ap2

Overview
Nameap2 (AFJ24713.1)
Smed IDSMED30020522
Length (bp)1932
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ap2 (SMED30020522) t-SNE clustered cells

Violin plots show distribution of expression levels for ap2 (SMED30020522) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ap2 (SMED30020522) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ap2 (SMED30020522) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020522

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30020522SMESG000022356.1 JX010470.1smed_ncbi_20200123PMID:24992682
Vásquez-Doorman et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30020522SMESG000022356.1 JX010470.1smed_ncbi_20200123PMID:24992682
Vásquez-Doorman et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30020522SMESG000022356.1 JX010470.1smed_ncbi_20200123PMID:24992682
Vásquez-Doorman et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30020522SMESG000022356.1 dd_Smed_v4_15104_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30020522SMESG000022356.1 dd_Smed_v6_15104_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
central nervous systemSMED30020522SMESG000022356.1 JX010470.1smed_ncbi_20200123PMID:25254346
Scimone et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30020522SMESG000022356.1 Contig11935newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30020522SMESG000022356.1 Contig11935uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30020522SMESG000022356.1 OX_Smed_1.0.06609ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
pharynx musculatureSMED30020522SMESG000022356.1 dd_Smed_v4_15104_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ap2 vs. Ensembl Human
Match: TFAP2D (transcription factor AP-2 delta [Source:HGNC Symbol;Acc:HGNC:15581])

HSP 1 Score: 288.115 bits (736), Expect = 5.896e-90
Identity = 139/205 (67.80%), Postives = 169/205 (82.44%), Query Frame = 1
Query: 1210 SDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            +D+FCSVPGRLSLLSSTSKYKV+I E++RRLSPPECLNASLLGGILRRAKSKNGGR LR+KLD++GLNLPAGRRKA  VTLLTSLVEGEA+ LARDF Y CE EFP +A  E+L+R   +   +T +R++ IL TKQ+  E  DLL++DR+PL ++RP  ILD  +QRHLT+FSLITHGFG+P + AA++T Q VL+EML   EK
Sbjct:  208 TDLFCSVPGRLSLLSSTSKYKVTIAEVKRRLSPPECLNASLLGGILRRAKSKNGGRCLREKLDRLGLNLPAGRRKAANVTLLTSLVEGEALHLARDFGYTCETEFPAKAVGEHLARQHMEQKEQT-ARKKMILATKQICKEFQDLLSQDRSPLGSSRPTPILDLDIQRHLTHFSLITHGFGTPAICAALSTFQTVLSEMLNYLEK 411          
BLAST of ap2 vs. Ensembl Human
Match: TFAP2B (transcription factor AP-2 beta [Source:HGNC Symbol;Acc:HGNC:11743])

HSP 1 Score: 287.73 bits (735), Expect = 1.113e-89
Identity = 164/322 (50.93%), Postives = 205/322 (63.66%), Query Frame = 1
Query:  859 DALMNSGHYDLRAAVGMGDPYSSGMRAGDLLGNCGGPVGLMDANHIDTSNNAVDFQNVIGIHNSTQLGMLADDGHNAMDDSGFMGSDNQIVYRKGIKLKCENKSYNGIMNMNGVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            D L++S H+ L A  GMGD  S        L   G P G+ D   ++ +NN+                     G N +D S        +  +    L      + G M++N      ++FCSVPGRLSLLSSTSKYKV++GE+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLR++L+KIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A +EYL+R   D P +  SR+  +L TKQL  E TDLL +DR P+ N+RP  IL+  +Q  LT+FSLITHGFG+P + AA+  +Q  L E LK  +K
Sbjct:  148 DVLLHSAHHGLDA--GMGDSLS--------LHGLGHP-GMEDVQSVEDANNS---------------------GMNLLDQSVI--KKVPVPPKSVTSLMMNKDGFLGGMSVN----TGEVFCSVPGRLSLLSSTSKYKVTVGEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLRERLEKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYICETEFPAKAVSEYLNRQHTD-PSDLHSRKNMLLATKQLCKEFTDLLAQDRTPIGNSRPSPILEPGIQSCLTHFSLITHGFGAPAICAALTALQNYLTEALKGMDK 430          
BLAST of ap2 vs. Ensembl Human
Match: TFAP2E (transcription factor AP-2 epsilon [Source:HGNC Symbol;Acc:HGNC:30774])

HSP 1 Score: 280.796 bits (717), Expect = 2.833e-87
Identity = 145/250 (58.00%), Postives = 178/250 (71.20%), Query Frame = 1
Query: 1084 NAMDDSGFMGSDNQIVYRKGIKLKCENKSYNGIMN---MNGVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
             AMD+ G    D  ++ +  I  K  + S   +     + G+    ++FCSVPGRLSLLSSTSKYKV++GE+QRRLSPPECLNASLLGG+LRRAKSKNGGR LR++L+KIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A AEYL R   D P E  SR+  +L  KQ+  E  DL+ +DR+PL N+RP +IL+  +Q  LT+FSLITHGFG P + AA+   Q  L E LK  +K
Sbjct:  170 QAMDEPGMSLLDQSVIKKVPIPSKASSLSALSLAKDSLVGGITNPGEVFCSVPGRLSLLSSTSKYKVTVGEVQRRLSPPECLNASLLGGVLRRAKSKNGGRCLRERLEKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAAAEYLCRQHAD-PGELHSRKSMLLAAKQICKEFADLMAQDRSPLGNSRPALILEPGVQSCLTHFSLITHGFGGPAICAALTAFQNYLLESLKGLDK 418          
BLAST of ap2 vs. Ensembl Human
Match: TFAP2C (transcription factor AP-2 gamma [Source:HGNC Symbol;Acc:HGNC:11744])

HSP 1 Score: 274.633 bits (701), Expect = 7.604e-85
Identity = 173/388 (44.59%), Postives = 228/388 (58.76%), Query Frame = 1
Query:  721 NSVDFGSHAAAAYAVHYPNPIFQQAFASTHPSHYSGFHMMTSRHHNDALMNSGHYDLRAAVGMGDPYSSGMRAG------------DLLGNCGGPVGLMDANHIDTSNNAVDFQNVIGIHNSTQLGMLADDGHNAMDDSGFMGSDNQIVYRKG--------IKLKCENKSYNGIMNMNGVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
             S D  SH   AYA    NP+ Q A   +    + G      R   +      H+   A +    P+ SG+ AG            DLL        L  A+ +D +  A +    +G+H+   +    D+  N +DD   +  D Q V RKG        + L C+ +    +MN       +++FCSVPGRLSLLSSTSKYKV++ E+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLR+KLDKIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +  AEYL+R      +E  +R+  +L  +QL  E T+LL++DR P   +R   +L++++Q  L++FSLITHGFGS  + AAV+ +Q  + E L V +K
Sbjct:   71 QSADPYSHLGEAYAAAI-NPLHQPAPTGSQQQAWPG------RQSQEGAGLPSHHGRPAGL---LPHLSGLEAGAVSARRDAYRRSDLL--------LPHAHALDAAGLAEN----LGLHD---MPHQMDEVQN-VDDQHLLLHD-QTVIRKGPISMTKNPLNLPCQKELVGAVMNP------TEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAAHVTLLTSLVEGEAVHLARDFAYVCEAEFPSKPVAEYLTRPHLGGRNEMAARKNMLLAAQQLCKEFTELLSQDRTPHGTSRLAPVLETNIQNCLSHFSLITHGFGSQAICAAVSALQNYIKEALIVIDK 425          
BLAST of ap2 vs. Ensembl Human
Match: TFAP2A (transcription factor AP-2 alpha [Source:HGNC Symbol;Acc:HGNC:11742])

HSP 1 Score: 273.863 bits (699), Expect = 1.032e-84
Identity = 189/414 (45.65%), Postives = 241/414 (58.21%), Query Frame = 1
Query:  604 IGAMSNSPTVNRFSLSQPHPISNNEPPFYPPPHNIQSSINSVDFGSHAAAAYAVHYPNPIFQQAFASTHPSHYSGFHMMTSRHHNDALMNSGHYDLRAAVGMGDPYSSGMRAGDLLGNCGGPVGLMDANHIDTSNNAVDFQNVIGIHNSTQLGMLADDGHNAMDDSGFMGSDNQIVYRKG-IKLKCENKSYNGIMNMN------GVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            +G +  SP  +   LS   P ++ +PP++ PP        S D  SH    Y++   NP+  Q     HP  + G      R   ++ +   H  L   +   DP     R  DLL    GP  L        S+   D       H   ++  + D G N  D         Q V +KG + L   N +    + +N      GV   +++FCSVPGRLSLLSSTSKYKV++ E+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLR+KLDKIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A AE+L+R   D P+E  +R+  +L TKQ+  E TDLL +DR+PL N+RP  IL+  +Q  LT+F+LI+HGFGSP V AAV  +Q  L E LK  +K
Sbjct:   31 LGTVGQSPYTSAPPLSH-TPNADFQPPYF-PPPYQPIYPQSQDPYSHVNDPYSL---NPLHAQP-QPQHPG-WPG-----QRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLL---HGPHAL--------SSGLGDLSIHSLPHAIEEVPHVEDPGINIPD---------QTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSD-PNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDK 411          
BLAST of ap2 vs. Ensembl Celegans
Match: aptf-1 (Transcription factor aptf-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09585])

HSP 1 Score: 208.379 bits (529), Expect = 4.241e-61
Identity = 99/206 (48.06%), Postives = 150/206 (72.82%), Query Frame = 1
Query: 1213 DMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIIL--DSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            +++C+VPGR SLLSST+KY+V++ EIQRR+SPPECLNASLLGGILR+AKSK+GG++LRD L K+GL LPAGRRK   VT  T+LVE EA+ +A++F  +CE EF  R    YL++    I  +   RR  +  +++++ E+ +LL+ DR PL    P  +L  D S+Q+HL++F+L+THGFG+  + A + +++ +++E +K  ++
Sbjct:  152 EVYCTVPGRTSLLSSTTKYRVTVAEIQRRISPPECLNASLLGGILRKAKSKDGGKTLRDSLKKLGLTLPAGRRKQANVTAWTALVEEEAIHMAKEFALVCEKEFHSREIGIYLTKTSLAIDPDVVKRRTALEMSRKVVGELAELLSCDRTPLTPYFPRNMLPIDPSVQQHLSHFTLMTHGFGNVAMSAVLESVKLMIDESIKYIDR 357          
BLAST of ap2 vs. Ensembl Celegans
Match: aptf-4 (AP-2 Transcription Factor family [Source:UniProtKB/TrEMBL;Acc:Q19863])

HSP 1 Score: 69.707 bits (169), Expect = 2.628e-12
Identity = 53/201 (26.37%), Postives = 91/201 (45.27%), Query Frame = 1
Query: 1228 VPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLN--KDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            V GRL  + + SKY +++ E++RR   PE +N S L    R++K K     ++  L    + +   +R+   VT  +  +E EA  LARD   + E   P  A A  +   ++ +    K+    +   K     IT ++   + R P    +   +  +S+     NFSL THGFG P  ++   + Q ++ +     EK
Sbjct:  235 VDGRLPAVGTRSKYDLTVDELRRRCGAPEHMNQSALYCFFRKSKKKEAINRVKKVLTDYNITVRTMQRQR-KVTCFSPFLEEEATALARDLDSITEEFLPIDAIALEM---LEKLIFNNKNLDICLRILKNTNKTITRVIKTLEVRQPKITGQKEKLKGNSLDLSYHNFSLTTHGFGHPNSLSHYRSYQKIVEQAALYCEK 431          
BLAST of ap2 vs. Ensembl Celegans
Match: aptf-3 (AP-2 Transcription Factor family [Source:UniProtKB/TrEMBL;Acc:Q19862])

HSP 1 Score: 67.3958 bits (163), Expect = 1.488e-11
Identity = 56/210 (26.67%), Postives = 93/210 (44.29%), Query Frame = 1
Query: 1228 VPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYL------SRNIQDIPHETKSRRQQILCTKQLLAEITDLLN--KDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEKDNN 1833
            V GRL  + + SKY +++ EI+RR   PE +N S L    R++K +     ++  L    + +   +R+   VT  +  +E EA  LARD   + E   P    A+ +      S N  D+ H            K   A IT ++   + R P    +   +  +++     NFSLITHGFG P  ++   +   ++   + + EK  N
Sbjct:  237 VDGRLPAVGTRSKYDITVDEIRRRCGAPEHMNQSALYCFFRKSKKREAINRVKQVLTVHNIPMRTMQRQ-RKVTCFSPFLEEEATALARDLDSISEEFLPINIIAQEMLEKLMSSGNNLDVCHRM---------LKNTTATITRVIKTLEVRQPKITGQEEKLKGNNLDLSYHNFSLITHGFGHPNSLSHYRSYLSIVERAVLLCEKIQN 436          
BLAST of ap2 vs. Ensembl Celegans
Match: aptf-2 (AP-2 Transcription Factor family [Source:UniProtKB/TrEMBL;Acc:Q9U1W4])

HSP 1 Score: 63.929 bits (154), Expect = 1.280e-10
Identity = 50/185 (27.03%), Postives = 85/185 (45.95%), Query Frame = 1
Query: 1219 FCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIIL-------DSSMQRHLTNFSLITHGFG 1752
            F  V GRLS+  + + Y V++ E++RRL  PE LN+S +   L+R K KNGG  +R +L   G+ +    ++      + +LVE EAV L  D      +++P +         IQ++ HE  +     L       + T+ ++   +   +  PPI         +  +   +  FS  +HG G
Sbjct:  151 FDVVHGRLSMGQNQTCYFVTVEEMRRRLQSPEKLNSSSIACNLKRPKLKNGGELMRAQLRDHGIKVQLNAKQKAFPNKVIALVEAEAVHLGLDLGTAVRDDYPVQDI-------IQEVAHEALADEDADLDALMNDKDFTECMSALESVFTSVVPPITGIEPKPSNNMRLNNGMETFSSASHGLG 328          
BLAST of ap2 vs. Ensembl Celegans
Match: aptf-2 (AP-2 Transcription Factor family [Source:UniProtKB/TrEMBL;Acc:Q9U1W4])

HSP 1 Score: 63.929 bits (154), Expect = 1.310e-10
Identity = 50/185 (27.03%), Postives = 85/185 (45.95%), Query Frame = 1
Query: 1219 FCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIIL-------DSSMQRHLTNFSLITHGFG 1752
            F  V GRLS+  + + Y V++ E++RRL  PE LN+S +   L+R K KNGG  +R +L   G+ +    ++      + +LVE EAV L  D      +++P +         IQ++ HE  +     L       + T+ ++   +   +  PPI         +  +   +  FS  +HG G
Sbjct:  147 FDVVHGRLSMGQNQTCYFVTVEEMRRRLQSPEKLNSSSIACNLKRPKLKNGGELMRAQLRDHGIKVQLNAKQKAFPNKVIALVEAEAVHLGLDLGTAVRDDYPVQDI-------IQEVAHEALADEDADLDALMNDKDFTECMSALESVFTSVVPPITGIEPKPSNNMRLNNGMETFSSASHGLG 324          
BLAST of ap2 vs. Ensembl Fly
Match: TfAP-2 (gene:FBgn0261953 transcript:FBtr0333465)

HSP 1 Score: 277.33 bits (708), Expect = 5.842e-86
Identity = 141/247 (57.09%), Postives = 178/247 (72.06%), Query Frame = 1
Query: 1084 NAMDDSGFMGSDNQIVYRKGIKLKCENKSYNGIMNMNGVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            NA+DD      D+ + +   + L    KS     N+ G    S++FC+VPGRLSLLSSTSKYKV+I E+QRRLSPPECLNASLLGG+LRRAKSKNGGR LR+KL+KIGLNLPAGRRKA  VTLLTSLVEGEA  LA+DF ++CE EFP R  AEY+ R+ Q  P ++  R++ IL ++Q+  E+  +L++DR     TR   +L+ SMQRHLT+FSLITHGFGSP ++A ++  Q  LNE L   EK
Sbjct:  191 NAVDDVQAPALDDNVAFMSDLPLIKSMKSGKEAGNI-GSGSPSEVFCAVPGRLSLLSSTSKYKVTIAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRLLREKLEKIGLNLPAGRRKAANVTLLTSLVEGEATHLAKDFHFVCETEFPARQLAEYIVRH-QTEPQDSYRRKELILHSQQITKELMQILSQDRTTHFGTRSQHLLEPSMQRHLTHFSLITHGFGSPAIMAVLHAFQTFLNESLNYLEK 435          
BLAST of ap2 vs. Ensembl Fly
Match: TfAP-2 (gene:FBgn0261953 transcript:FBtr0333468)

HSP 1 Score: 276.944 bits (707), Expect = 8.372e-86
Identity = 141/247 (57.09%), Postives = 178/247 (72.06%), Query Frame = 1
Query: 1084 NAMDDSGFMGSDNQIVYRKGIKLKCENKSYNGIMNMNGVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            NA+DD      D+ + +   + L    KS     N+ G    S++FC+VPGRLSLLSSTSKYKV+I E+QRRLSPPECLNASLLGG+LRRAKSKNGGR LR+KL+KIGLNLPAGRRKA  VTLLTSLVEGEA  LA+DF ++CE EFP R  AEY+ R+ Q  P ++  R++ IL ++Q+  E+  +L++DR     TR   +L+ SMQRHLT+FSLITHGFGSP ++A ++  Q  LNE L   EK
Sbjct:  197 NAVDDVQAPALDDNVAFMSDLPLIKSMKSGKEAGNI-GSGSPSEVFCAVPGRLSLLSSTSKYKVTIAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRLLREKLEKIGLNLPAGRRKAANVTLLTSLVEGEATHLAKDFHFVCETEFPARQLAEYIVRH-QTEPQDSYRRKELILHSQQITKELMQILSQDRTTHFGTRSQHLLEPSMQRHLTHFSLITHGFGSPAIMAVLHAFQTFLNESLNYLEK 441          
BLAST of ap2 vs. Ensembl Fly
Match: TfAP-2 (gene:FBgn0261953 transcript:FBtr0078419)

HSP 1 Score: 276.944 bits (707), Expect = 8.767e-86
Identity = 141/247 (57.09%), Postives = 178/247 (72.06%), Query Frame = 1
Query: 1084 NAMDDSGFMGSDNQIVYRKGIKLKCENKSYNGIMNMNGVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            NA+DD      D+ + +   + L    KS     N+ G    S++FC+VPGRLSLLSSTSKYKV+I E+QRRLSPPECLNASLLGG+LRRAKSKNGGR LR+KL+KIGLNLPAGRRKA  VTLLTSLVEGEA  LA+DF ++CE EFP R  AEY+ R+ Q  P ++  R++ IL ++Q+  E+  +L++DR     TR   +L+ SMQRHLT+FSLITHGFGSP ++A ++  Q  LNE L   EK
Sbjct:  193 NAVDDVQAPALDDNVAFMSDLPLIKSMKSGKEAGNI-GSGSPSEVFCAVPGRLSLLSSTSKYKVTIAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRLLREKLEKIGLNLPAGRRKAANVTLLTSLVEGEATHLAKDFHFVCETEFPARQLAEYIVRH-QTEPQDSYRRKELILHSQQITKELMQILSQDRTTHFGTRSQHLLEPSMQRHLTHFSLITHGFGSPAIMAVLHAFQTFLNESLNYLEK 437          
BLAST of ap2 vs. Ensembl Fly
Match: TfAP-2 (gene:FBgn0261953 transcript:FBtr0078418)

HSP 1 Score: 276.944 bits (707), Expect = 8.921e-86
Identity = 141/247 (57.09%), Postives = 178/247 (72.06%), Query Frame = 1
Query: 1084 NAMDDSGFMGSDNQIVYRKGIKLKCENKSYNGIMNMNGVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            NA+DD      D+ + +   + L    KS     N+ G    S++FC+VPGRLSLLSSTSKYKV+I E+QRRLSPPECLNASLLGG+LRRAKSKNGGR LR+KL+KIGLNLPAGRRKA  VTLLTSLVEGEA  LA+DF ++CE EFP R  AEY+ R+ Q  P ++  R++ IL ++Q+  E+  +L++DR     TR   +L+ SMQRHLT+FSLITHGFGSP ++A ++  Q  LNE L   EK
Sbjct:  197 NAVDDVQAPALDDNVAFMSDLPLIKSMKSGKEAGNI-GSGSPSEVFCAVPGRLSLLSSTSKYKVTIAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRLLREKLEKIGLNLPAGRRKAANVTLLTSLVEGEATHLAKDFHFVCETEFPARQLAEYIVRH-QTEPQDSYRRKELILHSQQITKELMQILSQDRTTHFGTRSQHLLEPSMQRHLTHFSLITHGFGSPAIMAVLHAFQTFLNESLNYLEK 441          
BLAST of ap2 vs. Ensembl Fly
Match: TfAP-2 (gene:FBgn0261953 transcript:FBtr0333467)

HSP 1 Score: 276.944 bits (707), Expect = 1.006e-85
Identity = 141/247 (57.09%), Postives = 178/247 (72.06%), Query Frame = 1
Query: 1084 NAMDDSGFMGSDNQIVYRKGIKLKCENKSYNGIMNMNGVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            NA+DD      D+ + +   + L    KS     N+ G    S++FC+VPGRLSLLSSTSKYKV+I E+QRRLSPPECLNASLLGG+LRRAKSKNGGR LR+KL+KIGLNLPAGRRKA  VTLLTSLVEGEA  LA+DF ++CE EFP R  AEY+ R+ Q  P ++  R++ IL ++Q+  E+  +L++DR     TR   +L+ SMQRHLT+FSLITHGFGSP ++A ++  Q  LNE L   EK
Sbjct:  199 NAVDDVQAPALDDNVAFMSDLPLIKSMKSGKEAGNI-GSGSPSEVFCAVPGRLSLLSSTSKYKVTIAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRLLREKLEKIGLNLPAGRRKAANVTLLTSLVEGEATHLAKDFHFVCETEFPARQLAEYIVRH-QTEPQDSYRRKELILHSQQITKELMQILSQDRTTHFGTRSQHLLEPSMQRHLTHFSLITHGFGSPAIMAVLHAFQTFLNESLNYLEK 443          
BLAST of ap2 vs. Ensembl Zebrafish
Match: tfap2a (transcription factor AP-2 alpha [Source:ZFIN;Acc:ZDB-GENE-011212-6])

HSP 1 Score: 288.886 bits (738), Expect = 6.754e-91
Identity = 146/250 (58.40%), Postives = 186/250 (74.40%), Query Frame = 1
Query: 1090 MDDSGFMGSDNQIVYRKGIKLKCENKSYNGI-MNMNG----VHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            ++D G    D  ++ +  + +   N + + I +N +G    V   +++FCSVPGRLSLLSSTSKYKV++ E+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLR+KLDKIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A AEY++R   D P+E   R+  +L TKQ+  E TDLL++DR+PL N+RP  IL+  +Q  LT+FSLI+HGFG+P V AA+  +Q  L E +K  +K
Sbjct:  143 VEDQGIHIPDQTVIKKGPVSISKNNSNISAIPINKDGLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAIAEYMNRQHSD-PNEQVQRKNMLLATKQICKEFTDLLSQDRSPLGNSRPQPILEPGIQSCLTHFSLISHGFGTPAVCAALTALQNYLTEAIKAMDK 391          
BLAST of ap2 vs. Ensembl Zebrafish
Match: tfap2a (transcription factor AP-2 alpha [Source:ZFIN;Acc:ZDB-GENE-011212-6])

HSP 1 Score: 289.656 bits (740), Expect = 7.368e-91
Identity = 146/250 (58.40%), Postives = 186/250 (74.40%), Query Frame = 1
Query: 1090 MDDSGFMGSDNQIVYRKGIKLKCENKSYNGI-MNMNG----VHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            ++D G    D  ++ +  + +   N + + I +N +G    V   +++FCSVPGRLSLLSSTSKYKV++ E+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLR+KLDKIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A AEY++R   D P+E   R+  +L TKQ+  E TDLL++DR+PL N+RP  IL+  +Q  LT+FSLI+HGFG+P V AA+  +Q  L E +K  +K
Sbjct:  162 VEDQGIHIPDQTVIKKGPVSISKNNSNISAIPINKDGLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAIAEYMNRQHSD-PNEQVQRKNMLLATKQICKEFTDLLSQDRSPLGNSRPQPILEPGIQSCLTHFSLISHGFGTPAVCAALTALQNYLTEAIKAMDK 410          
BLAST of ap2 vs. Ensembl Zebrafish
Match: tfap2a (transcription factor AP-2 alpha [Source:ZFIN;Acc:ZDB-GENE-011212-6])

HSP 1 Score: 288.886 bits (738), Expect = 9.146e-91
Identity = 146/250 (58.40%), Postives = 186/250 (74.40%), Query Frame = 1
Query: 1090 MDDSGFMGSDNQIVYRKGIKLKCENKSYNGI-MNMNG----VHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            ++D G    D  ++ +  + +   N + + I +N +G    V   +++FCSVPGRLSLLSSTSKYKV++ E+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLR+KLDKIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A AEY++R   D P+E   R+  +L TKQ+  E TDLL++DR+PL N+RP  IL+  +Q  LT+FSLI+HGFG+P V AA+  +Q  L E +K  +K
Sbjct:  151 VEDQGIHIPDQTVIKKGPVSISKNNSNISAIPINKDGLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAIAEYMNRQHSD-PNEQVQRKNMLLATKQICKEFTDLLSQDRSPLGNSRPQPILEPGIQSCLTHFSLISHGFGTPAVCAALTALQNYLTEAIKAMDK 399          
BLAST of ap2 vs. Ensembl Zebrafish
Match: tfap2e (transcription factor AP-2 epsilon [Source:NCBI gene;Acc:393794])

HSP 1 Score: 286.189 bits (731), Expect = 1.565e-90
Identity = 160/368 (43.48%), Postives = 222/368 (60.33%), Query Frame = 1
Query:  766 HYPNPIFQQAFASTHPSHYSGFHMMTSRHHNDALMNSGHYDL-----RAAVGMGDPYSSGMRAGDLLGNCG-GPVGLMDANHIDTSNNAVDFQNVIGIHNSTQLGMLADDGHNAMDDSGFMGSDNQIVYRKGIKLKCENKSYNGI------MNMNGVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEKDNN 1833
            H P P    +  S H    + +H   SR  +  L++  H  L     R   G+    + G+  GD     G GP+G+   +H           ++ G+  ++ LG+L                D+ ++ +  +  K    + + +      + + GV   +++FCSVPGRLSLLSSTSKYKV++GE+QRRL+PPECLNASLLGG+LRRAKSKNGGR LR++L+KIGLNLPAGRRKA  VTLLT+LVEGEAV LARDF Y+CE EFP RA AEYL R  +  P +  +RR  +L TK++  E  DL+++DR+PL  +RP   L+  +Q  LT+FSL+THGFG+P + AA++  Q  L E LK+ +K  N
Sbjct:    9 HLPEPY--PSLNSLHQHQQAAWHSQRSRSEDAGLLSQPHRALSLDPRREYPGVPRLLTHGL--GDGAAALGDGPLGMHAVHH--------GLDDIQGLEEASALGIL----------------DHSVIKKVPLPSKLNGSTISALSLSKEGLGLGGVSNPAEVFCSVPGRLSLLSSTSKYKVTVGEVQRRLAPPECLNASLLGGVLRRAKSKNGGRCLRERLEKIGLNLPAGRRKAANVTLLTALVEGEAVHLARDFGYVCETEFPARATAEYLCRQTE--PDQLPTRRSMLLATKEICKEFVDLMSQDRSPLGASRPTPCLEPGVQSSLTHFSLLTHGFGTPALCAALSAFQSYLLEALKLLDKGEN 346          
BLAST of ap2 vs. Ensembl Zebrafish
Match: tfap2a (transcription factor AP-2 alpha [Source:ZFIN;Acc:ZDB-GENE-011212-6])

HSP 1 Score: 288.5 bits (737), Expect = 1.649e-90
Identity = 146/250 (58.40%), Postives = 186/250 (74.40%), Query Frame = 1
Query: 1090 MDDSGFMGSDNQIVYRKGIKLKCENKSYNGI-MNMNG----VHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            ++D G    D  ++ +  + +   N + + I +N +G    V   +++FCSVPGRLSLLSSTSKYKV++ E+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLR+KLDKIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A AEY++R   D P+E   R+  +L TKQ+  E TDLL++DR+PL N+RP  IL+  +Q  LT+FSLI+HGFG+P V AA+  +Q  L E +K  +K
Sbjct:  163 VEDQGIHIPDQTVIKKGPVSISKNNSNISAIPINKDGLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAIAEYMNRQHSD-PNEQVQRKNMLLATKQICKEFTDLLSQDRSPLGNSRPQPILEPGIQSCLTHFSLISHGFGTPAVCAALTALQNYLTEAIKAMDK 411          
BLAST of ap2 vs. Ensembl Xenopus
Match: b4galnt1 (beta-1,4-N-acetyl-galactosaminyl transferase 1 [Source:Xenbase;Acc:XB-GENE-960512])

HSP 1 Score: 287.73 bits (735), Expect = 4.922e-90
Identity = 147/242 (60.74%), Postives = 183/242 (75.62%), Query Frame = 1
Query: 1120 NQIVYRKG-IKLKCENKSYNGIMNMN------GVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            +Q V +KG + L   N +    +++N      GV   +++FCSVPGRLSLLSSTSKYKV++ E+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLR+KLDKIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A  EY++R   D P+E  +R+  +L TKQ+  E TDLL++DR+PL N+RP  IL+  +Q  LT+F+LI+HGFGSP V AA+  +Q  L E LK  +K
Sbjct:  176 DQTVIKKGPVSLSKSNNNAVSSLSLNKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAIGEYVNRQHSD-PNEQVTRKNMLLATKQICKEFTDLLSQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAITALQNYLTEALKAMDK 416          
BLAST of ap2 vs. Ensembl Xenopus
Match: tfap2e (transcription factor AP-2 epsilon [Source:NCBI gene;Acc:100170172])

HSP 1 Score: 287.345 bits (734), Expect = 5.782e-90
Identity = 148/253 (58.50%), Postives = 183/253 (72.33%), Query Frame = 1
Query: 1084 NAMDDSGFMGSDNQIVYRKGIKLKCENKSYNGIMNMN------GVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
             ++D+SG    D  ++ +  I  K  N S    ++M+      GV   +++FCSVPGRLSLLSSTSKYKV++GE+QRRLSPPECLNASLLGG+LRRAKSKNGGR LR++L+KIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A AEYL R   D P E  +R+  +L TKQ+  E  DLL +DR+PL N+RP +IL+  +Q  LT+FSLITHGFG P + AA+   Q  L E LK  +K
Sbjct:  158 QSLDESGVSILDQSVIKKVPIPSK-NNGSMMSALSMHKESLIGGVTNPNEVFCSVPGRLSLLSSTSKYKVTVGEVQRRLSPPECLNASLLGGVLRRAKSKNGGRCLRERLEKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAAAEYLCRQHSD-PTELHARKNMLLATKQICKEFADLLAQDRSPLGNSRPSLILEPGVQSCLTHFSLITHGFGGPAICAALTAFQNYLLESLKGMDK 408          
BLAST of ap2 vs. Ensembl Xenopus
Match: b4galnt1 (beta-1,4-N-acetyl-galactosaminyl transferase 1 [Source:Xenbase;Acc:XB-GENE-960512])

HSP 1 Score: 285.804 bits (730), Expect = 4.074e-89
Identity = 141/218 (64.68%), Postives = 172/218 (78.90%), Query Frame = 1
Query: 1171 YNGIMNMNGVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            + G++N N      ++FCSVPGRLSLLSSTSKYKV++ E+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLR+KLDKIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A  EY++R   D P+E  +R+  +L TKQ+  E TDLL++DR+PL N+RP  IL+  +Q  LT+F+LI+HGFGSP V AA+  +Q  L E LK  +K
Sbjct:  218 FGGVVNPN------EVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAIGEYVNRQHSD-PNEQVTRKNMLLATKQICKEFTDLLSQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAITALQNYLTEALKAMDK 428          
BLAST of ap2 vs. Ensembl Xenopus
Match: mat2a (methionine adenosyltransferase II, alpha [Source:Xenbase;Acc:XB-GENE-981938])

HSP 1 Score: 284.263 bits (726), Expect = 1.291e-88
Identity = 138/204 (67.65%), Postives = 165/204 (80.88%), Query Frame = 1
Query: 1213 DMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            ++FCSVPGRLSLLSSTSKYKV++GE+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLR++L+KIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A +EYL+R   D P +  SR+  +L TKQL  E TDLL +DR P+ N+RP  IL+  +Q  LT+FSLITHGFG+P + AA+  +Q  L E LK  +K
Sbjct:  209 EVFCSVPGRLSLLSSTSKYKVTVGEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLRERLEKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYICETEFPAKAVSEYLNRQHTD-PTDLHSRKNMLLATKQLCKEFTDLLAQDRTPIGNSRPSPILEPGIQSCLTHFSLITHGFGAPAICAALTALQNYLTEALKGMDK 411          
BLAST of ap2 vs. Ensembl Xenopus
Match: mat2a (methionine adenosyltransferase II, alpha [Source:Xenbase;Acc:XB-GENE-981938])

HSP 1 Score: 284.263 bits (726), Expect = 1.760e-88
Identity = 138/204 (67.65%), Postives = 165/204 (80.88%), Query Frame = 1
Query: 1213 DMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            ++FCSVPGRLSLLSSTSKYKV++GE+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLR++L+KIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A +EYL+R   D P +  SR+  +L TKQL  E TDLL +DR P+ N+RP  IL+  +Q  LT+FSLITHGFG+P + AA+  +Q  L E LK  +K
Sbjct:  216 EVFCSVPGRLSLLSSTSKYKVTVGEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLRERLEKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYICETEFPAKAVSEYLNRQHTD-PTDLHSRKNMLLATKQLCKEFTDLLAQDRTPIGNSRPSPILEPGIQSCLTHFSLITHGFGAPAICAALTALQNYLTEALKGMDK 418          
BLAST of ap2 vs. Ensembl Mouse
Match: Tfap2a (transcription factor AP-2, alpha [Source:MGI Symbol;Acc:MGI:104671])

HSP 1 Score: 291.197 bits (744), Expect = 1.624e-91
Identity = 148/251 (58.96%), Postives = 184/251 (73.31%), Query Frame = 1
Query: 1090 MDDSGFMGSDNQIVYRKGIKLKCENKSYNGIMNMN------GVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            ++D G    D  ++ +  + L   N +    + +N      GV   +++FCSVPGRLSLLSSTSKYKV++ E+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLR+KLDKIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A AE+L+R   D P+E  +R+  +L TKQ+  E TDLL +DR+PL N+RP  IL+  +Q  LT+F+LI+HGFGSP V AAV  +Q  L E LK  +K
Sbjct:  158 VEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSD-PNEQVARKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDK 407          
BLAST of ap2 vs. Ensembl Mouse
Match: Tfap2a (transcription factor AP-2, alpha [Source:MGI Symbol;Acc:MGI:104671])

HSP 1 Score: 291.197 bits (744), Expect = 1.631e-91
Identity = 148/251 (58.96%), Postives = 184/251 (73.31%), Query Frame = 1
Query: 1090 MDDSGFMGSDNQIVYRKGIKLKCENKSYNGIMNMN------GVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            ++D G    D  ++ +  + L   N +    + +N      GV   +++FCSVPGRLSLLSSTSKYKV++ E+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLR+KLDKIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A AE+L+R   D P+E  +R+  +L TKQ+  E TDLL +DR+PL N+RP  IL+  +Q  LT+F+LI+HGFGSP V AAV  +Q  L E LK  +K
Sbjct:  156 VEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSD-PNEQVARKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDK 405          
BLAST of ap2 vs. Ensembl Mouse
Match: Tfap2a (transcription factor AP-2, alpha [Source:MGI Symbol;Acc:MGI:104671])

HSP 1 Score: 290.812 bits (743), Expect = 2.768e-91
Identity = 148/251 (58.96%), Postives = 184/251 (73.31%), Query Frame = 1
Query: 1090 MDDSGFMGSDNQIVYRKGIKLKCENKSYNGIMNMN------GVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            ++D G    D  ++ +  + L   N +    + +N      GV   +++FCSVPGRLSLLSSTSKYKV++ E+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLR+KLDKIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A AE+L+R   D P+E  +R+  +L TKQ+  E TDLL +DR+PL N+RP  IL+  +Q  LT+F+LI+HGFGSP V AAV  +Q  L E LK  +K
Sbjct:  162 VEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSD-PNEQVARKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDK 411          
BLAST of ap2 vs. Ensembl Mouse
Match: Tfap2a (transcription factor AP-2, alpha [Source:MGI Symbol;Acc:MGI:104671])

HSP 1 Score: 290.812 bits (743), Expect = 3.301e-91
Identity = 148/251 (58.96%), Postives = 184/251 (73.31%), Query Frame = 1
Query: 1090 MDDSGFMGSDNQIVYRKGIKLKCENKSYNGIMNMN------GVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            ++D G    D  ++ +  + L   N +    + +N      GV   +++FCSVPGRLSLLSSTSKYKV++ E+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLR+KLDKIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A AE+L+R   D P+E  +R+  +L TKQ+  E TDLL +DR+PL N+RP  IL+  +Q  LT+F+LI+HGFGSP V AAV  +Q  L E LK  +K
Sbjct:  164 VEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSD-PNEQVARKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDK 413          
BLAST of ap2 vs. Ensembl Mouse
Match: Tfap2a (transcription factor AP-2, alpha [Source:MGI Symbol;Acc:MGI:104671])

HSP 1 Score: 290.812 bits (743), Expect = 3.301e-91
Identity = 148/251 (58.96%), Postives = 184/251 (73.31%), Query Frame = 1
Query: 1090 MDDSGFMGSDNQIVYRKGIKLKCENKSYNGIMNMN------GVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            ++D G    D  ++ +  + L   N +    + +N      GV   +++FCSVPGRLSLLSSTSKYKV++ E+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLR+KLDKIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A AE+L+R   D P+E  +R+  +L TKQ+  E TDLL +DR+PL N+RP  IL+  +Q  LT+F+LI+HGFGSP V AAV  +Q  L E LK  +K
Sbjct:  164 VEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSD-PNEQVARKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDK 413          
BLAST of ap2 vs. UniProt/SwissProt
Match: sp|A1A4R9|AP2A_BOVIN (Transcription factor AP-2-alpha OS=Bos taurus OX=9913 GN=TFAP2A PE=2 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 2.247e-90
Identity = 148/251 (58.96%), Postives = 184/251 (73.31%), Query Frame = 1
Query: 1090 MDDSGFMGSDNQIVYRKGIKLKCENKSYNGIMNMN------GVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            ++D G    D  ++ +  + L   N +    + +N      GV   +++FCSVPGRLSLLSSTSKYKV++ E+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLR+KLDKIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A AE+L+R   D P+E  +R+  +L TKQ+  E TDLL +DR+PL N+RP  IL+  +Q  LT+F+LI+HGFGSP V AAV  +Q  L E LK  +K
Sbjct:  162 VEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSD-PNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDK 411          
BLAST of ap2 vs. UniProt/SwissProt
Match: sp|P34056|AP2A_MOUSE (Transcription factor AP-2-alpha OS=Mus musculus OX=10090 GN=Tfap2a PE=1 SV=2)

HSP 1 Score: 288.886 bits (738), Expect = 8.582e-90
Identity = 148/251 (58.96%), Postives = 184/251 (73.31%), Query Frame = 1
Query: 1090 MDDSGFMGSDNQIVYRKGIKLKCENKSYNGIMNMN------GVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            ++D G    D  ++ +  + L   N +    + +N      GV   +++FCSVPGRLSLLSSTSKYKV++ E+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLR+KLDKIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A AE+L+R   D P+E  +R+  +L TKQ+  E TDLL +DR+PL N+RP  IL+  +Q  LT+F+LI+HGFGSP V AAV  +Q  L E LK  +K
Sbjct:  162 VEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSD-PNEQVARKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDK 411          
BLAST of ap2 vs. UniProt/SwissProt
Match: sp|Q6VUP9|AP2E_MOUSE (Transcription factor AP-2-epsilon OS=Mus musculus OX=10090 GN=Tfap2e PE=1 SV=2)

HSP 1 Score: 288.5 bits (737), Expect = 1.458e-89
Identity = 147/250 (58.80%), Postives = 179/250 (71.60%), Query Frame = 1
Query: 1084 NAMDDSGFMGSDNQIVYRKGIKLKCENKSYNGIMN---MNGVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
             A+DD G    D  ++ +  I  K  + S   +     + G+   S++FCSVPGRLSLLSSTSKYKV++GE+QRRLSPPECLNASLLGG+LRRAKSKNGGR LR++L+KIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A AEYL R   D P E  SR+  +L  KQ+  E  DL+ +DR+PL N+RP +IL+  +Q  LT+FSLITHGFG P + AA+   Q  L E LK  EK
Sbjct:  170 QAIDDPGMSLLDQSVIKKVPIPSKAGSLSTLALSKDSLVGGISNPSEVFCSVPGRLSLLSSTSKYKVTVGEVQRRLSPPECLNASLLGGVLRRAKSKNGGRCLRERLEKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAAAEYLCRQHAD-PGELHSRKSMLLAAKQICKEFADLMAQDRSPLGNSRPALILEPGVQSCLTHFSLITHGFGGPAICAALTAFQNYLLESLKGLEK 418          
BLAST of ap2 vs. UniProt/SwissProt
Match: sp|Q9N0N3|AP2A_SHEEP (Transcription factor AP-2-alpha OS=Ovis aries OX=9940 GN=TFAP2A PE=2 SV=1)

HSP 1 Score: 289.656 bits (740), Expect = 2.572e-89
Identity = 148/251 (58.96%), Postives = 184/251 (73.31%), Query Frame = 1
Query: 1090 MDDSGFMGSDNQIVYRKGIKLKCENKSYNGIMNMN------GVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            ++D G    D  ++ +  + L   N +    + +N      GV   +++FCSVPGRLSLLSSTSKYKV++ E+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLR+KLDKIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A AE+L+R   D P+E  +R+  +L TKQ+  E TDLL +DR+PL N+RP  IL+  +Q  LT+F+LI+HGFGSP V AAV  +Q  L E LK  +K
Sbjct:  216 VEDPGINIPDQTVIKKGPVSLSKSNSNAVSSIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSD-PNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDK 465          
BLAST of ap2 vs. UniProt/SwissProt
Match: sp|Q7Z6R9|AP2D_HUMAN (Transcription factor AP-2-delta OS=Homo sapiens OX=9606 GN=TFAP2D PE=1 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 2.831e-89
Identity = 139/205 (67.80%), Postives = 169/205 (82.44%), Query Frame = 1
Query: 1210 SDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            +D+FCSVPGRLSLLSSTSKYKV+I E++RRLSPPECLNASLLGGILRRAKSKNGGR LR+KLD++GLNLPAGRRKA  VTLLTSLVEGEA+ LARDF Y CE EFP +A  E+L+R   +   +T +R++ IL TKQ+  E  DLL++DR+PL ++RP  ILD  +QRHLT+FSLITHGFG+P + AA++T Q VL+EML   EK
Sbjct:  208 TDLFCSVPGRLSLLSSTSKYKVTIAEVKRRLSPPECLNASLLGGILRRAKSKNGGRCLREKLDRLGLNLPAGRRKAANVTLLTSLVEGEALHLARDFGYTCETEFPAKAVGEHLARQHMEQKEQT-ARKKMILATKQICKEFQDLLSQDRSPLGSSRPTPILDLDIQRHLTHFSLITHGFGTPAICAALSTFQTVLSEMLNYLEK 411          
BLAST of ap2 vs. TrEMBL
Match: I1ZI59 (Ap2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 893.649 bits (2308), Expect = 0.000e+0
Identity = 429/430 (99.77%), Postives = 430/430 (100.00%), Query Frame = 1
Query:  556 MNNSTSSSFVSNPTGLIGAMSNSPTVNRFSLSQPHPISNNEPPFYPPPHNIQSSINSVDFGSHAAAAYAVHYPNPIFQQAFASTHPSHYSGFHMMTSRHHNDALMNSGHYDLRAAVGMGDPYSSGMRAGDLLGNCGGPVGLMDANHIDTSNNAVDFQNVIGIHNSTQLGMLADDGHNAMDDSGFMGSDNQIVYRKGIKLKCENKSYNGIMNMNGVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEKDNNTISP 1845
            MNNSTSSSFVSNPTGLIGAMSNSPTVNRFSLSQPHPISNNEPPFYPPPHNIQSSINSVDFGSHAAAAYAVHYPNPIFQQAFASTHPSHYSGFHMMTSRHHNDALMNSGHYDLRAAVGMGDPYSSGMRAGDLLGNCGGPVGLMDANHIDT+NNAVDFQNVIGIHNSTQLGMLADDGHNAMDDSGFMGSDNQIVYRKGIKLKCENKSYNGIMNMNGVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEKDNNTISP
Sbjct:    1 MNNSTSSSFVSNPTGLIGAMSNSPTVNRFSLSQPHPISNNEPPFYPPPHNIQSSINSVDFGSHAAAAYAVHYPNPIFQQAFASTHPSHYSGFHMMTSRHHNDALMNSGHYDLRAAVGMGDPYSSGMRAGDLLGNCGGPVGLMDANHIDTTNNAVDFQNVIGIHNSTQLGMLADDGHNAMDDSGFMGSDNQIVYRKGIKLKCENKSYNGIMNMNGVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEKDNNTISP 430          
BLAST of ap2 vs. TrEMBL
Match: K1P2V7 (Transcription factor AP-2 alpha OS=Crassostrea gigas OX=29159 GN=CGI_10015578 PE=4 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 6.445e-109
Identity = 183/315 (58.10%), Postives = 227/315 (72.06%), Query Frame = 1
Query:  904 GMGDPYSS--GMRAGDLLGNCGGPVGLMDANHIDTSNNAVDFQNVIGIHNSTQLGMLADDGHN-AMDDSG-FMGSDNQIVYRKGIKLKCENKSYNGIMNMNGVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEKDNNT 1836
            G+  P+S   G+R  D+L + G P+G  D N            N++ IH S  L  + D  H  A+D+SG ++ SD+  V RKGI+ K +N      + ++G+    D+FCSVPGRLSLLSSTSKYKV++ E+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLRDKLDKIGL+LPAGRRKA  VTLLTSLVEGEAVRLARD+ YLCE EFP R CAEY +R   + P +  +R+  IL TKQ+L E  DLLN+DR+PL NTRP  IL+  +QRHLT+FSLITHGFGSP VVA++  +Q  LNEMLK+ +K  +T
Sbjct:  159 GLTPPHSEYGGIRRPDILMSGGHPLGFGDQN-----------TNLLNIHPSAGLPGIEDGIHQGAIDESGNYISSDHNGVIRKGIRPKNDNSKD---LVISGITSPGDVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLRDKLDKIGLSLPAGRRKAANVTLLTSLVEGEAVRLARDYGYLCETEFPARQCAEYNTRQYSNDPTDQMARKNMILATKQILKEFMDLLNQDRSPLGNTRPQPILEPGIQRHLTHFSLITHGFGSPAVVASLTAVQAYLNEMLKILDKSYST 459          
BLAST of ap2 vs. TrEMBL
Match: A0A210QC86 (Transcription factor AP-2-epsilon OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT08476 PE=4 SV=1)

HSP 1 Score: 335.109 bits (858), Expect = 5.780e-105
Identity = 192/347 (55.33%), Postives = 232/347 (66.86%), Query Frame = 1
Query:  817 HYSGFHMMTSRH----HNDALMNSGHYDLRAAVGMGDPYSSGMRAGDLLGNCGGPVGLMDANHIDTSNNAVDFQNVIGIHNSTQLGMLADDGHNA--MDDSGFM-GSDNQIVYRKGIKLKCENKSYNGIMNMNGVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEKDNNT 1836
            HY   H   SR+      D L N  H+ L A         SGMR  D+L   G  +G  D +             ++ IH    L +L +  H A   D + F+ G  N  V RKGI+ K EN   N  + ++GV   SD+FCSVPGRLSLLSSTSKYKV++ E+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLRDKLDKIGL+LPAGRRKA  VTLLTSLVEGE+VRLARD+ YLCE EFP R CAEY  R   D P +  +R+  IL TKQ+L E  DLLN+DR+PL NTRP +IL+  +QRHLT+FSLITHGFGSP VVA++  +Q  LNEMLK+ +K+ +T
Sbjct:   93 HYHQLHTPDSRNVLRPREDGLHNM-HHGLPAPHDPRRTDYSGMRRPDILVPGGHHLGF-DQD-----------PTILNIHAGNGLQVLDEGIHQAGLEDTTSFISGEHNHSVIRKGIRQKNEN---NKDLVISGVSSPSDVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLRDKLDKIGLSLPAGRRKAANVTLLTSLVEGESVRLARDYGYLCETEFPSRQCAEYNCRTYTD-PADQMTRKNMILATKQILKEFMDLLNQDRSPLGNTRPQMILEPGIQRHLTHFSLITHGFGSPAVVASLTAVQNYLNEMLKILDKNYST 422          
BLAST of ap2 vs. TrEMBL
Match: A0A1S3JCV3 (transcription factor AP-2-epsilon isoform X2 OS=Lingula unguis OX=7574 GN=LOC106171994 PE=4 SV=1)

HSP 1 Score: 335.109 bits (858), Expect = 1.827e-104
Identity = 164/276 (59.42%), Postives = 213/276 (77.17%), Query Frame = 1
Query: 1006 NNAVDFQNVIGIHNSTQLGMLADDGHNAMDDSG-FMGSDNQIVYRK-GIKLKCENKSYNGIMNMNGVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEKD 1827
             + +D +  + +H S+ LG+  +DG  ++DDSG ++  D+  V RK G ++K + K     + ++GV   +D+FCSVPGRLSLLSSTSKYKV++ E+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLRDKL+KIGL LPAGRRKA  +TL +S+VEGEA+RLARDF YLCE EFP R C EY++R   D P +  +RR  +L ++Q+L E+TDLLN+DR+PL NTRP +ILD S+QRHLT+FSLITHGFGSP +VAA+  +Q  L EMLK  +K+
Sbjct:  182 THGLDQETALSLHGSSMLGI--EDGQGSVDDSGNYIPGDHSSVIRKAGNRIKSDTKD----IVISGVTAPTDVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLRDKLEKIGLTLPAGRRKAAPITLYSSVVEGEAIRLARDFGYLCETEFPARQCGEYVARQTTD-PSDCHNRRNMVLASRQILKELTDLLNQDRSPLGNTRPQMILDPSIQRHLTHFSLITHGFGSPAIVAALTAVQNYLTEMLKFMDKN 450          
BLAST of ap2 vs. TrEMBL
Match: A0A1I8I601 (TF_AP-2 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 4.829e-104
Identity = 152/217 (70.05%), Postives = 182/217 (83.87%), Query Frame = 1
Query: 1195 GVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEKDNNTISP 1845
            G+   SD+FCSVPGRLSLLSSTSKYKV++ EIQRRLSPPECLNASLLGG+LRRAKSKNGGRSLRDKLDKIGLNLPAGRRKA  VTLLTSLVEGEAVRLARDF YLCE EFP RACA+YL+R +   P E + R+  I+  K LL E+TD+LNKDR+PLCNTRP  +LD  +QRHLT+FSLITHGFG+P +V+A   +Q +L+EM+K  +++ + ++P
Sbjct:   31 GLGAPSDLFCSVPGRLSLLSSTSKYKVTVAEIQRRLSPPECLNASLLGGVLRRAKSKNGGRSLRDKLDKIGLNLPAGRRKAATVTLLTSLVEGEAVRLARDFNYLCETEFPARACADYLNRGVSPDPVEMQHRKSSIVAAKGLLQEVTDMLNKDRSPLCNTRPNAVLDGGIQRHLTHFSLITHGFGAPAMVSAFTVVQSILSEMVKSLDREMSGLTP 247          
BLAST of ap2 vs. Ensembl Cavefish
Match: tfap2a (transcription factor AP-2 alpha [Source:NCBI gene;Acc:103022824])

HSP 1 Score: 291.197 bits (744), Expect = 1.292e-91
Identity = 148/250 (59.20%), Postives = 186/250 (74.40%), Query Frame = 1
Query: 1090 MDDSGFMGSDNQIVYRKGIKLKCENKSYNGI-MNMNG----VHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            ++D G    D  ++ +  + L   N + + I +N +G    V   +++FCSVPGRLSLLSSTSKYKV++ E+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLR+KLDKIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A AEY++R   D P+E   R+  +L TKQ+  E TDLL++DR+PL N+RP  IL+  +Q  LT+FSLI+HGFG+P V AAV  +Q  L E +K  +K
Sbjct:  153 VEDQGIHIPDQTVIKKGPVSLSKNNSNVSAIPINKDGLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEYVNRQHSD-PNEQVQRKNMLLATKQICKEFTDLLSQDRSPLGNSRPQPILEPGIQSCLTHFSLISHGFGTPAVCAAVTALQNYLTEAIKAMDK 401          
BLAST of ap2 vs. Ensembl Cavefish
Match: tfap2a (transcription factor AP-2 alpha [Source:NCBI gene;Acc:103022824])

HSP 1 Score: 290.812 bits (743), Expect = 1.368e-91
Identity = 148/250 (59.20%), Postives = 186/250 (74.40%), Query Frame = 1
Query: 1090 MDDSGFMGSDNQIVYRKGIKLKCENKSYNGI-MNMNG----VHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            ++D G    D  ++ +  + L   N + + I +N +G    V   +++FCSVPGRLSLLSSTSKYKV++ E+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLR+KLDKIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A AEY++R   D P+E   R+  +L TKQ+  E TDLL++DR+PL N+RP  IL+  +Q  LT+FSLI+HGFG+P V AAV  +Q  L E +K  +K
Sbjct:  151 VEDQGIHIPDQTVIKKGPVSLSKNNSNVSAIPINKDGLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEYVNRQHSD-PNEQVQRKNMLLATKQICKEFTDLLSQDRSPLGNSRPQPILEPGIQSCLTHFSLISHGFGTPAVCAAVTALQNYLTEAIKAMDK 399          
BLAST of ap2 vs. Ensembl Cavefish
Match: tfap2a (transcription factor AP-2 alpha [Source:NCBI gene;Acc:103022824])

HSP 1 Score: 291.197 bits (744), Expect = 2.539e-91
Identity = 148/250 (59.20%), Postives = 186/250 (74.40%), Query Frame = 1
Query: 1090 MDDSGFMGSDNQIVYRKGIKLKCENKSYNGI-MNMNG----VHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            ++D G    D  ++ +  + L   N + + I +N +G    V   +++FCSVPGRLSLLSSTSKYKV++ E+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLR+KLDKIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A AEY++R   D P+E   R+  +L TKQ+  E TDLL++DR+PL N+RP  IL+  +Q  LT+FSLI+HGFG+P V AAV  +Q  L E +K  +K
Sbjct:  185 VEDQGIHIPDQTVIKKGPVSLSKNNSNVSAIPINKDGLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEYVNRQHSD-PNEQVQRKNMLLATKQICKEFTDLLSQDRSPLGNSRPQPILEPGIQSCLTHFSLISHGFGTPAVCAAVTALQNYLTEAIKAMDK 433          
BLAST of ap2 vs. Ensembl Cavefish
Match: tfap2a (transcription factor AP-2 alpha [Source:NCBI gene;Acc:103022824])

HSP 1 Score: 290.426 bits (742), Expect = 2.573e-91
Identity = 148/250 (59.20%), Postives = 186/250 (74.40%), Query Frame = 1
Query: 1090 MDDSGFMGSDNQIVYRKGIKLKCENKSYNGI-MNMNG----VHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            ++D G    D  ++ +  + L   N + + I +N +G    V   +++FCSVPGRLSLLSSTSKYKV++ E+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLR+KLDKIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A AEY++R   D P+E   R+  +L TKQ+  E TDLL++DR+PL N+RP  IL+  +Q  LT+FSLI+HGFG+P V AAV  +Q  L E +K  +K
Sbjct:  159 VEDQGIHIPDQTVIKKGPVSLSKNNSNVSAIPINKDGLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEYVNRQHSD-PNEQVQRKNMLLATKQICKEFTDLLSQDRSPLGNSRPQPILEPGIQSCLTHFSLISHGFGTPAVCAAVTALQNYLTEAIKAMDK 407          
BLAST of ap2 vs. Ensembl Cavefish
Match: tfap2a (transcription factor AP-2 alpha [Source:NCBI gene;Acc:103022824])

HSP 1 Score: 290.426 bits (742), Expect = 2.876e-91
Identity = 148/250 (59.20%), Postives = 186/250 (74.40%), Query Frame = 1
Query: 1090 MDDSGFMGSDNQIVYRKGIKLKCENKSYNGI-MNMNG----VHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            ++D G    D  ++ +  + L   N + + I +N +G    V   +++FCSVPGRLSLLSSTSKYKV++ E+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLR+KLDKIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A AEY++R   D P+E   R+  +L TKQ+  E TDLL++DR+PL N+RP  IL+  +Q  LT+FSLI+HGFG+P V AAV  +Q  L E +K  +K
Sbjct:  166 VEDQGIHIPDQTVIKKGPVSLSKNNSNVSAIPINKDGLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEYVNRQHSD-PNEQVQRKNMLLATKQICKEFTDLLSQDRSPLGNSRPQPILEPGIQSCLTHFSLISHGFGTPAVCAAVTALQNYLTEAIKAMDK 414          
BLAST of ap2 vs. Ensembl Sea Lamprey
Match: tfap2d (transcription factor AP-2 delta (activating enhancer binding protein 2 delta) [Source:NCBI gene;Acc:566838])

HSP 1 Score: 246.514 bits (628), Expect = 1.154e-75
Identity = 118/173 (68.21%), Postives = 144/173 (83.24%), Query Frame = 1
Query: 1210 SDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNF 1728
            +D+FCSVPGRLSLLSSTSKYKV+I E++RRLSPPECLNASLLGGILRRAKSKNGGR LR+KLD++GLNLPAGRRKA  VTLLTSLVEGEA+ LARDF Y CE EFP +A  E+L++   + P E ++RR+ IL TKQ+  E  D L++DR+PL ++RP  +LD  +QRHLT+F
Sbjct:  227 TDLFCSVPGRLSLLSSTSKYKVTIAEVKRRLSPPECLNASLLGGILRRAKSKNGGRCLREKLDRLGLNLPAGRRKAANVTLLTSLVEGEALHLARDFGYTCETEFPGKAVGEHLAKQHAE-PKEQQTRRKMILATKQICKEFQDFLSQDRSPLGSSRPTPVLDPEVQRHLTHF 398          
BLAST of ap2 vs. Ensembl Sea Lamprey
Match: tfap2c (transcription factor AP-2 gamma (activating enhancer binding protein 2 gamma) [Source:ZFIN;Acc:ZDB-GENE-041212-61])

HSP 1 Score: 204.142 bits (518), Expect = 2.038e-62
Identity = 102/161 (63.35%), Postives = 123/161 (76.40%), Query Frame = 1
Query: 1342 ILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            +L RAKSKNGGRSLR+KLDKIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF ++CE EFP +A A++L+R   D P +  SR+  +L TKQ+  E  DLL +DR+PL NTRPP IL+  +Q  LT+FSLITHGFGSP + AA+  +Q  LNE LK  +K
Sbjct:    1 VLNRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGFVCETEFPAKAAADFLNRQHSD-PGDLHSRKNMLLATKQICKEFMDLLTQDRSPLGNTRPPPILEPGIQSCLTHFSLITHGFGSPAICAAMTALQNYLNEALKAMDK 160          
BLAST of ap2 vs. Ensembl Nematostella
Match: EDO41881 (Activator protein 2-like protein; Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S318])

HSP 1 Score: 244.202 bits (622), Expect = 3.463e-77
Identity = 127/201 (63.18%), Postives = 148/201 (73.63%), Query Frame = 1
Query: 1210 SDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLK 1812
            SD+FC VPGRLSLLSSTSKYKV++GEI+RRLS PECLNASLLGG+LRRAKSKNGG+ LRDKLDKIGL+LPAGRRKA  VTLLTSLVEGEA  LA DF ++CE+EFP    AEY  R   D P E  SR+  I+  KQL  E+ D+L +D  P     P   L  S  R L  F L+THGFGSP++ AA+N  Q  L+E+LK
Sbjct:    6 SDVFCCVPGRLSLLSSTSKYKVTVGEIRRRLSHPECLNASLLGGVLRRAKSKNGGKCLRDKLDKIGLSLPAGRRKAAQVTLLTSLVEGEAAHLAADFDFVCESEFPASQLAEYQYRQHAD-PAEQGSRKNAIMAAKQLAKELQDILAQDPYPKLRL-PTSSLPESTLRSLNQFGLVTHGFGSPSINAAMNAFQAYLSELLK 204          
BLAST of ap2 vs. Ensembl Medaka
Match: tfap2d (transcription factor AP-2 delta [Source:NCBI gene;Acc:101159790])

HSP 1 Score: 293.508 bits (750), Expect = 3.027e-92
Identity = 141/208 (67.79%), Postives = 173/208 (83.17%), Query Frame = 1
Query: 1210 SDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEKDNN 1833
            +D+FCSVPGRLSLLSSTSKYKV+I E++RRLSPPECLNASLLGGILRRAKSKNGGR LR+KLD++GLNLPAGRRKA  VTLLTSLVEGEA+ LARDF Y CE EFP +A  E+L+R   + P ET +R++ +L TKQ+  E  DLL++DR+PL ++RP  ILD  +QRHLT+FSLITHGFG+P V AA++T Q VL+EML   +K++N
Sbjct:  215 TDLFCSVPGRLSLLSSTSKYKVTIAEVKRRLSPPECLNASLLGGILRRAKSKNGGRCLREKLDRLGLNLPAGRRKAANVTLLTSLVEGEALHLARDFGYTCETEFPSKAVGEHLARQHSE-PKETSARKKMVLATKQICKEFQDLLSQDRSPLGSSRPTPILDLDIQRHLTHFSLITHGFGTPAVCAALSTFQTVLSEMLNYLDKNSN 421          
BLAST of ap2 vs. Ensembl Medaka
Match: tfap2c (transcription factor AP-2 gamma [Source:NCBI gene;Acc:101167699])

HSP 1 Score: 289.271 bits (739), Expect = 8.129e-91
Identity = 148/256 (57.81%), Postives = 184/256 (71.88%), Query Frame = 1
Query: 1084 NAMDDSGFMGSDNQIVYRKGIKLKCENK-----SYNGIMNMNGVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPH----ETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
             ++DD G + +D  ++ +  + L   N          ++ M  V   +++FCSVPGRLSLLSSTSKYKV++ E+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLR+KLDKIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A AEYL R     PH    E  SR+  +L  KQ+  E TDLL +DR+PL N+RP  +L+  +Q  LT+FSLITHGFGSP + AA+ ++Q  LNE +K  +K
Sbjct:  167 QSVDDPGIIMADQTVIKKGPVTLPKGNSLGLPFQKESLLGM--VSNPTEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAIAEYLGR-----PHVERNEVNSRKNMLLAAKQICKEFTDLLTQDRSPLGNSRPAPMLEPGIQGCLTHFSLITHGFGSPAICAAMTSLQNYLNEAIKQVDK 415          
BLAST of ap2 vs. Ensembl Medaka
Match: tfap2a (transcription factor AP-2 alpha [Source:NCBI gene;Acc:101161196])

HSP 1 Score: 288.115 bits (736), Expect = 1.646e-90
Identity = 151/249 (60.64%), Postives = 186/249 (74.70%), Query Frame = 1
Query: 1093 DDSGFMGSDNQIVYRKGIKLKCENKSYNGI-MNMNG----VHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            +D G    D Q V +KG     +N S + I +N +G    V   +++FCSVPGRLSLLSSTSKYKV++ E+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLR+KLDKIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A AEY++R   D P+E   R+  +L TKQ+  E TDLL++DR+PL N+RP  IL+  +Q  LT+FSLI+HGFG+P + AAV  +Q  L E +K  +K
Sbjct:  151 EDQGIHIPD-QTVIKKGPVSLSKNNSVSAIPVNKDGLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEYVNRQHSD-PNEQVQRKNMLLATKQVCKEFTDLLSQDRSPLGNSRPQPILEPGIQSCLTHFSLISHGFGTPALCAAVTALQNYLTEAIKAMDK 397          
BLAST of ap2 vs. Ensembl Medaka
Match: tfap2a (transcription factor AP-2 alpha [Source:NCBI gene;Acc:101161196])

HSP 1 Score: 287.345 bits (734), Expect = 3.516e-90
Identity = 151/249 (60.64%), Postives = 186/249 (74.70%), Query Frame = 1
Query: 1093 DDSGFMGSDNQIVYRKGIKLKCENKSYNGI-MNMNG----VHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            +D G    D Q V +KG     +N S + I +N +G    V   +++FCSVPGRLSLLSSTSKYKV++ E+QRRLSPPECLNASLLGG+LRRAKSKNGGRSLR+KLDKIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP +A AEY++R   D P+E   R+  +L TKQ+  E TDLL++DR+PL N+RP  IL+  +Q  LT+FSLI+HGFG+P + AAV  +Q  L E +K  +K
Sbjct:  159 EDQGIHIPD-QTVIKKGPVSLSKNNSVSAIPVNKDGLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEYVNRQHSD-PNEQVQRKNMLLATKQVCKEFTDLLSQDRSPLGNSRPQPILEPGIQSCLTHFSLISHGFGTPALCAAVTALQNYLTEAIKAMDK 405          
BLAST of ap2 vs. Ensembl Medaka
Match: tfap2e (transcription factor AP-2 epsilon [Source:NCBI gene;Acc:101169125])

HSP 1 Score: 287.345 bits (734), Expect = 3.970e-90
Identity = 166/382 (43.46%), Postives = 228/382 (59.69%), Query Frame = 1
Query:  721 NSVDFGSHAAAAYAVHYPNPIFQQAFASTHPSHYSGFHMMTSRHHNDALMNSGHYDLRAAVGMGDP---YSSGMRAGDLLGNCG-----GPVGLMDANHIDTSNNAVDFQNVIGIHNSTQLGMLADDGHNAMDDSGFMGSDNQIVYRKGIKLKCENKSYNGI------MNMNGVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEK 1824
            +S+ +     +AY+ H P+P    +  S H    + +H   SR  + AL+   H  L       DP   YS+  R    LG        GP+G+   +H          +++ G+   + LG+L                D+ ++ +  +  K    S + +      + M  V   +++FCSVPGRLSLLSS SKYKV++GE+QRRLSPPECLNASLLGG+LRRAKSKNGGR LR++L+KIGLNLPAGRRKA  VTLLTSLVEGEAV LARDF Y+CE EFP RA AEYL R  Q  P + ++RR  +L TK++  E  DL+++DR+PL  +RP   L+  +Q  LT+FSL+THGFG+P + AA++  Q  L E +K+ +K
Sbjct:   65 SSLPYSQSQDSAYS-HLPDPY--SSINSLHQHQQAAWHSQRSRSEDGALLAQSHRALSL-----DPRREYSAVPRLLHGLGEGAAALGEGPLGMHLGHH--------GLEDLQGMEEGSALGIL----------------DHSVIKKVPLPSKLNGSSLSALSIGKEGLGMGAVSNPAEVFCSVPGRLSLLSSNSKYKVTVGEVQRRLSPPECLNASLLGGVLRRAKSKNGGRCLRERLEKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPARATAEYLCR--QSDPDQLQTRRSMLLATKEVCKEFVDLMSQDRSPLGGSRPTPCLEPGVQGSLTHFSLLTHGFGTPAICAALSAFQSYLMEAIKMLDK 412          
BLAST of ap2 vs. Planmine SMEST
Match: SMESG000022356.1 (SMESG000022356.1)

HSP 1 Score: 1164.06 bits (3010), Expect = 0.000e+0
Identity = 562/562 (100.00%), Postives = 562/562 (100.00%), Query Frame = 1
Query:  160 MGDRINSIIAPQEISRQLYSHPDDYHHQSNYHSELNIENDSRLDEGFFGSRISNNTGSEAETNCKSEATNNSNDDHSLINENLLPGNKLEKLDQFSSYRTSIVNNFISSLGQSEFGRPCHLLYDDRKLNALGMNNSTSSSFVSNPTGLIGAMSNSPTVNRFSLSQPHPISNNEPPFYPPPHNIQSSINSVDFGSHAAAAYAVHYPNPIFQQAFASTHPSHYSGFHMMTSRHHNDALMNSGHYDLRAAVGMGDPYSSGMRAGDLLGNCGGPVGLMDANHIDTSNNAVDFQNVIGIHNSTQLGMLADDGHNAMDDSGFMGSDNQIVYRKGIKLKCENKSYNGIMNMNGVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEKDNNTISP 1845
            MGDRINSIIAPQEISRQLYSHPDDYHHQSNYHSELNIENDSRLDEGFFGSRISNNTGSEAETNCKSEATNNSNDDHSLINENLLPGNKLEKLDQFSSYRTSIVNNFISSLGQSEFGRPCHLLYDDRKLNALGMNNSTSSSFVSNPTGLIGAMSNSPTVNRFSLSQPHPISNNEPPFYPPPHNIQSSINSVDFGSHAAAAYAVHYPNPIFQQAFASTHPSHYSGFHMMTSRHHNDALMNSGHYDLRAAVGMGDPYSSGMRAGDLLGNCGGPVGLMDANHIDTSNNAVDFQNVIGIHNSTQLGMLADDGHNAMDDSGFMGSDNQIVYRKGIKLKCENKSYNGIMNMNGVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEKDNNTISP
Sbjct:    1 MGDRINSIIAPQEISRQLYSHPDDYHHQSNYHSELNIENDSRLDEGFFGSRISNNTGSEAETNCKSEATNNSNDDHSLINENLLPGNKLEKLDQFSSYRTSIVNNFISSLGQSEFGRPCHLLYDDRKLNALGMNNSTSSSFVSNPTGLIGAMSNSPTVNRFSLSQPHPISNNEPPFYPPPHNIQSSINSVDFGSHAAAAYAVHYPNPIFQQAFASTHPSHYSGFHMMTSRHHNDALMNSGHYDLRAAVGMGDPYSSGMRAGDLLGNCGGPVGLMDANHIDTSNNAVDFQNVIGIHNSTQLGMLADDGHNAMDDSGFMGSDNQIVYRKGIKLKCENKSYNGIMNMNGVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEKDNNTISP 562          
BLAST of ap2 vs. Planmine SMEST
Match: SMESG000022356.1 (SMESG000022356.1)

HSP 1 Score: 910.983 bits (2353), Expect = 0.000e+0
Identity = 438/438 (100.00%), Postives = 438/438 (100.00%), Query Frame = 1
Query:  532 DRKLNALGMNNSTSSSFVSNPTGLIGAMSNSPTVNRFSLSQPHPISNNEPPFYPPPHNIQSSINSVDFGSHAAAAYAVHYPNPIFQQAFASTHPSHYSGFHMMTSRHHNDALMNSGHYDLRAAVGMGDPYSSGMRAGDLLGNCGGPVGLMDANHIDTSNNAVDFQNVIGIHNSTQLGMLADDGHNAMDDSGFMGSDNQIVYRKGIKLKCENKSYNGIMNMNGVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEKDNNTISP 1845
            DRKLNALGMNNSTSSSFVSNPTGLIGAMSNSPTVNRFSLSQPHPISNNEPPFYPPPHNIQSSINSVDFGSHAAAAYAVHYPNPIFQQAFASTHPSHYSGFHMMTSRHHNDALMNSGHYDLRAAVGMGDPYSSGMRAGDLLGNCGGPVGLMDANHIDTSNNAVDFQNVIGIHNSTQLGMLADDGHNAMDDSGFMGSDNQIVYRKGIKLKCENKSYNGIMNMNGVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEKDNNTISP
Sbjct:   32 DRKLNALGMNNSTSSSFVSNPTGLIGAMSNSPTVNRFSLSQPHPISNNEPPFYPPPHNIQSSINSVDFGSHAAAAYAVHYPNPIFQQAFASTHPSHYSGFHMMTSRHHNDALMNSGHYDLRAAVGMGDPYSSGMRAGDLLGNCGGPVGLMDANHIDTSNNAVDFQNVIGIHNSTQLGMLADDGHNAMDDSGFMGSDNQIVYRKGIKLKCENKSYNGIMNMNGVHKYSDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAKSKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYLCENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDRAPLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEMLKVFEKDNNTISP 469          
The following BLAST results are available for this feature:
BLAST of ap2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TFAP2D5.896e-9067.80transcription factor AP-2 delta [Source:HGNC Symbo... [more]
TFAP2B1.113e-8950.93transcription factor AP-2 beta [Source:HGNC Symbol... [more]
TFAP2E2.833e-8758.00transcription factor AP-2 epsilon [Source:HGNC Sym... [more]
TFAP2C7.604e-8544.59transcription factor AP-2 gamma [Source:HGNC Symbo... [more]
TFAP2A1.032e-8445.65transcription factor AP-2 alpha [Source:HGNC Symbo... [more]
back to top
BLAST of ap2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aptf-14.241e-6148.06Transcription factor aptf-1 [Source:UniProtKB/Swi... [more]
aptf-42.628e-1226.37AP-2 Transcription Factor family [Source:UniProtK... [more]
aptf-31.488e-1126.67AP-2 Transcription Factor family [Source:UniProtK... [more]
aptf-21.280e-1027.03AP-2 Transcription Factor family [Source:UniProtK... [more]
aptf-21.310e-1027.03AP-2 Transcription Factor family [Source:UniProtK... [more]
back to top
BLAST of ap2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TfAP-25.842e-8657.09gene:FBgn0261953 transcript:FBtr0333465[more]
TfAP-28.372e-8657.09gene:FBgn0261953 transcript:FBtr0333468[more]
TfAP-28.767e-8657.09gene:FBgn0261953 transcript:FBtr0078419[more]
TfAP-28.921e-8657.09gene:FBgn0261953 transcript:FBtr0078418[more]
TfAP-21.006e-8557.09gene:FBgn0261953 transcript:FBtr0333467[more]
back to top
BLAST of ap2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tfap2a6.754e-9158.40transcription factor AP-2 alpha [Source:ZFIN;Acc:Z... [more]
tfap2a7.368e-9158.40transcription factor AP-2 alpha [Source:ZFIN;Acc:Z... [more]
tfap2a9.146e-9158.40transcription factor AP-2 alpha [Source:ZFIN;Acc:Z... [more]
tfap2e1.565e-9043.48transcription factor AP-2 epsilon [Source:NCBI gen... [more]
tfap2a1.649e-9058.40transcription factor AP-2 alpha [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of ap2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
b4galnt14.922e-9060.74beta-1,4-N-acetyl-galactosaminyl transferase 1 [So... [more]
tfap2e5.782e-9058.50transcription factor AP-2 epsilon [Source:NCBI gen... [more]
b4galnt14.074e-8964.68beta-1,4-N-acetyl-galactosaminyl transferase 1 [So... [more]
mat2a1.291e-8867.65methionine adenosyltransferase II, alpha [Source:X... [more]
mat2a1.760e-8867.65methionine adenosyltransferase II, alpha [Source:X... [more]
back to top
BLAST of ap2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tfap2a1.624e-9158.96transcription factor AP-2, alpha [Source:MGI Symbo... [more]
Tfap2a1.631e-9158.96transcription factor AP-2, alpha [Source:MGI Symbo... [more]
Tfap2a2.768e-9158.96transcription factor AP-2, alpha [Source:MGI Symbo... [more]
Tfap2a3.301e-9158.96transcription factor AP-2, alpha [Source:MGI Symbo... [more]
Tfap2a3.301e-9158.96transcription factor AP-2, alpha [Source:MGI Symbo... [more]
back to top
BLAST of ap2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A1A4R9|AP2A_BOVIN2.247e-9058.96Transcription factor AP-2-alpha OS=Bos taurus OX=9... [more]
sp|P34056|AP2A_MOUSE8.582e-9058.96Transcription factor AP-2-alpha OS=Mus musculus OX... [more]
sp|Q6VUP9|AP2E_MOUSE1.458e-8958.80Transcription factor AP-2-epsilon OS=Mus musculus ... [more]
sp|Q9N0N3|AP2A_SHEEP2.572e-8958.96Transcription factor AP-2-alpha OS=Ovis aries OX=9... [more]
sp|Q7Z6R9|AP2D_HUMAN2.831e-8967.80Transcription factor AP-2-delta OS=Homo sapiens OX... [more]
back to top
BLAST of ap2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZI590.000e+099.77Ap2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
K1P2V76.445e-10958.10Transcription factor AP-2 alpha OS=Crassostrea gig... [more]
A0A210QC865.780e-10555.33Transcription factor AP-2-epsilon OS=Mizuhopecten ... [more]
A0A1S3JCV31.827e-10459.42transcription factor AP-2-epsilon isoform X2 OS=Li... [more]
A0A1I8I6014.829e-10470.05TF_AP-2 domain-containing protein OS=Macrostomum l... [more]
back to top
BLAST of ap2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tfap2a1.292e-9159.20transcription factor AP-2 alpha [Source:NCBI gene;... [more]
tfap2a1.368e-9159.20transcription factor AP-2 alpha [Source:NCBI gene;... [more]
tfap2a2.539e-9159.20transcription factor AP-2 alpha [Source:NCBI gene;... [more]
tfap2a2.573e-9159.20transcription factor AP-2 alpha [Source:NCBI gene;... [more]
tfap2a2.876e-9159.20transcription factor AP-2 alpha [Source:NCBI gene;... [more]
back to top
BLAST of ap2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tfap2d1.154e-7568.21transcription factor AP-2 delta (activating enhanc... [more]
tfap2c2.038e-6263.35transcription factor AP-2 gamma (activating enhanc... [more]
back to top
BLAST of ap2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ap2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO418813.463e-7763.18Activator protein 2-like protein; Predicted protei... [more]
back to top
BLAST of ap2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tfap2d3.027e-9267.79transcription factor AP-2 delta [Source:NCBI gene;... [more]
tfap2c8.129e-9157.81transcription factor AP-2 gamma [Source:NCBI gene;... [more]
tfap2a1.646e-9060.64transcription factor AP-2 alpha [Source:NCBI gene;... [more]
tfap2a3.516e-9060.64transcription factor AP-2 alpha [Source:NCBI gene;... [more]
tfap2e3.970e-9043.46transcription factor AP-2 epsilon [Source:NCBI gen... [more]
back to top
BLAST of ap2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000022356.10.000e+0100.00SMESG000022356.1[more]
SMESG000022356.10.000e+0100.00SMESG000022356.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30020522
GenBankAFJ24713.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020522 ID=SMED30020522|Name=ap2|organism=Schmidtea mediterranea sexual|type=transcript|length=1932bp
TTAACGAAGAAATATAAACACACACGCATTTTCCAATAGCAAATAGCATG
TTATTTTGGGTTGAACAGTTTTTTTTATTTTGACTTAAAAGGCACTTCGG
GCATTTTTCTTCATTATCTTCAACATCTCAGAAAATTTAGCCTGGAGCAA
CAATACAACATGGGAGATAGAATAAATTCCATAATTGCACCACAAGAAAT
CAGTCGACAACTGTATTCCCATCCAGATGATTACCATCACCAATCCAACT
ATCATTCTGAATTAAATATTGAAAACGATTCAAGACTTGATGAAGGTTTT
TTTGGATCCCGAATTTCCAATAATACAGGCAGTGAGGCTGAAACGAATTG
TAAAAGTGAAGCGACGAATAATTCCAATGATGATCATTCTTTGATCAATG
AAAATTTATTGCCTGGGAATAAACTTGAAAAATTAGATCAGTTTTCCAGT
TATCGAACATCAATTGTAAATAATTTTATATCTTCTCTGGGACAATCTGA
ATTTGGGAGACCGTGTCATTTATTATATGATGATCGAAAATTAAATGCAT
TAGGAATGAACAATTCAACTTCGAGTTCGTTTGTATCCAACCCAACTGGA
TTGATCGGAGCCATGTCAAATTCACCAACAGTTAATCGTTTCAGTCTCAG
TCAACCTCATCCAATTTCGAATAATGAACCCCCTTTTTATCCTCCTCCAC
ATAATATTCAATCCTCAATAAACAGTGTAGATTTCGGTAGTCATGCCGCT
GCCGCTTACGCAGTTCACTATCCAAATCCCATTTTTCAACAGGCTTTCGC
ATCGACACATCCATCACATTATTCCGGTTTCCATATGATGACCAGTAGAC
ATCATAACGATGCGTTGATGAATTCTGGTCATTATGATTTGCGAGCAGCG
GTTGGAATGGGTGATCCCTATTCATCTGGAATGCGAGCTGGAGATTTGTT
GGGCAATTGTGGAGGGCCTGTTGGACTTATGGATGCAAACCACATCGATA
CTTCAAACAATGCGGTTGATTTTCAAAATGTAATTGGTATTCATAATTCT
ACACAATTAGGAATGTTGGCAGACGATGGACATAACGCCATGGACGATTC
TGGATTCATGGGCTCCGATAATCAGATTGTTTATAGAAAAGGCATCAAAC
TAAAATGTGAAAATAAATCTTATAATGGAATAATGAATATGAATGGAGTT
CATAAATATTCTGATATGTTTTGTTCGGTGCCCGGTCGGTTGTCATTGTT
GAGTTCAACATCAAAATACAAAGTTTCAATTGGAGAAATTCAACGACGTT
TATCACCCCCAGAATGCTTAAATGCATCCTTATTAGGAGGAATTTTGCGA
AGAGCAAAATCTAAAAATGGGGGAAGATCATTAAGAGATAAATTAGACAA
AATCGGACTCAATCTACCAGCTGGTCGACGAAAAGCGACTGCTGTCACAT
TGCTCACATCTTTAGTCGAAGGTGAAGCTGTGAGATTGGCTCGTGACTTC
ACATATCTATGTGAAAATGAATTTCCCCATCGAGCATGTGCTGAATATCT
TTCGAGAAATATCCAAGACATTCCCCATGAAACCAAATCCAGAAGACAAC
AAATTCTATGTACAAAACAACTGCTTGCTGAAATCACAGATTTACTCAAC
AAGGATCGGGCACCGTTATGCAATACCAGACCGCCGATTATACTTGATTC
GTCAATGCAAAGACATTTGACAAATTTCAGTCTCATCACTCATGGTTTCG
GTTCACCGACAGTTGTTGCAGCGGTCAATACCATTCAAGGCGTTCTAAAT
GAAATGCTCAAGGTATTCGAGAAAGACAACAATACCATTTCACCGCAGAA
TAAAATTCAAAACAAATCTCAAAATTTAAACAATAATAACAACAGTAATA
ATAACAACAATAATAAAGACTCGAAATGATTT
back to top

protein sequence of SMED30020522-orf-1

>SMED30020522-orf-1 ID=SMED30020522-orf-1|Name=SMED30020522-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=590bp
MGDRINSIIAPQEISRQLYSHPDDYHHQSNYHSELNIENDSRLDEGFFGS
RISNNTGSEAETNCKSEATNNSNDDHSLINENLLPGNKLEKLDQFSSYRT
SIVNNFISSLGQSEFGRPCHLLYDDRKLNALGMNNSTSSSFVSNPTGLIG
AMSNSPTVNRFSLSQPHPISNNEPPFYPPPHNIQSSINSVDFGSHAAAAY
AVHYPNPIFQQAFASTHPSHYSGFHMMTSRHHNDALMNSGHYDLRAAVGM
GDPYSSGMRAGDLLGNCGGPVGLMDANHIDTSNNAVDFQNVIGIHNSTQL
GMLADDGHNAMDDSGFMGSDNQIVYRKGIKLKCENKSYNGIMNMNGVHKY
SDMFCSVPGRLSLLSSTSKYKVSIGEIQRRLSPPECLNASLLGGILRRAK
SKNGGRSLRDKLDKIGLNLPAGRRKATAVTLLTSLVEGEAVRLARDFTYL
CENEFPHRACAEYLSRNIQDIPHETKSRRQQILCTKQLLAEITDLLNKDR
APLCNTRPPIILDSSMQRHLTNFSLITHGFGSPTVVAAVNTIQGVLNEML
KVFEKDNNTISPQNKIQNKSQNLNNNNNSNNNNNNKDSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000044cephalic ganglia
PLANA:0000097ventral nerve cord
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0000418head
PLANA:0000478pharynx musculature
Vocabulary: INTERPRO
TermDefinition
IPR004979TF_AP2
IPR013854TF_AP2_C
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013854Transcription factor AP-2, C-terminalPRINTSPR01748AP2TNSCPFCTcoord: 407..422
score: 88.44
coord: 423..437
score: 85.33
coord: 392..406
score: 93.0
IPR013854Transcription factor AP-2, C-terminalPFAMPF03299TF_AP-2coord: 354..549
e-value: 1.5E-77
score: 260.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 565..589
NoneNo IPR availablePANTHERPTHR10812:SF13TRANSCRIPTION FACTOR AP-2-EPSILONcoord: 160..564
IPR004979Transcription factor AP-2PANTHERPTHR10812TRANSCRIPTION FACTOR AP-2coord: 160..564