHGHTGPIYQVKWNPLYPEAFLTCSADWSVRLWHCDRQFPVMSF-LSSTKSVNDISWSPDCATLFACVN-DRAVEIWDLSLNTLDPVVS--FVPVQDCKLTTVLFALNTATILVGDSEGQVTVYQL 303          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Nematostella
Match: EDO49079 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI29])

HSP 1 Score: 126.716 bits (317), Expect = 6.493e-31
Identity = 110/435 (25.29%), Postives = 195/435 (44.83%), Query Frame = 2
Query:  659 FEKQQQSKEKKATFGTKVEEKSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDK--AKKIAVTALSWSPKYHDLFAVGHGSY-DFMKQSNGLICFYTLK-NPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVH-KCSKAYSTQFLDTYHAHHMAV-----YKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVF-DLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQI 1930
             +++ Q + ++ T   K EE S+++   I  + +      K +++VER + ++   +I+ D+   E    E   Q    L L R  +D+  ++   VT L WS +Y +L    + +  D   + +G+   + LK   + PEYIF  QS V+S    +  P+++  G Y G + +++    K  P+  +      HT PV+ V        N  N  SVS DG++ SW+L           P D +    ++ K S  V               TC +F     + F++G+EEG V+  C         D +  H+  V     +  +  +  S +F+T S DWT+++W H    P + F D G  + DV W+P    +FA     G + +++L+ +   PI     A++  T L +V +      + +GDD G++
Sbjct:   41 IQQESQPETEEKTEQHKEEELSEEQKDQILGSQEFSRFFDKAVRLVERALTEDL--DITIDYSGAEGDDLEGGSQAARELTLSRDFYDERWSRHRTVTCLDWSNQYPELLVASYNNNEDAPHEPDGVALIWNLKFAKTTPEYIFHCQSAVMSATFAKFHPNLIIGGTYSGQIVLWDNRSSKRTPVQRTPLSATAHTHPVYCVN--VVGTQNAHNLISVSTDGKMCSWSL------DMLSQPQDSM---ELQYKQSKSVAV-------------TCMSFLAGDVNNFVVGSEEGTVYTACRHGSKAGISDVFEGHYGPVTGIDTHSASGPIDFSHLFLTSSFDWTLKLWSHKSPRPYYSFEDNGDYIYDVKWSPIHPALFATVDGTGRLDLWNLNSDTEVPIAS--TATESLTALNNVQWTQSGQQISVGDDDGRV 447          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Nematostella
Match: EDO40075 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8B8])

HSP 1 Score: 108.227 bits (269), Expect = 1.438e-24
Identity = 94/416 (22.60%), Postives = 180/416 (43.27%), Query Frame = 2
Query:  764 MSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICF----YTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYST---QFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLG--SPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAPKEKKG 1984
            M+ I +   ++E  + QN   +I +D  Y+ D  ++   +  +   +  F  +   K   T++SW P      AV +   +F K ++  IC     + + NP+ P+ + +  S ++ L+ +   PH+L  G Y+G +G ++ T++ S P+ ++  +   H DP+++  + +    +  + +S S DG+V  W + K G                   + ++ +   P+  +   L  G    F P     F++GTE+G V  C++   T   + + +Y  H+  VY V  N F    F+T   DW  RIW    ++   ++     S + D  W+P    VF     +G++ V+D     ++  C  L        L  +       ++  G   G +T L+LS  L    + +K 
Sbjct:  107 MNTIQQLGNVMEHCIKQNNAIDIYED--YFPDLEEDQSCETPSAKTINVFRDENNIKRTATSISWYPDGTQKLAVAYSVLEFQKSTD--ICMDSYIWDIDNPTKPDMVLKPVSPLICLEYNPKDPHLLIGGCYNGQLGFWD-TRKGSHPVEMTPIEKS-HRDPIYKTIFLQS--KSGTDCFSTSTDGQVLWWDIRKLG-------------------EPTESLLLCPNKKDPRPL-GGVSLEFEPTMPTKFMVGTEQGSVLSCNRKAKTPADKIVASYAGHYGPVYSVQRNPFFPKNFLTI-GDWQARIWSEDLRESSIMWTKCGMSYLTDGCWSPSRPGVFFTTKMDGTLDVWDC---MFKQNCPTLSIQVCDMSLNSLRVQDHGRLVACGSHDGTVTLLELSEGLHTMQRNEKA 490          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Nematostella
Match: EDO43231 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ65])

HSP 1 Score: 86.6557 bits (213), Expect = 7.451e-18
Identity = 81/378 (21.43%), Postives = 158/378 (41.80%), Query Frame = 2
Query:  926 AKKIAVTALSWSPKYHDLFAVGHGSYDFMK--QSNGLICFYTLK----NPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKW--QREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCS---------KAYSTQFLDT-----YHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSP-VGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNL-RKAPKEKKGL 1987
              ++ +T+LSW+     + A  +G  D          +C + L     N +  +   +  S +LSL  H   P ++  G ++G V +++++      +  S      H +PV ++ W    +         S S DG+V  W +              I+    +   L     +G     + +LS      F+ + + +F++G+E G + KCS            S+  L +     +  H   V+ V  + +H ++F+TC  D TIR++   +  PL   +  +  +  + W+P    VF+ AT +G + +YD+ +N   P+    ++ KK       + + +  ++  GD  G I   +LS  L  + P+E + L
Sbjct:  119 GNQLQITSLSWN-STGSVIAAAYGRLDHEDWCTHKSSLCTWNLDRRGINVNKADTTVDLSSCLLSLAFHPKSPALIAGGTFNGEVHLWDLSCEDEMLVASSGMGNDSHREPVNKIMWLLDPDSKGKKYQILSASGDGKVLLWQVPPIESQDLRLVGGYILQTGAVPRSLRTSKAKGDMEMGVTTLS------FSHEDKTLFVLGSEAGGIFKCSVNSRGPPVGNVTSSVPLGSPVTFAFAPHVGPVFSVNCSPYHRNLFLTCGTDGTIRLYTMLQAKPLLSLEPAAGYLFAIRWSPVRPLVFSVATGDGRLLIYDMKVNHINPVTTIDVSDKKPVHTLEYNIH-RRQLVATGDSEGVIKIWRLSDELTTQGPRETEIL 488          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Medaka
Match: dnai1.2 (dynein, axonemal, intermediate chain 1, paralog 2 [Source:ZFIN;Acc:ZDB-GENE-070112-1302])

HSP 1 Score: 375.941 bits (964), Expect = 2.710e-123
Identity = 190/442 (42.99%), Postives = 275/442 (62.22%), Query Frame = 2
Query:  716 EKSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFM-KQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAPKEKKGLDVPKGPEIEIQKLEKIL 2038
            +  +KK   +ET  DE+SKI +  K++ER V QN+  +I+ DFK+YEDPSDE+   +GTL+PLW F +   K + V+AL W+ +Y D+FAVG G+ D+  +Q  G++  Y+LKNP+YPEY ++T SGV  +D+H    +++  GFYDG V VYN+   K  P+  S+ +TGKH DPV ++ WQ++D +NN NFYSVS DG++ SWTL                      +K++  V        +L L      +F+P    I +         +CS  Y+   ++ Y AH ++V  V WN FH  +FI+CS D T++IWDH+   P+   DL  PV DV ++P++STVFAA T  G++Y YD+SI+ YE IC+Q + +K+K +LT + FNP + I+IIGD +G I S KLSPNLRK PK KKG ++P  P+ E+ KLEK L
Sbjct:   18 DTGRKKTLLMETKIDELSKIRESCKLMERAVVQNSLCDIAIDFKFYEDPSDEFIGHEGTLMPLWNFRYKGTKHLTVSALCWNRRYLDMFAVGMGTEDYFDQQCGGMVLIYSLKNPTYPEYAYKTASGVRCVDIHPHKSYLVAAGFYDGNVAVYNLKVEKLKPVCASSPETGKHMDPVIQLCWQKDDINNNHNFYSVSLDGQIVSWTL----------------------VKVNMHVYVFSQYLEVLQLYLLLNLSFDPLYGQILVFFF----FFQCSMTYTGHPMEVYDAHLLSVGTVKWNPFHPKVFISCSCDMTVKIWDHTVTTPISNIDLKEPVEDVAFSPHTSTVFAAVTRRGTVYFYDVSISIYEAICQQEVVNKRKGQLTKLEFNPIHLIIIIGDGKGCIHSFKLSPNLRKRPKNKKGQEIPIDPQEEVGKLEKFL 433          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Medaka
Match: dnai1.2 (dynein, axonemal, intermediate chain 1, paralog 2 [Source:ZFIN;Acc:ZDB-GENE-070112-1302])

HSP 1 Score: 331.257 bits (848), Expect = 3.751e-106
Identity = 187/488 (38.32%), Postives = 267/488 (54.71%), Query Frame = 2
Query:  626 QWVIYDAYLEDFEKQQQSKEKKATFGTKVEEKS---KKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYD--------------FMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAPKEKKGLDVPKGPEIEIQKLEKIL 2038
            QWVIYDAY ++ +K+Q+ +      G  ++E S   +KK   +ET            KI+  +     FD +  DFK+YEDPSDE+   +GTL+PLW F +   K + V+AL W    H    +    +               F +Q  G++  Y+LKNP+YPEY ++T SGV  +D+H    +++  GFYDG V VYN+   K  P+  S+ +TGKH DPV ++ WQ++D +NN NFYSVS D                                                  S T   F+    ++FL+GT EG + KCS  Y+   ++ Y AH ++V  V WN FH  +FI+CS D T++IWDH+   P+   DL  PV DV ++P++STVFAA T  G++Y YD+SI+ YE IC+Q + +K+K +LT + FNP + I+IIGD +G I S KLSPNLRK PK KKG ++P  P+ E+ KLEK L
Sbjct:    6 QWVIYDAYKKELKKRQEQEG-----GHLLKENSDTGRKKTLLMET------------KIL--LFFFFYFDSLI-DFKFYEDPSDEFIGHEGTLMPLWNFRYKGTKHLTVSALCWMQSIHTCTNLKKNVFICVFVSSVLLFPEDYFDQQCGGMVLIYSLKNPTYPEYAYKTASGVRCVDIHPHKSYLVAAGFYDGNVAVYNLKVEKLKPVCASSPETGKHMDPVIQLCWQKDDINNNHNFYSVSLD-------------------------------------------------VSCTSIDFHKDIPNLFLVGTLEGMILKCSMTYTGHPMEVYDAHLLSVGTVKWNPFHPKVFISCSCDMTVKIWDHTVTTPISNIDLKEPVEDVAFSPHTSTVFAAVTRRGTVYFYDVSISIYEAICQQEVVNKRKGQLTKLEFNPIHLIIIIGDGKGCIHSFKLSPNLRKRPKNKKGQEIPIDPQEEVGKLEKFL 424          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Medaka
Match: wdr78 (WD repeat domain 78 [Source:NCBI gene;Acc:101174321])

HSP 1 Score: 214.542 bits (545), Expect = 2.386e-59
Identity = 120/375 (32.00%), Postives = 200/375 (53.33%), Query Frame = 2
Query:  866 DEYRDQQGTLLP----LWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQT-GKHTDPVWEVKWQREDF----DNNLN-FYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGAN--------LLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSP-VGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQIT 1933
            +E RD + +  P    LW F+ +  +  +V++++W+ K  DL AVG+G +D   +  GL+C ++LKNP++PE +   +S V SLD   + P  L VG +DG++ +Y+I    S  L+L +++   +H  PVW+++W +++F    +  L    SV ADGR+  W +    +G                +KL   + + PD           + SL    C  F+P +  I+L GT EG +HKCS + + Q+LDTY  H+ AV  VAW     DIF++CSAD TI++W  ++ +P+  F      V D+ W+P  +TVFAA   +  + V+DL+++   P+  Q   +    +L  + F      +++GD  GQ+T
Sbjct:  365 EEQRDAEISETPALEGLWAFSCELTRGFSVSSMAWNKKNPDLLAVGYGEFDSTNERAGLVCCWSLKNPTWPERVVRCESAVTSLDFSATRPSHLAVGLFDGSIAIYDIQNPDSISLFLDSSKCPSRHLGPVWQLRWNQQEFGLPAEERLEVLISVGADGRIIKWVVCTGNLGHTE------------LMKLKRTIYKNPDAKTTESISQSLISSLIPALCLDFHPTEPGIYLTGTWEGLIHKCSCSNNQQYLDTYRKHYCAVNYVAWCPLSDDIFLSCSADCTIQLWTQNQHNPMLSFSTTRKVVHDIKWSPKWATVFAAV-YDEQLEVWDLNLSCLSPVIVQ--PALPGVRLASLLFASHTDCVVVGDSCGQVT 724          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Medaka
Match: ENSORLT00000002152.2 (WD repeat-containing protein 78 [Source:NCBI gene;Acc:101160807])

HSP 1 Score: 206.068 bits (523), Expect = 2.811e-56
Identity = 122/380 (32.11%), Postives = 197/380 (51.84%), Query Frame = 2
Query:  890 TLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQT-GKHTDPVWEVKWQRED-----FDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPD-----GANLLS-LSSGTCFAFNPQQEHIFLIGTEEGDVHKCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVF-DLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAPKEKKGLD 1990
            T+ PLW F  +      +T+++W+ K  ++ AV +   D        IC ++L NP +P+ IF   S V S+D   S    L VG YDG+V +YN+  +  G    ++++   +H  PVW+V W +++      +      S+SADGR++ W            C N + C D+++I+   D  +G       G  +LS +S G C  F+P++  I+L+G+ +G +HKCS   + QFLD+Y  H +AV  + W+ F  D+F++CS+D TI++W H+   PL  F  + S V  V W+P  STVF AA     + V++LS N   P+     A+     LT + F      +++GD  G++T  +L  N     K+ K LD
Sbjct:  384 TIKPLWTFDSELTTGRMITSMTWNKKNLNILAVSYSDCDPSSSRASFICCWSLNNPLWPQRIFSCPSRVASMDFSSSDHGHLAVGMYDGSVAIYNVQIQDRGACVATSSKCPNRHLRPVWQVAWNKQESKFSGLEAEEVLVSMSADGRISMW----------QRCNNHLECIDLMKIRRIHDDKRGNGVSKMVGETILSEVSPGHCLDFHPKESDIYLVGSWDGLIHKCSLNNNQQFLDSYQKHLLAVNDIQWSPFSPDLFLSCSSDCTIQLWRHTCLSPLLSFKSVHSQVCAVRWSPERSTVF-AAIYRQQVEVWELSSNILSPVVVHHAAA--GVTLTALLFARGTDCVLVGDSEGKVTVYQLK-NFTAEDKKGKRLD 749          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Medaka
Match: DYNC1I1 (dynein cytoplasmic 1 intermediate chain 1 [Source:NCBI gene;Acc:101175663])

HSP 1 Score: 115.931 bits (289), Expect = 1.298e-26
Identity = 97/398 (24.37%), Postives = 175/398 (43.97%), Query Frame = 2
Query:  785 IKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDK--AKKIAVTALSWSPKYHDLFAVGHGSYDFM-KQSNGLICFYTLK-NPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVIEIKLSDDVCQGPDGANLLSLSSG-----TCFAFNPQQEHIFLIGTEEGDVHKCSKAYS-TQFLDTYHAHHMAVYKVAWN-----LFHSDIFITCSADWTIRIWDHSKKDPLFVF-DLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQI 1930
            I+++ER + +++  +I  D+        E     G+ L L R  +D+  +K+  +T L WSP+Y +L    + + +    + +G+   + +K   + PEYIF  QS V+S+   R  P++L  G Y G + +++    +  P+  +      HT PV+ V        NNL   ++S DG++ SW+L                           D+   P     L  S       T  AF     + +++G+E+G V+  S+  S     D +  H   V  ++ +     +  S +FIT S DWT+++W      PL+ F D    V DV+W+P     FAA    G + +++L+ +   P     I  +  + L  V ++     + +GD  G++
Sbjct:  203 IRVIERALAEDS--DIYFDYSGRNLEDKEGDVGSGSRLSLSRVFYDEHWSKRRVITCLDWSPQYPELLVASYNNNEEAPHEPDGVALVWNIKFKKATPEYIFHCQSPVVSVGFARFHPNLLVGGTYSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPVYCVNVVGTQNANNL--ITLSTDGKMCSWSL---------------------------DMLSQPQETMELVYSKSKPVAVTGMAFPTGDVNNYVVGSEDGSVYNASRHGSKAGICDMFEGHQGPVTGISCHSAVGPVDFSHLFITSSFDWTVKLWSTKHNKPLYSFEDNADYVYDVMWSPVHPATFAAVDGMGRLDLWNLNNDTEVPTASVTI--EGASALNRVRWSSGGKEVAVGDSEGRV 567          
BLAST of Dynein intermediate chain 2, ciliary vs. Planmine SMEST
Match: SMESG000001839.1 (SMESG000001839.1)

HSP 1 Score: 900.582 bits (2326), Expect = 0.000e+0
Identity = 431/431 (100.00%), Postives = 431/431 (100.00%), Query Frame = 2
Query:   47 MKGAKDKKTKGRRRSKIEEDIPEAGPQDDLGDFMHSKIVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQGKLIDDLKEDKEPGEGETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKATFGTKVEEKSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIK 1339
            MKGAKDKKTKGRRRSKIEEDIPEAGPQDDLGDFMHSKIVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQGKLIDDLKEDKEPGEGETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKATFGTKVEEKSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIK
Sbjct:    1 MKGAKDKKTKGRRRSKIEEDIPEAGPQDDLGDFMHSKIVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQGKLIDDLKEDKEPGEGETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKATFGTKVEEKSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIK 431          
BLAST of Dynein intermediate chain 2, ciliary vs. Planmine SMEST
Match: SMESG000001839.1 (SMESG000001839.1)

HSP 1 Score: 880.552 bits (2274), Expect = 0.000e+0
Identity = 421/423 (99.53%), Postives = 422/423 (99.76%), Query Frame = 2
Query:   71 TKGRRRSKIEEDIPEAGPQDDLGDFMHSKIVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQGKLIDDLKEDKEPGEGETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKATFGTKVEEKSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIK 1339
             +GRRRSKIEEDIPEAGPQDDLGDFMHSKIVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQGKLIDDLKEDKEPGEGETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKATFGTKVEEKSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIK
Sbjct:   31 VQGRRRSKIEEDIPEAGPQDDLGDFMHSKIVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQGKLIDDLKEDKEPGEGETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKATFGTKVEEKSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIK 453          
BLAST of Dynein intermediate chain 2, ciliary vs. Planmine SMEST
Match: SMESG000001830.1 (SMESG000001830.1)

HSP 1 Score: 742.651 bits (1916), Expect = 0.000e+0
Identity = 369/431 (85.61%), Postives = 370/431 (85.85%), Query Frame = 2
Query:   47 MKGAKDKKTKGRRRSKIEEDIPEAGPQDDLGDFMHSKIVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQGKLIDDLKEDKEPGEGETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKATFGTKVEEKSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIK 1339
            MKGAKDKKTKGRRRSKIEEDIPEAGPQDDLGDFMHSKIVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFK                                          +DL   KE                TPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKATFGTKVEEKSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIK
Sbjct:    1 MKGAKDKKTKGRRRSKIEEDIPEAGPQDDLGDFMHSKIVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFK-----------------------------------------TEDLSSQKE----------------TPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKATFGTKVEEKSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIK 374          
BLAST of Dynein intermediate chain 2, ciliary vs. Planmine SMEST
Match: SMESG000001830.1 (SMESG000001830.1)

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 290/318 (91.19%), Postives = 290/318 (91.19%), Query Frame = 2
Query:   47 MKGAKDKKTKGRRRSKIEEDIPEAGPQDDLGDFMHSKIVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQGKLIDDLKEDKEPGEGETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKATFGTKVEEKSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGS 1000
            MKGAKDKKTKGRRRSKIEEDIPEAGPQDDLGDFMHSKIVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQGKLIDDLKEDKEPGEGETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQ                            ADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGS
Sbjct:    1 MKGAKDKKTKGRRRSKIEEDIPEAGPQDDLGDFMHSKIVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQGKLIDDLKEDKEPGEGETETEDLSSQKETPVEPEVSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQ----------------------------ADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGS 290          
BLAST of Dynein intermediate chain 2, ciliary vs. Planmine SMEST
Match: SMESG000066594.1 (SMESG000066594.1)

HSP 1 Score: 519.62 bits (1337), Expect = 6.829e-176
Identity = 282/704 (40.06%), Postives = 420/704 (59.66%), Query Frame = 2
Query:   47 MKGAKDKKTKGRRRSKIEEDIPEAGPQDDLGDFMHSKIVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQGKLIDD-------LKEDKEPGEGETETEDLSSQKETPVEPE-------VSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQ-SKEKKATFG--TKVEEKSKKKLTSI-ETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYR-DQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMK-QSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYL---STAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVI---EIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVH---------KCSKAYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPLFVFDLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEP-ICEQLIASKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAPKEKKGLDVPKGPEIEIQKLEKILALVG 2050
            +K  + +K+      + ++D     P  +  +  +  +VKP DQ+ LTEQEL+EE T++L ATNP AP NIV++NFKEM YKP+  +D   +HFS++ NL+++DS E    ++    L D+          +      E E   + SQ  T  + E       +   K +NQF +C RA+QT NNP + +   +E PPR  FSDN+ Q VIYD+Y  DF++Q + +K +   FG   K+    KK+++ + E    +++ I   +KI+ERM+N NTFDEI+QDF YYEDP+DE+R D  GTLLPLW+F+FDK +K+ VT++ WS  Y DLF V HG Y+ +  +  G IC Y+LKNPSYPEY   T+S VL++D++ +   ++C G  DG V + ++ ++ S    +   S   + KH DP W+VKW   + DN + FYS+S+DGR+  W++ K  +           C D++   +I L  D+    D      L SGTC A +P++ H FL+GT++G+++         K +  YS  F +  + H M +Y++ W+ +H DIF +CSADWTI IW+  + +PLFV DLG  V  + WAPYSSTV AA T +  + VYD SIN+ EP +C+ + +SK K  LT + F+  YPI++IGD RG   S+KLSPNLRK PK KK  ++    E +  KLE+++ L+ 
Sbjct:    3 LKPFEKRKSNAFYLKRKDDDFYTKDPTLNENEDHYQTLVKPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLVYKDSMEAVSNLSVPAFLDDNSVHLPIEFDANIVLENLEQENSTMLSQTSTTFKQEAWNENSNLDSNKSSNQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINKSRLTNFGGSQKIIVPDKKRISLVHEKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELN----------CQDIVALRQINLPIDMETVADRF----LESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNE--NIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRGNTHSMKLSPNLRKIPKVKKD-ELFNMDEYQFNKLERLIQLLS 689          
The following BLAST results are available for this feature:
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAI10.000e+054.20dynein axonemal intermediate chain 1 [Source:HGNC ... [more]
DNAI10.000e+054.56dynein axonemal intermediate chain 1 [Source:HGNC ... [more]
WDR785.702e-7034.90WD repeat domain 78 [Source:HGNC Symbol;Acc:HGNC:2... [more]
DNAI12.230e-6351.92dynein axonemal intermediate chain 1 [Source:HGNC ... [more]
DNAI13.450e-5547.19dynein axonemal intermediate chain 1 [Source:HGNC ... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dyci-11.705e-2425.23DYnein Chain, light Intermediate [Source:UniProtK... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG93134.376e-17445.13gene:FBgn0034566 transcript:FBtr0071521[more]
CG93134.376e-17445.13gene:FBgn0034566 transcript:FBtr0345666[more]
CG93134.562e-17445.13gene:FBgn0034566 transcript:FBtr0342788[more]
Dic61B8.260e-3226.12gene:FBgn0263988 transcript:FBtr0072538[more]
Dic61B1.004e-3126.37gene:FBgn0263988 transcript:FBtr0072539[more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnai1.20.000e+053.21dynein, axonemal, intermediate chain 1, paralog 2 ... [more]
dnai1.14.487e-15639.84dynein, axonemal, intermediate chain 1, paralog 1 ... [more]
dnai1.13.372e-15340.43dynein, axonemal, intermediate chain 1, paralog 1 ... [more]
wdr782.656e-7032.45WD repeat domain 78 [Source:ZFIN;Acc:ZDB-GENE-0505... [more]
wdr782.656e-7032.45WD repeat domain 78 [Source:ZFIN;Acc:ZDB-GENE-0505... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
creb53.605e-7032.86cAMP responsive element binding protein 5 [Source:... [more]
creb53.612e-7032.86cAMP responsive element binding protein 5 [Source:... [more]
creb53.821e-6933.42cAMP responsive element binding protein 5 [Source:... [more]
csrnp21.546e-2525.06cysteine-serine-rich nuclear protein 2 [Source:Xen... [more]
csrnp22.312e-2525.06cysteine-serine-rich nuclear protein 2 [Source:Xen... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnaic10.000e+052.73dynein, axonemal, intermediate chain 1 [Source:MGI... [more]
Wdr781.279e-7134.90WD repeat domain 78 [Source:MGI Symbol;Acc:MGI:238... [more]
Dnaic11.200e-3365.12dynein, axonemal, intermediate chain 1 [Source:MGI... [more]
Wdr783.592e-3231.25WD repeat domain 78 [Source:MGI Symbol;Acc:MGI:238... [more]
Wdr789.640e-3137.66WD repeat domain 78 [Source:MGI Symbol;Acc:MGI:238... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q16959|DYI2_HELCR0.000e+058.48Dynein intermediate chain 2, ciliary OS=Heliocidar... [more]
sp|Q5XIL8|DNAI1_RAT0.000e+052.86Dynein intermediate chain 1, axonemal OS=Rattus no... [more]
sp|Q8C0M8|DNAI1_MOUSE0.000e+052.73Dynein intermediate chain 1, axonemal OS=Mus muscu... [more]
sp|Q32KS2|DNAI1_BOVIN0.000e+054.12Dynein intermediate chain 1, axonemal OS=Bos tauru... [more]
sp|Q9UI46|DNAI1_HUMAN0.000e+054.56Dynein intermediate chain 1, axonemal OS=Homo sapi... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|229324770.000e+066.52tr|A0A4S2L4T2|A0A4S2L4T2_OPIFE WD_REPEATS_REGION d... [more]
gnl|BL_ORD_ID|214745070.000e+062.52tr|A0A075A3K8|A0A075A3K8_9TREM WD_REPEATS_REGION d... [more]
gnl|BL_ORD_ID|229241980.000e+065.30tr|A0A4S2L493|A0A4S2L493_OPIFE WD_REPEATS_REGION d... [more]
gnl|BL_ORD_ID|228241660.000e+062.13tr|A0A5K4F0L6|A0A5K4F0L6_SCHMA Uncharacterized pro... [more]
gnl|BL_ORD_ID|214350450.000e+060.20tr|A0A1S8X644|A0A1S8X644_9TREM WD domain, G-beta r... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnai1.20.000e+058.70dynein, axonemal, intermediate chain 1, paralog 2 ... [more]
wdr782.668e-6332.85WD repeat domain 78 [Source:NCBI gene;Acc:10304656... [more]
DYNC1I15.699e-2724.87dynein cytoplasmic 1 intermediate chain 1 [Source:... [more]
dync1i2b1.416e-2524.94dynein, cytoplasmic 1, intermediate chain 2b [Sour... [more]
dync1i2a3.742e-2524.31dynein cytoplasmic 1 intermediate chain 2 [Source:... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004773.10.000e+056.65pep scaffold:Pmarinus_7.0:GL483227:3631:14047:-1 g... [more]
ENSPMAT00000000105.11.034e-3932.97pep scaffold:Pmarinus_7.0:GL481647:21521:25263:-1 ... [more]
ENSPMAT00000009966.15.949e-3664.95pep scaffold:Pmarinus_7.0:GL490051:1079:6069:1 gen... [more]
dync1i2a4.944e-2723.93dynein, cytoplasmic 1, intermediate chain 2a [Sour... [more]
wdr346.677e-1725.34WD repeat domain 34 [Source:ZFIN;Acc:ZDB-GENE-0709... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
MSI14.621e-724.32Subunit of chromatin assembly factor I (CAF-1); ch... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO361980.000e+055.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO344746.627e-5734.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490796.493e-3125.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO400751.438e-2422.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO432317.451e-1821.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnai1.22.710e-12342.99dynein, axonemal, intermediate chain 1, paralog 2 ... [more]
dnai1.23.751e-10638.32dynein, axonemal, intermediate chain 1, paralog 2 ... [more]
wdr782.386e-5932.00WD repeat domain 78 [Source:NCBI gene;Acc:10117432... [more]
ENSORLT00000002152.22.811e-5632.11WD repeat-containing protein 78 [Source:NCBI gene;... [more]
DYNC1I11.298e-2624.37dynein cytoplasmic 1 intermediate chain 1 [Source:... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000001839.10.000e+0100.00SMESG000001839.1[more]
SMESG000001839.10.000e+099.53SMESG000001839.1[more]
SMESG000001830.10.000e+085.61SMESG000001830.1[more]
SMESG000001830.10.000e+091.19SMESG000001830.1[more]
SMESG000066594.16.829e-17640.06SMESG000066594.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020525 ID=SMED30020525|Name=Dynein intermediate chain 2, ciliary|organism=Schmidtea mediterranea sexual|type=transcript|length=2146bp
ATCTTTTTTTTCTAATAGTAACCATTGAGATTTTACTTATCAAATTATGA
AAGGTGCCAAAGATAAAAAGACTAAAGGCAGAAGAAGGAGTAAGATTGAG
GAAGACATTCCAGAAGCTGGACCTCAAGATGATTTAGGAGATTTTATGCA
TTCAAAAATAGTTAAGCCAGAAGATCAAATGCAGCTAACTGAACAAGAAT
TAAAAGAAGAATTCACTCGTATTTTAACTGCAACTAATCCTCATGCTCCT
CAAAATATCGTCCGATTCAATTTCAAGGAAATGTGCTACAAACCTATCGC
CCAAGTGGATCAACTAGCAGTACATTTCAGTGTGGAAGGCAATTTGTTGC
ATCGCGATTCAGACGAGGGCAGGCGACAAATGGCCAAGCAAGGCAAATTG
ATTGATGACTTGAAAGAGGACAAGGAACCTGGAGAAGGTGAGACGGAGAC
CGAAGATCTATCTTCACAGAAAGAAACCCCTGTTGAGCCGGAAGTATCGG
AGAAGAAATTGACCAATCAGTTTAACTTCTGTGAGCGCGCCAGTCAGACA
TATAATAACCCTGCTAGAGACCGTGGAAATGTCACTGAACCGCCTCCTAG
ATCGAACTTCTCCGATAACATCACCCAATGGGTAATTTACGATGCCTATT
TAGAGGATTTTGAGAAGCAACAACAAAGCAAAGAAAAAAAAGCAACATTT
GGTACGAAAGTTGAAGAGAAATCGAAGAAAAAACTGACTTCGATTGAAAC
AGCGGCAGACGAAATGAGTAAGATCGCCAAGCCAATCAAAATCGTTGAGC
GTATGGTCAATCAGAACACATTCGATGAAATATCTCAAGACTTCAAGTAT
TACGAGGATCCATCGGACGAGTATCGAGATCAGCAAGGAACTCTCCTGCC
GCTGTGGAGATTTACATTTGACAAGGCCAAGAAAATCGCGGTGACGGCGC
TAAGCTGGTCACCAAAATATCACGATTTATTTGCAGTTGGCCACGGATCA
TACGACTTCATGAAGCAGAGCAACGGACTTATCTGCTTTTACACCCTTAA
GAACCCGAGCTACCCAGAATACATATTCGAAACGCAATCTGGAGTGCTGT
CACTGGATCTGCATCGATCGCTGCCTCACATGCTCTGTGTCGGGTTCTAT
GATGGTGCCGTCGGGGTCTACAACATCACGCAGAGGAAATCAGGCCCACT
CTACCTCAGCACTGCGCAAACTGGCAAGCACACCGATCCAGTCTGGGAAG
TCAAATGGCAGCGGGAGGACTTCGATAATAATTTGAATTTCTATTCGGTG
AGTGCGGATGGCAGAGTCACCTCTTGGACGCTGATCAAGGAAGGAGTGGG
CAAGAAACACGAATGTCCAAACGACATTGTCTGCCATGACGTCATCGAAA
TCAAACTTTCAGATGATGTCTGCCAGGGACCAGATGGGGCGAACTTGTTG
TCACTCAGCAGCGGAACTTGTTTTGCATTCAATCCACAGCAAGAGCACAT
CTTCTTGATTGGTACTGAGGAAGGAGATGTCCATAAATGCAGCAAGGCCT
ACAGCACCCAATTTCTCGACACCTATCATGCGCACCACATGGCTGTGTAC
AAGGTTGCTTGGAATCTCTTTCATTCGGATATCTTCATTACGTGCTCCGC
TGATTGGACGATTCGCATTTGGGATCACAGCAAGAAAGATCCTTTGTTTG
TGTTTGACCTCGGTTCACCCGTCGGTGACGTTGTCTGGGCCCCGTATTCA
TCAACAGTATTCGCTGCCGCCACAGCCAATGGGAGCATCTATGTGTATGA
TCTAAGTATCAATAAATATGAGCCTATCTGCGAGCAGCTTATTGCCTCAA
AGAAGAAAACCAAGCTCACACATGTCTCTTTCAATCCAAAGTACCCGATC
TTGATCATTGGCGATGATCGAGGTCAAATCACCAGCTTGAAATTATCACC
CAATCTCAGGAAGGCTCCAAAAGAAAAGAAAGGACTGGATGTGCCAAAGG
GACCAGAAATAGAAATACAGAAATTAGAGAAAATACTGGCCTTGGTTGGA
TAGGATCGGTGCTAAAATTTGATAGATTGGATGAACGGATGAGCATCTGA
GCTGTTAGATTTGTTTCCTTTATTTTTGATGTTGATGAGAATAAAT
back to top

protein sequence of SMED30020525-orf-1

>SMED30020525-orf-1 ID=SMED30020525-orf-1|Name=SMED30020525-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=669bp
MKGAKDKKTKGRRRSKIEEDIPEAGPQDDLGDFMHSKIVKPEDQMQLTEQ
ELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNL
LHRDSDEGRRQMAKQGKLIDDLKEDKEPGEGETETEDLSSQKETPVEPEV
SEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDA
YLEDFEKQQQSKEKKATFGTKVEEKSKKKLTSIETAADEMSKIAKPIKIV
ERMVNQNTFDEISQDFKYYEDPSDEYRDQQGTLLPLWRFTFDKAKKIAVT
ALSWSPKYHDLFAVGHGSYDFMKQSNGLICFYTLKNPSYPEYIFETQSGV
LSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYLSTAQTGKHTDPVW
EVKWQREDFDNNLNFYSVSADGRVTSWTLIKEGVGKKHECPNDIVCHDVI
EIKLSDDVCQGPDGANLLSLSSGTCFAFNPQQEHIFLIGTEEGDVHKCSK
AYSTQFLDTYHAHHMAVYKVAWNLFHSDIFITCSADWTIRIWDHSKKDPL
FVFDLGSPVGDVVWAPYSSTVFAAATANGSIYVYDLSINKYEPICEQLIA
SKKKTKLTHVSFNPKYPILIIGDDRGQITSLKLSPNLRKAPKEKKGLDVP
KGPEIEIQKLEKILALVG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005929cilium
GO:0042995cell projection
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0030286dynein complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003774motor activity
Vocabulary: biological process
TermDefinition
GO:0003351epithelial cilium movement
GO:0007368determination of left/right symmetry
GO:0007507heart development
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 337..376
e-value: 3.2
score: 13.9
coord: 546..585
e-value: 0.43
score: 19.3
coord: 503..543
e-value: 1.3E-6
score: 38.0
coord: 383..428
e-value: 56.0
score: 6.0
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 510..543
score: 10.007
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 465..636
e-value: 4.1E-23
score: 84.0
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 225..451
e-value: 3.5E-16
score: 61.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 105..157
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..33
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 105..150
NoneNo IPR availablePANTHERPTHR12442:SF11DYNEIN INTERMEDIATE CHAIN 1, AXONEMALcoord: 35..652
NoneNo IPR availablePANTHERPTHR12442DYNEIN INTERMEDIATE CHAINcoord: 35..652
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 510..552
score: 9.678
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 298..630