Glycerol-3-phosphate acyltransferase 3

Overview
NameGlycerol-3-phosphate acyltransferase 3
Smed IDSMED30020521
Length (bp)1717
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glycerol-3-phosphate acyltransferase 3 (SMED30020521) t-SNE clustered cells

Violin plots show distribution of expression levels for Glycerol-3-phosphate acyltransferase 3 (SMED30020521) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glycerol-3-phosphate acyltransferase 3 (SMED30020521) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glycerol-3-phosphate acyltransferase 3 (SMED30020521) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020521

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30020521SMESG000014290.1 Contig3816GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30020521SMESG000061821.1 Contig3816GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30020521SMESG000061821.1 dd_Smed_v4_2445_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30020521SMESG000061821.1 dd_Smed_v4_2445_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020521SMESG000061821.1 dd_Smed_v4_2445_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020521SMESG000061821.1 dd_Smed_v4_2445_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020521SMESG000014290.1 Contig3816GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020521SMESG000061821.1 Contig3816GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30020521SMESG000061821.1 dd_Smed_v4_2445_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Human
Match: GPAT4 (glycerol-3-phosphate acyltransferase 4 [Source:HGNC Symbol;Acc:HGNC:20880])

HSP 1 Score: 396.741 bits (1018), Expect = 7.650e-133
Identity = 207/424 (48.82%), Postives = 289/424 (68.16%), Query Frame = 1
Query:  115 LVGGIVGVLTGYRFIEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRT-HSYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            +V  I GV  G R   +LY+K LLK+FA+A  T+      + K   + +  + G   +D  ++  +++  +   +   +   D   +F L+D  YF + G+E I++D+VTKRFS+ E+E WNLLSRT +++Q+I+ +LT+LW +G   RY  LLP R+    T IS LV  + +V  LP  + K+F +  V  + +R+ VRA + +I +H++EN+ ++GGICVANHT+PIDVI+L  D  YAMVGQ  GG  G++Q+   +A   +WFERSE +DR  V KRL +H+++   LPILIFPEGTCINNTSVMMFKKGSFE+G T+YPVA+KYD +F D FWNSSKY ++ YL  MM+SWAIV  VWYLPP  ++  E+A++FANRVK  IA+QGGLVD+ WDGGLKR   KD+ K+ QQK +SK I
Sbjct:   31 IVPAIFGVSFGIR---KLYMKSLLKIFAWA--TLRMERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIR---RSGSSKALDNTPEFELSDIFYFCRKGMETIMDDEVTKRFSAEELESWNLLSRTNYNFQYISLRLTVLWGLGVLIRYCFLLPLRIALAFTGISLLVVGTTVVGYLPNGRFKEFMSKHVHLMCYRICVRALTAIITYHDRENRPRNGGICVANHTSPIDVIILASDGYYAMVGQVHGGLMGVIQRAMVKACPHVWFERSEVKDRHLVAKRLTEHVQDKSKLPILIFPEGTCINNTSVMMFKKGSFEIGATVYPVAIKYDPQFGDAFWNSSKYGMVTYLLRMMTSWAIVCSVWYLPPMTREADEDAVQFANRVKSAIARQGGLVDLLWDGGLKREKVKDTFKEEQQKLYSKMI 446          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Human
Match: GPAT3 (glycerol-3-phosphate acyltransferase 3 [Source:HGNC Symbol;Acc:HGNC:28157])

HSP 1 Score: 394.815 bits (1013), Expect = 1.990e-132
Identity = 210/430 (48.84%), Postives = 289/430 (67.21%), Query Frame = 1
Query:   97 FILFTNLVGGIVGVLTGYRFIEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTH-SYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            FIL  ++ G  +G       I E+Y+K+L+K   +A+  +   E+   K   +K S S+G   RD   + + +     G++            F L+D  YF K G+EAI+ED+VT+RFSS E+  WNLL+RT+ ++Q+I+ +LT++WV+G   RY +LLP R+      IS LV  + LV  LP+   K + + +V     R+ VRA SG I +HNK+ + + GGICVANHT+PIDV++L  D  YAMVGQ  GG  G++Q+   +A   +WFERSE +DR  VTKRL++HI +   LPILIFPEGTCINNTSVMMFKKGSFE+GGTI+PVA+KY+ +F D FWNSSKY+++ YL  MM+SWAIV DVWY+PP  ++E E+A++FANRVK  IA QGGL ++ WDGGLKR+  KD  K+ QQK++SK I
Sbjct:   21 FILLPSVFGVSLG-------ISEIYMKILVKTLEWATIRI---EKGTPKESILKNSASVGIIQRDESPMEKGL----SGLR---------GRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEELVSWNLLTRTNVNFQYISLRLTMVWVLGVIVRYCVLLPLRVTLAFIGISLLVIGTTLVGQLPDSSLKNWLSELVHLTCCRICVRALSGTIHYHNKQYRPQKGGICVANHTSPIDVLILTTDGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEMKDRHLVTKRLKEHIADKKKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIHPVAIKYNPQFGDAFWNSSKYNMVSYLLRMMTSWAIVCDVWYMPPMTREEGEDAVQFANRVKSAIAIQGGLTELPWDGGLKRAKVKDIFKEEQQKNYSKMI 427          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Human
Match: GPAT3 (glycerol-3-phosphate acyltransferase 3 [Source:HGNC Symbol;Acc:HGNC:28157])

HSP 1 Score: 394.815 bits (1013), Expect = 1.990e-132
Identity = 210/430 (48.84%), Postives = 289/430 (67.21%), Query Frame = 1
Query:   97 FILFTNLVGGIVGVLTGYRFIEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTH-SYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            FIL  ++ G  +G       I E+Y+K+L+K   +A+  +   E+   K   +K S S+G   RD   + + +     G++            F L+D  YF K G+EAI+ED+VT+RFSS E+  WNLL+RT+ ++Q+I+ +LT++WV+G   RY +LLP R+      IS LV  + LV  LP+   K + + +V     R+ VRA SG I +HNK+ + + GGICVANHT+PIDV++L  D  YAMVGQ  GG  G++Q+   +A   +WFERSE +DR  VTKRL++HI +   LPILIFPEGTCINNTSVMMFKKGSFE+GGTI+PVA+KY+ +F D FWNSSKY+++ YL  MM+SWAIV DVWY+PP  ++E E+A++FANRVK  IA QGGL ++ WDGGLKR+  KD  K+ QQK++SK I
Sbjct:   21 FILLPSVFGVSLG-------ISEIYMKILVKTLEWATIRI---EKGTPKESILKNSASVGIIQRDESPMEKGL----SGLR---------GRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEELVSWNLLTRTNVNFQYISLRLTMVWVLGVIVRYCVLLPLRVTLAFIGISLLVIGTTLVGQLPDSSLKNWLSELVHLTCCRICVRALSGTIHYHNKQYRPQKGGICVANHTSPIDVLILTTDGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEMKDRHLVTKRLKEHIADKKKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIHPVAIKYNPQFGDAFWNSSKYNMVSYLLRMMTSWAIVCDVWYMPPMTREEGEDAVQFANRVKSAIAIQGGLTELPWDGGLKRAKVKDIFKEEQQKNYSKMI 427          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Human
Match: GPAT3 (glycerol-3-phosphate acyltransferase 3 [Source:HGNC Symbol;Acc:HGNC:28157])

HSP 1 Score: 394.815 bits (1013), Expect = 1.990e-132
Identity = 210/430 (48.84%), Postives = 289/430 (67.21%), Query Frame = 1
Query:   97 FILFTNLVGGIVGVLTGYRFIEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTH-SYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            FIL  ++ G  +G       I E+Y+K+L+K   +A+  +   E+   K   +K S S+G   RD   + + +     G++            F L+D  YF K G+EAI+ED+VT+RFSS E+  WNLL+RT+ ++Q+I+ +LT++WV+G   RY +LLP R+      IS LV  + LV  LP+   K + + +V     R+ VRA SG I +HNK+ + + GGICVANHT+PIDV++L  D  YAMVGQ  GG  G++Q+   +A   +WFERSE +DR  VTKRL++HI +   LPILIFPEGTCINNTSVMMFKKGSFE+GGTI+PVA+KY+ +F D FWNSSKY+++ YL  MM+SWAIV DVWY+PP  ++E E+A++FANRVK  IA QGGL ++ WDGGLKR+  KD  K+ QQK++SK I
Sbjct:   21 FILLPSVFGVSLG-------ISEIYMKILVKTLEWATIRI---EKGTPKESILKNSASVGIIQRDESPMEKGL----SGLR---------GRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEELVSWNLLTRTNVNFQYISLRLTMVWVLGVIVRYCVLLPLRVTLAFIGISLLVIGTTLVGQLPDSSLKNWLSELVHLTCCRICVRALSGTIHYHNKQYRPQKGGICVANHTSPIDVLILTTDGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEMKDRHLVTKRLKEHIADKKKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIHPVAIKYNPQFGDAFWNSSKYNMVSYLLRMMTSWAIVCDVWYMPPMTREEGEDAVQFANRVKSAIAIQGGLTELPWDGGLKRAKVKDIFKEEQQKNYSKMI 427          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Human
Match: GPAT4 (glycerol-3-phosphate acyltransferase 4 [Source:HGNC Symbol;Acc:HGNC:20880])

HSP 1 Score: 98.5969 bits (244), Expect = 1.571e-23
Identity = 58/161 (36.02%), Postives = 95/161 (59.01%), Query Frame = 1
Query:  172 IKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVR-LDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRT-HSYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLP 648
            +K LLK+FA+A  T+      + K   + +  + G   +D  ++  +++ + + G     +   D   +F L+D  YF + G+E I++D+VTKRFS+ E+E WNLLSRT +++Q+I+ +LT+LW +G   RY  LLP R+    T IS LV  + +V  LP
Sbjct:    1 MKSLLKIFAWA--TLRMERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIRRSG----SSKALDNTPEFELSDIFYFCRKGMETIMDDEVTKRFSAEELESWNLLSRTNYNFQYISLRLTVLWGLGVLIRYCFLLPLRIALAFTGISLLVVGTTVVGYLP 155          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Celegans
Match: acl-5 (ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc:Q21812])

HSP 1 Score: 370.933 bits (951), Expect = 3.109e-123
Identity = 183/336 (54.46%), Postives = 240/336 (71.43%), Query Frame = 1
Query:  400 FVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRT-HSYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQK-SFSKFIKTSE*N 1398
            F+ +G+EA+IED VT RFS+ ++  WNLLSRT +S+   N QLT+LW+ GF  RY +L+PCR+  F  AI  ++ S+ ++ L+P  + +KF N     +  R++ RA+S VIRFH+KEN+A  GGICVANHT+PIDV+VL CDN YAM+GQKQ GF G +Q    R+   IWFER E  DR  V  R+R+H+ +   LPI+IFPEGTCINNTSVMMFKKGSFE+G TIYP+AVKYD+R  D FWNSS  S   YL+ MM+SWAI+ DVWYLP   + E+E++I FA RVKR IA++GGL+D++WDG LKR      L  +QQK  F +  +T+  N
Sbjct:   57 FITAGMEAVIEDQVTNRFSAAQLPSWNLLSRTKYSFHFFNWQLTLLWIAGFMFRYYVLVPCRIALFGIAIVLMIVSTSIIGLVPNAKVRKFLNRRCMLMCMRIYSRAFSSVIRFHDKENRANKGGICVANHTSPIDVMVLSCDNCYAMIGQKQAGFLGFLQTTLSRSEHHIWFERGEAGDRAKVMDRMREHVNDENKLPIIIFPEGTCINNTSVMMFKKGSFEIGSTIYPIAVKYDTRLTDAFWNSSAQSYGRYLWSMMTSWAIICDVWYLPAMTRGENEDSISFAKRVKRAIAKKGGLIDLEWDGALKRERVSSKLVTLQQKLYFERLARTTTLN 392          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Celegans
Match: acl-5 (ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc:Q21812])

HSP 1 Score: 371.703 bits (953), Expect = 1.030e-122
Identity = 205/444 (46.17%), Postives = 280/444 (63.06%), Query Frame = 1
Query:  124 GIVGVLTGYRFIEELYIKLLLKVFAYASSTVSENEQI-------------ETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRDANN---KFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRT-HSYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQK-SFSKFIKTSE*N 1398
             + G   G R   E Y+  L+ +F + ++    NEQ              + + K  +RS S      D+  INR+ + D    K ++  + +A        + D   F+ +G+EA+IED VT RFS+ ++  WNLLSRT +S+   N QLT+LW+ GF  RY +L+PCR+  F  AI  ++ S+ ++ L+P  + +KF N     +  R++ RA+S VIRFH+KEN+A  GGICVANHT+PIDV+VL CDN YAM+GQKQ GF G +Q    R+   IWFER E  DR  V  R+R+H+ +   LPI+IFPEGTCINNTSVMMFKKGSFE+G TIYP+AVKYD+R  D FWNSS  S   YL+ MM+SWAI+ DVWYLP   + E+E++I FA RVKR IA++GGL+D++WDG LKR      L  +QQK  F +  +T+  N
Sbjct:   17 AVTGKTLGLR---EYYVNTLVYIFEWGATL---NEQYEEEEGSVEEDMPEDFQHKKPRRSSSAS----DLGIINRE-KSDIIDAKLHETNVPEAKQTTVSVLVDDTLDFITAGMEAVIEDQVTNRFSAAQLPSWNLLSRTKYSFHFFNWQLTLLWIAGFMFRYYVLVPCRIALFGIAIVLMIVSTSIIGLVPNAKVRKFLNRRCMLMCMRIYSRAFSSVIRFHDKENRANKGGICVANHTSPIDVMVLSCDNCYAMIGQKQAGFLGFLQTTLSRSEHHIWFERGEAGDRAKVMDRMREHVNDENKLPIIIFPEGTCINNTSVMMFKKGSFEIGSTIYPIAVKYDTRLTDAFWNSSAQSYGRYLWSMMTSWAIICDVWYLPAMTRGENEDSISFAKRVKRAIAKKGGLIDLEWDGALKRERVSSKLVTLQQKLYFERLARTTTLN 449          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Celegans
Match: acl-5 (ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc:Q21812])

HSP 1 Score: 371.703 bits (953), Expect = 1.030e-122
Identity = 205/444 (46.17%), Postives = 280/444 (63.06%), Query Frame = 1
Query:  124 GIVGVLTGYRFIEELYIKLLLKVFAYASSTVSENEQI-------------ETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRDANN---KFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRT-HSYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQK-SFSKFIKTSE*N 1398
             + G   G R   E Y+  L+ +F + ++    NEQ              + + K  +RS S      D+  INR+ + D    K ++  + +A        + D   F+ +G+EA+IED VT RFS+ ++  WNLLSRT +S+   N QLT+LW+ GF  RY +L+PCR+  F  AI  ++ S+ ++ L+P  + +KF N     +  R++ RA+S VIRFH+KEN+A  GGICVANHT+PIDV+VL CDN YAM+GQKQ GF G +Q    R+   IWFER E  DR  V  R+R+H+ +   LPI+IFPEGTCINNTSVMMFKKGSFE+G TIYP+AVKYD+R  D FWNSS  S   YL+ MM+SWAI+ DVWYLP   + E+E++I FA RVKR IA++GGL+D++WDG LKR      L  +QQK  F +  +T+  N
Sbjct:   17 AVTGKTLGLR---EYYVNTLVYIFEWGATL---NEQYEEEEGSVEEDMPEDFQHKKPRRSSSAS----DLGIINRE-KSDIIDAKLHETNVPEAKQTTVSVLVDDTLDFITAGMEAVIEDQVTNRFSAAQLPSWNLLSRTKYSFHFFNWQLTLLWIAGFMFRYYVLVPCRIALFGIAIVLMIVSTSIIGLVPNAKVRKFLNRRCMLMCMRIYSRAFSSVIRFHDKENRANKGGICVANHTSPIDVMVLSCDNCYAMIGQKQAGFLGFLQTTLSRSEHHIWFERGEAGDRAKVMDRMREHVNDENKLPIIIFPEGTCINNTSVMMFKKGSFEIGSTIYPIAVKYDTRLTDAFWNSSAQSYGRYLWSMMTSWAIICDVWYLPAMTRGENEDSISFAKRVKRAIAKKGGLIDLEWDGALKRERVSSKLVTLQQKLYFERLARTTTLN 449          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Celegans
Match: acl-4 (ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc:Q9N5S9])

HSP 1 Score: 352.058 bits (902), Expect = 8.368e-114
Identity = 173/342 (50.58%), Postives = 242/342 (70.76%), Query Frame = 1
Query:  388 DPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTHS--YQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKK-FNAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRS-VPKDSLKQVQQK---SFSKFIKTSE 1392
            D   FVK+G+EAIIED+VT RF + ++  WN+L+RT    YQ +N +L+ LW++GF  RY ++LP R   F   +  L+ S+ L+ L+P    KK  N     + +R+  R+ + V+ FH++  KA++ GICVANHT+PID ++L  DN YA++GQK  G  G++Q+   RA+S IWFERSE +DR  V ++L++H   P  LPILIFPEGTCINNTSVMMFKKGSFE+G TIYP+A+KYDSRF D FWNSS+ S   Y+  MM+SWAI+ +VWYLPP  +++ E+A++FANRVK+ IA +GGLVD++WDGGLKR+ VP   + + Q++     S++   SE
Sbjct:  202 DSVDFVKAGMEAIIEDEVTSRFEAEQLVSWNMLTRTSIKFYQFVNWKLSALWILGFMFRYCVMLPLRFTVFCIGLVFLISSTALIGLVPIGNWKKALNHKCMLICYRILSRSLTAVVYFHDEHYKAQAQGICVANHTSPIDALILSIDNVYALIGQKHEGLLGIVQRALSRASSHIWFERSEAKDRLVVAQKLKEHCTNPDKLPILIFPEGTCINNTSVMMFKKGSFEIGTTIYPIAMKYDSRFGDAFWNSSEQSWCGYIMRMMTSWAIICNVWYLPPMTRRDGEDAVDFANRVKKEIANKGGLVDLEWDGGLKRAKVPPKMVAKQQERYANRLSRYTSVSE 543          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Celegans
Match: acl-4 (ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc:Q9N5S9])

HSP 1 Score: 343.199 bits (879), Expect = 4.456e-113
Identity = 168/333 (50.45%), Postives = 236/333 (70.87%), Query Frame = 1
Query:  415 IEAIIEDDVTKRFSSNEMEVWNLLSRTHS--YQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKK-FNAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRS-VPKDSLKQVQQK---SFSKFIKTSE 1392
            +EAIIED+VT RF + ++  WN+L+RT    YQ +N +L+ LW++GF  RY ++LP R   F   +  L+ S+ L+ L+P    KK  N     + +R+  R+ + V+ FH++  KA++ GICVANHT+PID ++L  DN YA++GQK  G  G++Q+   RA+S IWFERSE +DR  V ++L++H   P  LPILIFPEGTCINNTSVMMFKKGSFE+G TIYP+A+KYDSRF D FWNSS+ S   Y+  MM+SWAI+ +VWYLPP  +++ E+A++FANRVK+ IA +GGLVD++WDGGLKR+ VP   + + Q++     S++   SE
Sbjct:    1 MEAIIEDEVTSRFEAEQLVSWNMLTRTSIKFYQFVNWKLSALWILGFMFRYCVMLPLRFTVFCIGLVFLISSTALIGLVPIGNWKKALNHKCMLICYRILSRSLTAVVYFHDEHYKAQAQGICVANHTSPIDALILSIDNVYALIGQKHEGLLGIVQRALSRASSHIWFERSEAKDRLVVAQKLKEHCTNPDKLPILIFPEGTCINNTSVMMFKKGSFEIGTTIYPIAMKYDSRFGDAFWNSSEQSWCGYIMRMMTSWAIICNVWYLPPMTRRDGEDAVDFANRVKKEIANKGGLVDLEWDGGLKRAKVPPKMVAKQQERYANRLSRYTSVSE 333          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Fly
Match: Gpat4 (gene:FBgn0034971 transcript:FBtr0302165)

HSP 1 Score: 374.015 bits (959), Expect = 3.319e-124
Identity = 202/446 (45.29%), Postives = 288/446 (64.57%), Query Frame = 1
Query:   97 FILFTNLVGGIVGVLTGYRFIEELYIKLLLKVFAYASSTVS----ENEQIETKRKGIKRSMSIGCYDRD-------MCTINRD-VRLDQDGIKFNQAFIRDANNK--FNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTH-SYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKFNAVVS-KLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFIKT 1386
            F++F + +   +GV        + Y+ LLL++F Y   ++     EN+ I+  +   K+ + +   D D          I RD V L Q      +  +    ++  F+      +VKSG+EAIIEDDVT RF + E++ WN+L+RT+  Y+ I+ ++T +WV GFF RY IL+P R+      +   V SS +V  LP +  +   A +S K++FR+   + S  I+FHNK+ K    G CVANHT+P+DV +L  D  Y+++GQ+ GGF G++Q+   RA+  IWFER E +DR  V +RL+ H+ +P + PILIFPEGTCINNTSVM FKKGSFEVGG IYPVA+KYD RF D FWNS+KYS+++YL+MMM+SWAIV DVWYLPP +++E E+AI+FANRVK  IA+QGGL+D+ WDG LKR  PK   +++QQ  F+  +K+
Sbjct:   19 FLIFISAINKSIGV-------RKAYVNLLLRIFEYGRVSIETASKENQHIQNPKTDDKQGVQL-VDDADSKEGTNGATLITRDAVLLPQPQEPAPEKPVSSTKDEINFDFEKCLDYVKSGVEAIIEDDVTSRFEAEELKSWNMLTRTNRHYEFISWKITSIWVFGFFIRYVILMPLRVLVCFVGVLFAVLSSSIVACLPFRFVRLSLASLSFKITFRLISSSMSSFIKFHNKQYKPTVSGFCVANHTSPLDVAILSTDCTYSLIGQRHGGFLGVLQRALARASPHIWFERGEAKDRHLVAERLKQHVSDPNNPPILIFPEGTCINNTSVMQFKKGSFEVGGVIYPVAIKYDPRFGDAFWNSAKYSMMQYLYMMMTSWAIVCDVWYLPPMYRQEGESAIDFANRVKSVIAKQGGLIDLVWDGQLKRMKPKKEWREIQQVEFANRLKS 456          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Fly
Match: Gpat4 (gene:FBgn0034971 transcript:FBtr0072179)

HSP 1 Score: 370.548 bits (950), Expect = 6.070e-123
Identity = 202/446 (45.29%), Postives = 287/446 (64.35%), Query Frame = 1
Query:   97 FILFTNLVGGIVGVLTGYRFIEELYIKLLLKVFAYASSTVS----ENEQIETKRKGIKRSMSIGCYDRD-------MCTINRD-VRLDQDGIKFNQAFIRDANNK--FNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTH-SYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKK-FNAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFIKT 1386
            F++F + +   +GV        + Y+ LLL++F Y   ++     EN+ I+  +   K+ + +   D D          I RD V L Q      +  +    ++  F+      +VKSG+EAIIEDDVT RF + E++ WN+L+RT+  Y+ I+ ++T +WV GFF RY IL+P R+      +  L   +  V  L +   K+     V  + F +   A S VI +HN++N+  S GICVANHT+PIDV+VL CD+ Y+++GQ+ GGF G++Q+   RA+  IWFER E +DR  V +RL+ H+ +P + PILIFPEGTCINNTSVM FKKGSFEVGG IYPVA+KYD RF D FWNS+KYS+++YL+MMM+SWAIV DVWYLPP +++E E+AI+FANRVK  IA+QGGL+D+ WDG LKR  PK   +++QQ  F+  +K+
Sbjct:   19 FLIFISAINKSIGV-------RKAYVNLLLRIFEYGRVSIETASKENQHIQNPKTDDKQGVQL-VDDADSKEGTNGATLITRDAVLLPQPQEPAPEKPVSSTKDEINFDFEKCLDYVKSGVEAIIEDDVTSRFEAEELKSWNMLTRTNRHYEFISWKITSIWVFGFFIRYVILMPLRVLVCFVGVVWLTVCTAAVGYLKDGPFKRDLVHKVLGMCFGVLSSAISAVITYHNEDNRP-SSGICVANHTSPIDVLVLMCDSTYSLIGQRHGGFLGVLQRALARASPHIWFERGEAKDRHLVAERLKQHVSDPNNPPILIFPEGTCINNTSVMQFKKGSFEVGGVIYPVAIKYDPRFGDAFWNSAKYSMMQYLYMMMTSWAIVCDVWYLPPMYRQEGESAIDFANRVKSVIAKQGGLIDLVWDGQLKRMKPKKEWREIQQVEFANRLKS 455          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Fly
Match: Gpat4 (gene:FBgn0034971 transcript:FBtr0343336)

HSP 1 Score: 295.049 bits (754), Expect = 1.141e-92
Identity = 139/233 (59.66%), Postives = 183/233 (78.54%), Query Frame = 1
Query:  688 LSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFIKT 1386
            + F +   A S VI +HN++N+  S GICVANHT+PIDV+VL CD+ Y+++GQ+ GGF G++Q+   RA+  IWFER E +DR  V +RL+ H+ +P + PILIFPEGTCINNTSVM FKKGSFEVGG IYPVA+KYD RF D FWNS+KYS+++YL+MMM+SWAIV DVWYLPP +++E E+AI+FANRVK  IA+QGGL+D+ WDG LKR  PK   +++QQ  F+  +K+
Sbjct:  303 MCFGVLSSAISAVITYHNEDNRP-SSGICVANHTSPIDVLVLMCDSTYSLIGQRHGGFLGVLQRALARASPHIWFERGEAKDRHLVAERLKQHVSDPNNPPILIFPEGTCINNTSVMQFKKGSFEVGGVIYPVAIKYDPRFGDAFWNSAKYSMMQYLYMMMTSWAIVCDVWYLPPMYRQEGESAIDFANRVKSVIAKQGGLIDLVWDGQLKRMKPKKEWREIQQVEFANRLKS 534          

HSP 2 Score: 139.813 bits (351), Expect = 3.718e-35
Identity = 90/264 (34.09%), Postives = 143/264 (54.17%), Query Frame = 1
Query:   97 FILFTNLVGGIVGVLTGYRFIEELYIKLLLKVFAYASSTVS----ENEQIETKRKGIKRSMSIGCYDRD-------MCTINRD-VRLDQDGIKFNQAFIRDANNK--FNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTH-SYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKFNAVVS-KLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMV 840
            F++F + +   +GV        + Y+ LLL++F Y   ++     EN+ I+  +   K+ + +   D D          I RD V L Q      +  +    ++  F+      +VKSG+EAIIEDDVT RF + E++ WN+L+RT+  Y+ I+ ++T +WV GFF RY IL+P R+      +   V SS +V  LP +  +   A +S K++FR+   + S  I+FHNK+ K    G CVANHT+P+DV +L  D  Y++V
Sbjct:   19 FLIFISAINKSIGV-------RKAYVNLLLRIFEYGRVSIETASKENQHIQNPKTDDKQGVQL-VDDADSKEGTNGATLITRDAVLLPQPQEPAPEKPVSSTKDEINFDFEKCLDYVKSGVEAIIEDDVTSRFEAEELKSWNMLTRTNRHYEFISWKITSIWVFGFFIRYVILMPLRVLVCFVGVLFAVLSSSIVACLPFRFVRLSLASLSFKITFRLISSSMSSFIKFHNKQYKPTVSGFCVANHTSPLDVAILSTDCTYSLV 274          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Fly
Match: CG15450 (gene:FBgn0031132 transcript:FBtr0077280)

HSP 1 Score: 255.758 bits (652), Expect = 2.987e-79
Identity = 130/316 (41.14%), Postives = 194/316 (61.39%), Query Frame = 1
Query:  400 FVKSGIEAIIEDDVTKRFSSNEMEV--WNLLSRT--HSYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQ-GKKFNAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVP 1332
            F+ +G+  ++EDDVT+RF +       WNLL+R      ++++ +L  +W++G+  RY +LLP R       +  + G S L+  +P+    KK   +V +  FR+       + RFHN E +  + GICV NHT+P+DV+VL CD  Y++ GQ   G  G++Q+   R +  +WF+R E  DRE +   LR H       P+L+FPEGTCINNT+VM FKKGSF V   ++PVA++YD RF + +W+S++YS+L Y+ M++SSW I  DVWY+P   +   E+ +EF+NRVK  IA Q  + D+ WDG LKR  P
Sbjct:   88 FITAGLGLVLEDDVTQRFVAPPSPAGEWNLLTRNLRQRNRYLSWRLRTVWLLGWVVRYGLLLPFRTIGCWLCLFMISGVSMLLGHIPDWCFKKKLVELVLRQCFRITAACLPMIRRFHNTEYRP-TKGICVCNHTSPLDVLVLMCDANYSLTGQVHTGILGVLQRALSRVSHHMWFDRKELADREALGLVLRLHCSMKDRPPVLLFPEGTCINNTAVMQFKKGSFAVSDVVHPVAIRYDRRFGEAYWDSTRYSMLRYMLMVVSSWCICCDVWYMPALSRCNDESPVEFSNRVKAAIAAQANIDDLPWDGNLKRWSP 402          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Fly
Match: Gpat4 (gene:FBgn0034971 transcript:FBtr0343337)

HSP 1 Score: 244.202 bits (622), Expect = 4.715e-75
Identity = 106/168 (63.10%), Postives = 134/168 (79.76%), Query Frame = 1
Query:  883 FGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFIKT 1386
              RA+  IWFER E +DR  V +RL+ H+ +P + PILIFPEGTCINNTSVM FKKGSFEVGG IYPVA+KYD RF D FWNS+KYS+++YL+MMM+SWAIV DVWYLPP +++E E+AI+FANRVK  IA+QGGL+D+ WDG LKR  PK   +++QQ  F+  +K+
Sbjct:  210 LARASPHIWFERGEAKDRHLVAERLKQHVSDPNNPPILIFPEGTCINNTSVMQFKKGSFEVGGVIYPVAIKYDPRFGDAFWNSAKYSMMQYLYMMMTSWAIVCDVWYLPPMYRQEGESAIDFANRVKSVIAKQGGLIDLVWDGQLKRMKPKKEWREIQQVEFANRLKS 377          

HSP 2 Score: 88.9669 bits (219), Expect = 9.773e-19
Identity = 60/190 (31.58%), Postives = 97/190 (51.05%), Query Frame = 1
Query:   97 FILFTNLVGGIVGVLTGYRFIEELYIKLLLKVFAYASSTVS----ENEQIETKRKGIKRSMSIGCYDRD-------MCTINRD-VRLDQDGIKFNQAFIRDANNK--FNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTH-SYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVG 621
            F++F + +   +GV        + Y+ LLL++F Y   ++     EN+ I+  +   K+ + +   D D          I RD V L Q      +  +    ++  F+      +VKSG+EAIIEDDVT RF + E++ WN+L+RT+  Y+ I+ ++T +WV GFF RY IL+P R+      I    G
Sbjct:   19 FLIFISAINKSIGV-------RKAYVNLLLRIFEYGRVSIETASKENQHIQNPKTDDKQGVQL-VDDADSKEGTNGATLITRDAVLLPQPQEPAPEKPVSSTKDEINFDFEKCLDYVKSGVEAIIEDDVTSRFEAEELKSWNMLTRTNRHYEFISWKITSIWVFGFFIRYVILMPLRVLVCFVGIGQRHG 200          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Zebrafish
Match: gpat3 (glycerol-3-phosphate acyltransferase 3 [Source:NCBI gene;Acc:436958])

HSP 1 Score: 400.593 bits (1028), Expect = 1.159e-134
Identity = 207/442 (46.83%), Postives = 296/442 (66.97%), Query Frame = 1
Query:   82 LPYYVFILFTNLVGGIV------GVLTGYRFIEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRD-ANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTHS-YQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            + + +  ++ ++V G++      GV  G+    ++YIKLL+K   +A+  +   ++   ++  +   ++ G  ++D      D  ++++ ++  ++  ++ A   F L D  YF K GIE I+ED VT+RFSS E+  WNLL+RT++ +++I+ +LTI+W +G F RY +LLP R+   +  +S LV  + LV  LP  + K + + +V    +R+  R  S  IR+HNKEN+ K GGICVANHT+PID+++L  D  YAMVGQ  GG  G++Q+   R+   +WFERSE +DR  V KRL+DHI +   LPILIFPEGTCINNTSVMMFKKGSFE GGTIYPVA+KYD RF D FWNS+KY+++ Y+  MM+SWAIV +VWYLPP  Q++ E+A+ FANRVK  IA QGGLVD+ WDGGLKRS  K+S K+ QQK +S  I
Sbjct:    7 VAFVLLHVWMSIVAGLIVLPAMFGVSLGF---TDIYIKLLVKTLEWATLRIQRGQK---EQPTLPLQLANGIIEKD------DGSMEEEIVELRRSHPKNLAEGNFTLCDAFYFCKKGIENIVEDQVTQRFSSEELASWNLLTRTNNNFRYISVRLTIIWGLGVFVRYCVLLPLRITLAVIGLSWLVIGTTLVGFLPNSKVKNWLSDLVHITCYRICARGLSATIRYHNKENRPKKGGICVANHTSPIDIVILANDGCYAMVGQVHGGLMGVIQRSMVRSCPHVWFERSEMKDRHAVAKRLKDHISDKTKLPILIFPEGTCINNTSVMMFKKGSFEFGGTIYPVAIKYDPRFGDAFWNSAKYNMVSYILRMMTSWAIVCNVWYLPPMTQQDGEDAVHFANRVKSAIAHQGGLVDLSWDGGLKRSKVKESFKEEQQKMYSSMI 436          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Zebrafish
Match: gpat3 (glycerol-3-phosphate acyltransferase 3 [Source:NCBI gene;Acc:436958])

HSP 1 Score: 400.593 bits (1028), Expect = 1.159e-134
Identity = 207/442 (46.83%), Postives = 296/442 (66.97%), Query Frame = 1
Query:   82 LPYYVFILFTNLVGGIV------GVLTGYRFIEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRD-ANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTHS-YQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            + + +  ++ ++V G++      GV  G+    ++YIKLL+K   +A+  +   ++   ++  +   ++ G  ++D      D  ++++ ++  ++  ++ A   F L D  YF K GIE I+ED VT+RFSS E+  WNLL+RT++ +++I+ +LTI+W +G F RY +LLP R+   +  +S LV  + LV  LP  + K + + +V    +R+  R  S  IR+HNKEN+ K GGICVANHT+PID+++L  D  YAMVGQ  GG  G++Q+   R+   +WFERSE +DR  V KRL+DHI +   LPILIFPEGTCINNTSVMMFKKGSFE GGTIYPVA+KYD RF D FWNS+KY+++ Y+  MM+SWAIV +VWYLPP  Q++ E+A+ FANRVK  IA QGGLVD+ WDGGLKRS  K+S K+ QQK +S  I
Sbjct:    7 VAFVLLHVWMSIVAGLIVLPAMFGVSLGF---TDIYIKLLVKTLEWATLRIQRGQK---EQPTLPLQLANGIIEKD------DGSMEEEIVELRRSHPKNLAEGNFTLCDAFYFCKKGIENIVEDQVTQRFSSEELASWNLLTRTNNNFRYISVRLTIIWGLGVFVRYCVLLPLRITLAVIGLSWLVIGTTLVGFLPNSKVKNWLSDLVHITCYRICARGLSATIRYHNKENRPKKGGICVANHTSPIDIVILANDGCYAMVGQVHGGLMGVIQRSMVRSCPHVWFERSEMKDRHAVAKRLKDHISDKTKLPILIFPEGTCINNTSVMMFKKGSFEFGGTIYPVAIKYDPRFGDAFWNSAKYNMVSYILRMMTSWAIVCNVWYLPPMTQQDGEDAVHFANRVKSAIAHQGGLVDLSWDGGLKRSKVKESFKEEQQKMYSSMI 436          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Zebrafish
Match: gpat3 (glycerol-3-phosphate acyltransferase 3 [Source:NCBI gene;Acc:436958])

HSP 1 Score: 400.593 bits (1028), Expect = 1.363e-134
Identity = 207/442 (46.83%), Postives = 296/442 (66.97%), Query Frame = 1
Query:   82 LPYYVFILFTNLVGGIV------GVLTGYRFIEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRD-ANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTHS-YQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            + + +  ++ ++V G++      GV  G+    ++YIKLL+K   +A+  +   ++   ++  +   ++ G  ++D      D  ++++ ++  ++  ++ A   F L D  YF K GIE I+ED VT+RFSS E+  WNLL+RT++ +++I+ +LTI+W +G F RY +LLP R+   +  +S LV  + LV  LP  + K + + +V    +R+  R  S  IR+HNKEN+ K GGICVANHT+PID+++L  D  YAMVGQ  GG  G++Q+   R+   +WFERSE +DR  V KRL+DHI +   LPILIFPEGTCINNTSVMMFKKGSFE GGTIYPVA+KYD RF D FWNS+KY+++ Y+  MM+SWAIV +VWYLPP  Q++ E+A+ FANRVK  IA QGGLVD+ WDGGLKRS  K+S K+ QQK +S  I
Sbjct:    8 VAFVLLHVWMSIVAGLIVLPAMFGVSLGF---TDIYIKLLVKTLEWATLRIQRGQK---EQPTLPLQLANGIIEKD------DGSMEEEIVELRRSHPKNLAEGNFTLCDAFYFCKKGIENIVEDQVTQRFSSEELASWNLLTRTNNNFRYISVRLTIIWGLGVFVRYCVLLPLRITLAVIGLSWLVIGTTLVGFLPNSKVKNWLSDLVHITCYRICARGLSATIRYHNKENRPKKGGICVANHTSPIDIVILANDGCYAMVGQVHGGLMGVIQRSMVRSCPHVWFERSEMKDRHAVAKRLKDHISDKTKLPILIFPEGTCINNTSVMMFKKGSFEFGGTIYPVAIKYDPRFGDAFWNSAKYNMVSYILRMMTSWAIVCNVWYLPPMTQQDGEDAVHFANRVKSAIAHQGGLVDLSWDGGLKRSKVKESFKEEQQKMYSSMI 437          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Zebrafish
Match: agpat9l (1-acylglycerol-3-phosphate O-acyltransferase 9, like [Source:NCBI gene;Acc:567414])

HSP 1 Score: 394.43 bits (1012), Expect = 2.542e-132
Identity = 215/444 (48.42%), Postives = 297/444 (66.89%), Query Frame = 1
Query:   67 FLALLLP----YYVFILFTNLVGGIVGVLTGYRFIEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTHS-YQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            + A+L P    ++  ++   ++  + G+  G   I E Y+KLL+K   +A+  +    + E   + +K S S G   RD  ++ +++    + ++ N+    D  + F L+D  YF + G E+I+EDDVT+RF+S E+  WNLL+RT++ +Q+I+ +LT+LWVVG   RY ILLP R+      ++ LV  +  V  LP  + K + + +V  + +R+  R  S  I FHNK+N+ K GGICVANHT+PIDV++L  D  YAMVGQ  GG  G++Q+   R+   IWFERSE RDR  VT+RL+DH+     LPILIFPEGTCINNTSVMMFKKGSFE+GGTIYPVA+KYD +F D FWNSSKYS++ YL  MM+SWAIV +VWYLPP   +E E+A++FANRVK  IAQQGGLVD+ WDGGLKR+  KDS K+ QQK +S  +
Sbjct:    4 YWAVLFPVLKVWFSCVIVLIMLPAMFGISLG---ITETYMKLLIKTLEWATHRIQRASRAE---EILKESASNGLIQRDNSSLEQEI----EELRRNRPKSADRGD-FTLSDVLYFSRKGFESIVEDDVTQRFTSEELVSWNLLTRTNNNFQYISLRLTVLWVVGVVVRYCILLPLRITLTTIGLTWLVIGTTTVGFLPNCRVKNWLSELVHLMCYRICARGLSATIHFHNKQNRPKKGGICVANHTSPIDVVILANDGCYAMVGQVHGGLMGVLQRAMERSCPHIWFERSEMRDRHLVTQRLKDHVNAKTKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIYPVAIKYDPQFGDAFWNSSKYSIMSYLLRMMTSWAIVCNVWYLPPMTHEEGEDAVQFANRVKSTIAQQGGLVDLAWDGGLKRAKVKDSFKEQQQKKYSHMV 436          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Zebrafish
Match: agpat9l (1-acylglycerol-3-phosphate O-acyltransferase 9, like [Source:NCBI gene;Acc:567414])

HSP 1 Score: 394.43 bits (1012), Expect = 2.542e-132
Identity = 215/444 (48.42%), Postives = 297/444 (66.89%), Query Frame = 1
Query:   67 FLALLLP----YYVFILFTNLVGGIVGVLTGYRFIEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTHS-YQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            + A+L P    ++  ++   ++  + G+  G   I E Y+KLL+K   +A+  +    + E   + +K S S G   RD  ++ +++    + ++ N+    D  + F L+D  YF + G E+I+EDDVT+RF+S E+  WNLL+RT++ +Q+I+ +LT+LWVVG   RY ILLP R+      ++ LV  +  V  LP  + K + + +V  + +R+  R  S  I FHNK+N+ K GGICVANHT+PIDV++L  D  YAMVGQ  GG  G++Q+   R+   IWFERSE RDR  VT+RL+DH+     LPILIFPEGTCINNTSVMMFKKGSFE+GGTIYPVA+KYD +F D FWNSSKYS++ YL  MM+SWAIV +VWYLPP   +E E+A++FANRVK  IAQQGGLVD+ WDGGLKR+  KDS K+ QQK +S  +
Sbjct:    4 YWAVLFPVLKVWFSCVIVLIMLPAMFGISLG---ITETYMKLLIKTLEWATHRIQRASRAE---EILKESASNGLIQRDNSSLEQEI----EELRRNRPKSADRGD-FTLSDVLYFSRKGFESIVEDDVTQRFTSEELVSWNLLTRTNNNFQYISLRLTVLWVVGVVVRYCILLPLRITLTTIGLTWLVIGTTTVGFLPNCRVKNWLSELVHLMCYRICARGLSATIHFHNKQNRPKKGGICVANHTSPIDVVILANDGCYAMVGQVHGGLMGVLQRAMERSCPHIWFERSEMRDRHLVTQRLKDHVNAKTKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIYPVAIKYDPQFGDAFWNSSKYSIMSYLLRMMTSWAIVCNVWYLPPMTHEEGEDAVQFANRVKSTIAQQGGLVDLAWDGGLKRAKVKDSFKEQQQKKYSHMV 436          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Xenopus
Match: gpat4 (glycerol-3-phosphate acyltransferase 4 [Source:NCBI gene;Acc:100170573])

HSP 1 Score: 403.675 bits (1036), Expect = 1.102e-135
Identity = 215/462 (46.54%), Postives = 302/462 (65.37%), Query Frame = 1
Query:   49 MLSIVPF---------LALLLPYYVFILFTNLVGGIVGVLTGYRFIEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDV-RLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRT-HSYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFIKTSE*N 1398
            M S++PF         L+L L + + ++F  +V  I GV  G R    LY+K LL++F +A+  +     I+     + + +S G   ++  +    +  L  +G   ++        +F L+D  YF + G+E+I++D+VT+RFS  E+E WNLL+RT +++QHI+ +LT+LW +G   RY  LLP R+   IT +S LV  + +V  LP  + K+F +  V  + +R+ VRA + +I +H  EN+ + GGICVANHT+PIDVI+L  D  YAMVGQ  GG  G++Q+   ++   +WFERSE +DR  V KRL DH+++   LPILIFPEGTCINNTSVMMFKKGSFE+G T+YPVA+KYD RF D FWNSSKY ++ YL  MM+SWAIV  VWYLPP  ++E E+A++FANRVK  IA QGGLVD+ WDGGLKR   KD+ K+ QQK +S+ I  S+ N
Sbjct:    1 MSSLLPFDSVICILLGLSLTLWFTLLLVFI-IVPAIFGVSFGIR---RLYMKTLLRIFTWATLRIERG--IKENSHALYKPLSNGIIAKESTSFEEGIWELRGNGRSLDRP-------EFELSDIFYFCRQGMESIVDDEVTQRFSGEELETWNLLTRTNYNFQHISLRLTVLWGLGMLVRYTFLLPLRVALAITGVSLLVIGTTVVGFLPNGRFKEFLSKHVHLMCYRICVRALTAIITYHGSENRPRKGGICVANHTSPIDVIILASDGYYAMVGQIHGGLMGVIQRAMVKSCPHVWFERSEVKDRHLVAKRLTDHVQDKSKLPILIFPEGTCINNTSVMMFKKGSFEIGATVYPVAIKYDPRFGDAFWNSSKYGMVTYLLRMMTSWAIVCSVWYLPPMTRQEDEDAVQFANRVKSAIAHQGGLVDLLWDGGLKREKVKDTFKEEQQKVYSRIIAGSQEN 449          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Xenopus
Match: hnrnpu (heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) [Source:Xenbase;Acc:XB-GENE-490782])

HSP 1 Score: 399.438 bits (1025), Expect = 4.011e-134
Identity = 209/411 (50.85%), Postives = 285/411 (69.34%), Query Frame = 1
Query:  157 IEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRD-ANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTHS-YQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKK-FNAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            I E+Y+K+L+KV  +A+  + +  + + K   +  S S G   RD   +  ++     G++ +++  +D     F L D  YF K G EAI+ED+VT RFSS E+  WNLL+RT++ + +++ ++T++WV+G F RY ILLP R+      IS LV  + LV  LP  + K  F+ +V  +  R+  RA S  I++HNKENK K GGICVANHT+PID+I+L  D  YAMVGQ  GG  G++Q+   RA   +WFERSE RDR  VT+RLR+H+ +   LPILIFPEGTCINNTSVMMFKKGSFE+GGTIYPVA+KYD +F D FWNSSK S++ YL  MM+SWA+  +VWYLPP +++E E+A++FANRVK  IA+QGGLV++ WDGGLKR   KDS K+ QQK++S+ I
Sbjct:   35 ISEVYMKILVKVLEWATLRIQKGFKDKEK---LHVSASNGIIQRDQSPMETEI----GGLRKSRS--QDIQQGDFELGDVFYFAKKGFEAIVEDEVTHRFSSEELISWNLLTRTNNNFHYVSLRVTLIWVLGLFVRYCILLPLRVTLATIGISWLVIGATLVGQLPNSRMKNWFSELVHLMCCRICARALSSAIQYHNKENKPKKGGICVANHTSPIDIIILANDGCYAMVGQVHGGLMGIIQRAMARACPHVWFERSEMRDRHLVTERLREHVSDISKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIYPVAIKYDPQFGDAFWNSSKNSMVSYLLRMMTSWALKCNVWYLPPVNKQEGEDAVQFANRVKSAIAKQGGLVELSWDGGLKRGKVKDSFKEEQQKNYSRII 436          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Xenopus
Match: gpat4 (glycerol-3-phosphate acyltransferase 4 [Source:NCBI gene;Acc:100170573])

HSP 1 Score: 396.356 bits (1017), Expect = 6.844e-133
Identity = 217/458 (47.38%), Postives = 298/458 (65.07%), Query Frame = 1
Query:   49 MLSIVPF---LALLLPYYVFILFTNL-VGGIVGVLTGYRF-IEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRDANN-KFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRT-HSYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFIKTSE*N 1398
            M S++PF   + +LL   + + FT L V  IV  + G  F I  LY+K LL++F +          +          MS+ C       I ++    ++GI   +   R  +  +F L+D  YF + G+E+I++D+VT+RFS  E+E WNLL+RT +++QHI+ +LT+LW +G   RY  LLP R+   IT +S LV  + +V  LP  + K+F +  V  + +R+ VRA + +I +H  EN+ + GGICVANHT+PIDVI+L  D  YAMVGQ  GG  G++Q+   ++   +WFERSE +DR  V KRL DH+++   LPILIFPEGTCINNTSVMMFKKGSFE+G T+YPVA+KYD RF D FWNSSKY ++ YL  MM+SWAIV  VWYLPP  ++E E+A++FANRVK  IA QGGLVD+ WDGGLKR   KD+ K+ QQK +S+ I  S+ N
Sbjct:    1 MSSLLPFDSVICILLGLSLTLWFTLLLVFIIVPAIFGVSFGIRRLYMKTLLRIFTF----------VGIHSNFTPCDMSVSCR-----IIAKESTSFEEGIWELRGNGRSLDRPEFELSDIFYFCRQGMESIVDDEVTQRFSGEELETWNLLTRTNYNFQHISLRLTVLWGLGMLVRYTFLLPLRVALAITGVSLLVIGTTVVGFLPNGRFKEFLSKHVHLMCYRICVRALTAIITYHGSENRPRKGGICVANHTSPIDVIILASDGYYAMVGQIHGGLMGVIQRAMVKSCPHVWFERSEVKDRHLVAKRLTDHVQDKSKLPILIFPEGTCINNTSVMMFKKGSFEIGATVYPVAIKYDPRFGDAFWNSSKYGMVTYLLRMMTSWAIVCSVWYLPPMTRQEDEDAVQFANRVKSAIAHQGGLVDLLWDGGLKREKVKDTFKEEQQKVYSRIIAGSQEN 443          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Xenopus
Match: gpat4 (glycerol-3-phosphate acyltransferase 4 [Source:NCBI gene;Acc:100170573])

HSP 1 Score: 394.43 bits (1012), Expect = 5.190e-132
Identity = 211/451 (46.78%), Postives = 296/451 (65.63%), Query Frame = 1
Query:   49 MLSIVPF---LALLLPYYVFILFTNL-VGGIVGVLTGYRF-IEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDV-RLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRT-HSYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKF 1377
            M S++PF   + +LL   + + FT L V  IV  + G  F I  LY+K LL++F +A+  +     I+     + + +S G   ++  +    +  L  +G   ++        +F L+D  YF + G+E+I++D+VT+RFS  E+E WNLL+RT +++QHI+ +LT+LW +G   RY  LLP R+   IT +S LV  + +V  LP  + K+F +  V  + +R+ VRA + +I +H + N+ + GGICVANHT+PIDVI+L  D  YAMVGQ  GG  G++Q+   ++   +WFERSE +DR  V KRL DH+++   LPILIFPEGTCINNTSVMMFKKGSFE+G T+YPVA+KYD RF D FWNSSKY ++ YL  MM+SWAIV  VWYLPP  ++E E+A++FANRVK  IA QGGLVD+ WDGGLKR   KD+ K+ QQK    +
Sbjct:    1 MSSLLPFDSVICILLGLSLTLWFTLLLVFIIVPAIFGVSFGIRRLYMKTLLRIFTWATLRIERG--IKENSHALYKPLSNGIIAKESTSFEEGIWELRGNGRSLDRP-------EFELSDIFYFCRQGMESIVDDEVTQRFSGEELETWNLLTRTNYNFQHISLRLTVLWGLGMLVRYTFLLPLRVALAITGVSLLVIGTTVVGFLPNGRFKEFLSKHVHLMCYRICVRALTAIITYHGRYNRPRKGGICVANHTSPIDVIILASDGYYAMVGQIHGGLMGVIQRAMVKSCPHVWFERSEVKDRHLVAKRLTDHVQDKSKLPILIFPEGTCINNTSVMMFKKGSFEIGATVYPVAIKYDPRFGDAFWNSSKYGMVTYLLRMMTSWAIVCSVWYLPPMTRQEDEDAVQFANRVKSAIAHQGGLVDLLWDGGLKREKVKDTFKEEQQKPLLSY 442          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Xenopus
Match: gpat4 (glycerol-3-phosphate acyltransferase 4 [Source:NCBI gene;Acc:100170573])

HSP 1 Score: 392.119 bits (1006), Expect = 6.811e-132
Identity = 198/409 (48.41%), Postives = 277/409 (67.73%), Query Frame = 1
Query:  172 IKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDV-RLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRT-HSYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFIKTS 1389
            +K LL++F +A+  +     I+     + + +S G   ++  +    +  L  +G   ++        +F L+D  YF + G+E+I++D+VT+RFS  E+E WNLL+RT +++QHI+ +LT+LW +G   RY  LLP R+   IT +S LV  + +V  LP  + K+F +  V  + +R+ VRA + +I +H  EN+ + GGICVANHT+PIDVI+L  D  YAMVGQ  GG  G++Q+   ++   +WFERSE +DR  V KRL DH+++   LPILIFPEGTCINNTSVMMFKKGSFE+G T+YPVA+KYD RF D FWNSSKY ++ YL  MM+SWAIV  VWYLPP  ++E E+A++FANRVK  IA QGGLVD+ WDGGLKR   KD+ K+ QQK +S+ I+ S
Sbjct:    1 MKTLLRIFTWATLRIERG--IKENSHALYKPLSNGIIAKESTSFEEGIWELRGNGRSLDRP-------EFELSDIFYFCRQGMESIVDDEVTQRFSGEELETWNLLTRTNYNFQHISLRLTVLWGLGMLVRYTFLLPLRVALAITGVSLLVIGTTVVGFLPNGRFKEFLSKHVHLMCYRICVRALTAIITYHGSENRPRKGGICVANHTSPIDVIILASDGYYAMVGQIHGGLMGVIQRAMVKSCPHVWFERSEVKDRHLVAKRLTDHVQDKSKLPILIFPEGTCINNTSVMMFKKGSFEIGATVYPVAIKYDPRFGDAFWNSSKYGMVTYLLRMMTSWAIVCSVWYLPPMTRQEDEDAVQFANRVKSAIAHQGGLVDLLWDGGLKREKVKDTFKEEQQKVYSRIIEPS 400          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Mouse
Match: Gpat3 (glycerol-3-phosphate acyltransferase 3 [Source:MGI Symbol;Acc:MGI:3603816])

HSP 1 Score: 398.667 bits (1023), Expect = 4.095e-134
Identity = 207/430 (48.14%), Postives = 290/430 (67.44%), Query Frame = 1
Query:  106 FTNLVGGIVGVLTGYRF---IEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTH-SYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            +  LVGG++ + + +     I E+Y+K+L+K   +A+  + +      K   +K S S+G   RD   + + +     G++            F L+D  YF K G+EAI+ED+VT+RFSS E+  WNLL+RT+ ++Q+I+ +LT++WV+G   RY  LLP R+      IS L+  + LV  LP+   K + + +V     R+ VR+ SG I +HNK+ + + GGICVANHT+PIDV++L  D  YAMVGQ  GG  G++Q+   +A   +WFERSE +DR  VTKRL++HI +   LPILIFPEGTCINNTSVMMFKKGSFE+GGTIYPVA+KY+ +F D FWNSSKY+L+ YL  +M+SWAIV DVWY+PP  ++E E+A++FANRVK  IA QGGL ++ WDGGLKR+  KD+ K+ QQK++SK I
Sbjct:   14 WLTLVGGLILLPSAFGLSLGISEIYMKILVKTLEWATLRIQKGA---PKESALKNSASVGIIQRDESPMEKGL----SGLR---------GRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEELVSWNLLTRTNVNFQYISPRLTMVWVLGVLVRYCFLLPLRVTLAFIGISLLIIGTTLVGQLPDSSLKNWLSELVHLTCCRICVRSLSGTIHYHNKQYRPQKGGICVANHTSPIDVLILATDGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEIKDRHLVTKRLKEHIADKKKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIYPVAIKYNPQFGDAFWNSSKYNLVSYLLRIMTSWAIVCDVWYMPPMTREEGEDAVQFANRVKSAIAVQGGLTELPWDGGLKRAKVKDTFKEEQQKNYSKMI 427          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Mouse
Match: Gpat3 (glycerol-3-phosphate acyltransferase 3 [Source:MGI Symbol;Acc:MGI:3603816])

HSP 1 Score: 398.667 bits (1023), Expect = 4.095e-134
Identity = 207/430 (48.14%), Postives = 290/430 (67.44%), Query Frame = 1
Query:  106 FTNLVGGIVGVLTGYRF---IEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTH-SYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            +  LVGG++ + + +     I E+Y+K+L+K   +A+  + +      K   +K S S+G   RD   + + +     G++            F L+D  YF K G+EAI+ED+VT+RFSS E+  WNLL+RT+ ++Q+I+ +LT++WV+G   RY  LLP R+      IS L+  + LV  LP+   K + + +V     R+ VR+ SG I +HNK+ + + GGICVANHT+PIDV++L  D  YAMVGQ  GG  G++Q+   +A   +WFERSE +DR  VTKRL++HI +   LPILIFPEGTCINNTSVMMFKKGSFE+GGTIYPVA+KY+ +F D FWNSSKY+L+ YL  +M+SWAIV DVWY+PP  ++E E+A++FANRVK  IA QGGL ++ WDGGLKR+  KD+ K+ QQK++SK I
Sbjct:   14 WLTLVGGLILLPSAFGLSLGISEIYMKILVKTLEWATLRIQKGA---PKESALKNSASVGIIQRDESPMEKGL----SGLR---------GRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEELVSWNLLTRTNVNFQYISPRLTMVWVLGVLVRYCFLLPLRVTLAFIGISLLIIGTTLVGQLPDSSLKNWLSELVHLTCCRICVRSLSGTIHYHNKQYRPQKGGICVANHTSPIDVLILATDGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEIKDRHLVTKRLKEHIADKKKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIYPVAIKYNPQFGDAFWNSSKYNLVSYLLRIMTSWAIVCDVWYMPPMTREEGEDAVQFANRVKSAIAVQGGLTELPWDGGLKRAKVKDTFKEEQQKNYSKMI 427          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Mouse
Match: Gpat3 (glycerol-3-phosphate acyltransferase 3 [Source:MGI Symbol;Acc:MGI:3603816])

HSP 1 Score: 398.667 bits (1023), Expect = 4.095e-134
Identity = 207/430 (48.14%), Postives = 290/430 (67.44%), Query Frame = 1
Query:  106 FTNLVGGIVGVLTGYRF---IEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTH-SYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            +  LVGG++ + + +     I E+Y+K+L+K   +A+  + +      K   +K S S+G   RD   + + +     G++            F L+D  YF K G+EAI+ED+VT+RFSS E+  WNLL+RT+ ++Q+I+ +LT++WV+G   RY  LLP R+      IS L+  + LV  LP+   K + + +V     R+ VR+ SG I +HNK+ + + GGICVANHT+PIDV++L  D  YAMVGQ  GG  G++Q+   +A   +WFERSE +DR  VTKRL++HI +   LPILIFPEGTCINNTSVMMFKKGSFE+GGTIYPVA+KY+ +F D FWNSSKY+L+ YL  +M+SWAIV DVWY+PP  ++E E+A++FANRVK  IA QGGL ++ WDGGLKR+  KD+ K+ QQK++SK I
Sbjct:   14 WLTLVGGLILLPSAFGLSLGISEIYMKILVKTLEWATLRIQKGA---PKESALKNSASVGIIQRDESPMEKGL----SGLR---------GRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEELVSWNLLTRTNVNFQYISPRLTMVWVLGVLVRYCFLLPLRVTLAFIGISLLIIGTTLVGQLPDSSLKNWLSELVHLTCCRICVRSLSGTIHYHNKQYRPQKGGICVANHTSPIDVLILATDGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEIKDRHLVTKRLKEHIADKKKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIYPVAIKYNPQFGDAFWNSSKYNLVSYLLRIMTSWAIVCDVWYMPPMTREEGEDAVQFANRVKSAIAVQGGLTELPWDGGLKRAKVKDTFKEEQQKNYSKMI 427          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Mouse
Match: Gpat4 (glycerol-3-phosphate acyltransferase 4 [Source:MGI Symbol;Acc:MGI:2142716])

HSP 1 Score: 396.741 bits (1018), Expect = 5.544e-133
Identity = 206/424 (48.58%), Postives = 289/424 (68.16%), Query Frame = 1
Query:  115 LVGGIVGVLTGYRFIEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRT-HSYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            +V  I GV  G R   +LY+K LLK+FA+A  T+      + +   + +  + G   +D  ++  +++  +   +   +   D   +F L+D  YF + G+E I++D+VTKRFS+ E+E WNLLSRT +++Q+I+ +LTILW +G   RY  LLP R+    T I  LV  + +V  LP  + K+F +  V  + +R+ VRA + +I +HN++N+ ++GGICVANHT+PIDVI+L  D  YAMVGQ  GG  G++Q+   +A   +WFERSE +DR  V KRL +H+++   LPILIFPEGTCINNTSVMMFKKGSFE+G T+YPVA+KYD +F D FWNSSKY ++ YL  MM+SWAIV  VWYLPP  +++ E+A++FANRVK  IA+QGGLVD+ WDGGLKR   KD+ K+ QQK +SK I
Sbjct:   31 IVPAIFGVSFGIR---KLYMKTLLKIFAWA--TLRMERGAKERNHQLYKPYTNGIIAKDPTSLEEEIKEIR---RSGSSKALDKTPEFELSDIFYFCRKGMETIMDDEVTKRFSAEELESWNLLSRTNYNFQYISLRLTILWGLGVLIRYCFLLPLRIALAFTGIGLLVVGTTMVGYLPNGRFKEFLSKHVHLMCYRICVRALTAIITYHNRKNRPRNGGICVANHTSPIDVIILASDGYYAMVGQVHGGLMGVIQRAMVKACPHVWFERSEVKDRHLVAKRLTEHVQDKSKLPILIFPEGTCINNTSVMMFKKGSFEIGATVYPVAIKYDPQFGDAFWNSSKYGMVTYLLRMMTSWAIVCSVWYLPPMTREKDEDAVQFANRVKSAIARQGGLVDLLWDGGLKREKVKDTFKEEQQKLYSKMI 446          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Mouse
Match: Gpat4 (glycerol-3-phosphate acyltransferase 4 [Source:MGI Symbol;Acc:MGI:2142716])

HSP 1 Score: 142.124 bits (357), Expect = 2.073e-39
Identity = 70/144 (48.61%), Postives = 102/144 (70.83%), Query Frame = 1
Query:  415 IEAIIEDDVTKRFSSNEMEVWNLLSRT-HSYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMV 840
            +E I++D+VTKRFS+ E+E WNLLSRT +++Q+I+ +LTILW +G   RY  LLP R+    T I  LV  + +V  LP  + K+F +  V  + +R+ VRA + +I +HN++N+ ++GGICVANHT+PIDVI+L  D  YAMV
Sbjct:    1 METIMDDEVTKRFSAEELESWNLLSRTNYNFQYISLRLTILWGLGVLIRYCFLLPLRIALAFTGIGLLVVGTTMVGYLPNGRFKEFLSKHVHLMCYRICVRALTAIITYHNRKNRPRNGGICVANHTSPIDVIILASDGYYAMV 144          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q6DG38|GPAT3_DANRE (Glycerol-3-phosphate acyltransferase 3 OS=Danio rerio OX=7955 GN=gpat3 PE=2 SV=1)

HSP 1 Score: 400.593 bits (1028), Expect = 8.746e-134
Identity = 207/442 (46.83%), Postives = 296/442 (66.97%), Query Frame = 1
Query:   82 LPYYVFILFTNLVGGIV------GVLTGYRFIEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRD-ANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTHS-YQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            + + +  ++ ++V G++      GV  G+    ++YIKLL+K   +A+  +   ++   ++  +   ++ G  ++D      D  ++++ ++  ++  ++ A   F L D  YF K GIE I+ED VT+RFSS E+  WNLL+RT++ +++I+ +LTI+W +G F RY +LLP R+   +  +S LV  + LV  LP  + K + + +V    +R+  R  S  IR+HNKEN+ K GGICVANHT+PID+++L  D  YAMVGQ  GG  G++Q+   R+   +WFERSE +DR  V KRL+DHI +   LPILIFPEGTCINNTSVMMFKKGSFE GGTIYPVA+KYD RF D FWNS+KY+++ Y+  MM+SWAIV +VWYLPP  Q++ E+A+ FANRVK  IA QGGLVD+ WDGGLKRS  K+S K+ QQK +S  I
Sbjct:    7 VAFVLLHVWMSIVAGLIVLPAMFGVSLGF---TDIYIKLLVKTLEWATLRIQRGQK---EQPTLPLQLANGIIEKD------DGSMEEEIVELRRSHPKNLAEGNFTLCDAFYFCKKGIENIVEDQVTQRFSSEELASWNLLTRTNNNFRYISVRLTIIWGLGVFVRYCVLLPLRITLAVIGLSWLVIGTTLVGFLPNSKVKNWLSDLVHITCYRICARGLSATIRYHNKENRPKKGGICVANHTSPIDIVILANDGCYAMVGQVHGGLMGVIQRSMVRSCPHVWFERSEMKDRHAVAKRLKDHISDKTKLPILIFPEGTCINNTSVMMFKKGSFEFGGTIYPVAIKYDPRFGDAFWNSAKYNMVSYILRMMTSWAIVCNVWYLPPMTQQDGEDAVHFANRVKSAIAHQGGLVDLSWDGGLKRSKVKESFKEEQQKMYSSMI 436          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q8C0N2|GPAT3_MOUSE (Glycerol-3-phosphate acyltransferase 3 OS=Mus musculus OX=10090 GN=Gpat3 PE=1 SV=1)

HSP 1 Score: 398.667 bits (1023), Expect = 2.864e-133
Identity = 207/430 (48.14%), Postives = 290/430 (67.44%), Query Frame = 1
Query:  106 FTNLVGGIVGVLTGYRF---IEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTH-SYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            +  LVGG++ + + +     I E+Y+K+L+K   +A+  + +      K   +K S S+G   RD   + + +     G++            F L+D  YF K G+EAI+ED+VT+RFSS E+  WNLL+RT+ ++Q+I+ +LT++WV+G   RY  LLP R+      IS L+  + LV  LP+   K + + +V     R+ VR+ SG I +HNK+ + + GGICVANHT+PIDV++L  D  YAMVGQ  GG  G++Q+   +A   +WFERSE +DR  VTKRL++HI +   LPILIFPEGTCINNTSVMMFKKGSFE+GGTIYPVA+KY+ +F D FWNSSKY+L+ YL  +M+SWAIV DVWY+PP  ++E E+A++FANRVK  IA QGGL ++ WDGGLKR+  KD+ K+ QQK++SK I
Sbjct:   14 WLTLVGGLILLPSAFGLSLGISEIYMKILVKTLEWATLRIQKGA---PKESALKNSASVGIIQRDESPMEKGL----SGLR---------GRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEELVSWNLLTRTNVNFQYISPRLTMVWVLGVLVRYCFLLPLRVTLAFIGISLLIIGTTLVGQLPDSSLKNWLSELVHLTCCRICVRSLSGTIHYHNKQYRPQKGGICVANHTSPIDVLILATDGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEIKDRHLVTKRLKEHIADKKKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIYPVAIKYNPQFGDAFWNSSKYNLVSYLLRIMTSWAIVCDVWYMPPMTREEGEDAVQFANRVKSAIAVQGGLTELPWDGGLKRAKVKDTFKEEQQKNYSKMI 427          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q5R6J7|GPAT4_PONAB (Glycerol-3-phosphate acyltransferase 4 OS=Pongo abelii OX=9601 GN=GPAT4 PE=2 SV=2)

HSP 1 Score: 397.127 bits (1019), Expect = 2.598e-132
Identity = 207/424 (48.82%), Postives = 289/424 (68.16%), Query Frame = 1
Query:  115 LVGGIVGVLTGYRFIEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRT-HSYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            +V  I GV  G R   +LY+K LLK+FA+A  T+      + K   + +  + G   +D  ++  +++  +   +   +   D   +F L+D  YF + G+E I++D+VTKRFS+ E+E WNLLSRT +++Q+I+ +LT+LW +G   RY  LLP R+    T IS LV  + +V  LP  + K+F +  V  + +R+ VRA + +I +H++EN+ ++GGICVANHT+PIDVI+L  D  YAMVGQ  GG  G++Q+   +A   +WFERSE +DR  V KRL +H+++   LPILIFPEGTCINNTSVMMFKKGSFE+G T+YPVA+KYD +F D FWNSSKY ++ YL  MM+SWAIV  VWYLPP  ++  E+A++FANRVK  IA+QGGLVD+ WDGGLKR   KD+ K+ QQK +SK I
Sbjct:   31 IVPAIFGVSFGIR---KLYMKTLLKIFAWA--TLRMERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIR---RSGSSKALDNTPEFELSDIFYFCRKGMETIMDDEVTKRFSAEELESWNLLSRTNYNFQYISLRLTVLWGLGVLIRYCFLLPLRIALAFTGISLLVVGTTVVGYLPNGRFKEFMSKHVHLMCYRICVRALTAIITYHDRENRPRNGGICVANHTSPIDVIILASDGYYAMVGQVHGGLMGVIQRAMVKACPHVWFERSEVKDRHLVAKRLTEHVQDKSKLPILIFPEGTCINNTSVMMFKKGSFEIGATVYPVAIKYDPQFGDAFWNSSKYGMVTYLLRMMTSWAIVCSVWYLPPMTREADEDAVQFANRVKSAIARQGGLVDLLWDGGLKREKVKDTFKEEQQKLYSKMI 446          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q86UL3|GPAT4_HUMAN (Glycerol-3-phosphate acyltransferase 4 OS=Homo sapiens OX=9606 GN=GPAT4 PE=1 SV=1)

HSP 1 Score: 396.741 bits (1018), Expect = 3.674e-132
Identity = 207/424 (48.82%), Postives = 289/424 (68.16%), Query Frame = 1
Query:  115 LVGGIVGVLTGYRFIEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRT-HSYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            +V  I GV  G R   +LY+K LLK+FA+A  T+      + K   + +  + G   +D  ++  +++  +   +   +   D   +F L+D  YF + G+E I++D+VTKRFS+ E+E WNLLSRT +++Q+I+ +LT+LW +G   RY  LLP R+    T IS LV  + +V  LP  + K+F +  V  + +R+ VRA + +I +H++EN+ ++GGICVANHT+PIDVI+L  D  YAMVGQ  GG  G++Q+   +A   +WFERSE +DR  V KRL +H+++   LPILIFPEGTCINNTSVMMFKKGSFE+G T+YPVA+KYD +F D FWNSSKY ++ YL  MM+SWAIV  VWYLPP  ++  E+A++FANRVK  IA+QGGLVD+ WDGGLKR   KD+ K+ QQK +SK I
Sbjct:   31 IVPAIFGVSFGIR---KLYMKSLLKIFAWA--TLRMERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIR---RSGSSKALDNTPEFELSDIFYFCRKGMETIMDDEVTKRFSAEELESWNLLSRTNYNFQYISLRLTVLWGLGVLIRYCFLLPLRIALAFTGISLLVVGTTVVGYLPNGRFKEFMSKHVHLMCYRICVRALTAIITYHDRENRPRNGGICVANHTSPIDVIILASDGYYAMVGQVHGGLMGVIQRAMVKACPHVWFERSEVKDRHLVAKRLTEHVQDKSKLPILIFPEGTCINNTSVMMFKKGSFEIGATVYPVAIKYDPQFGDAFWNSSKYGMVTYLLRMMTSWAIVCSVWYLPPMTREADEDAVQFANRVKSAIARQGGLVDLLWDGGLKREKVKDTFKEEQQKLYSKMI 446          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q68F37|GPAT3_XENLA (Glycerol-3-phosphate acyltransferase 3 OS=Xenopus laevis OX=8355 GN=gpat3 PE=2 SV=1)

HSP 1 Score: 396.356 bits (1017), Expect = 3.868e-132
Identity = 207/410 (50.49%), Postives = 281/410 (68.54%), Query Frame = 1
Query:  157 IEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTHS-YQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKK-FNAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            I E+Y+K+L+KV  +A+  + +  + + K      S S G   RD   +  ++   +         IR+ +  F L D  YF K G EAI+ED+VT+RFSS E+  WNLL+RT++ + +++ ++T++WV+G   RY ILLP R+      IS LV  + LV  LP  + K  F+ +V  +  R+  RA S  I++HNKENK K GGICVANHT+PID+I+L  D  YAMVGQ  GG  G++Q+   RA   +WFERSE RDR  VT+RLR+H+ +   LPILIFPEGTCINNTSVMMFKKGSFE+GGTIYPVA+KYD +F D FWNSSK S++ YL  MM+SWA+  +VWYLPP ++++ E+A++FANRVK  IA+QGGLV++ WDGGLKR   KDS K+ QQK++S+ I
Sbjct:   35 ISEVYMKILVKVLEWATLRIQKGFKDKEKL-----SASNGIIQRDKSPMETEIECLRQS---RSQDIREGD--FELGDVFYFAKKGFEAIVEDEVTQRFSSEELISWNLLTRTNNNFHYVSLRVTLIWVLGLCVRYCILLPLRITLATIGISWLVLGATLVGQLPNSRMKSWFSELVHLMCCRICARALSSAIQYHNKENKPKKGGICVANHTSPIDIIILANDGCYAMVGQVHGGLMGIIQRAMARACPHVWFERSEMRDRHLVTERLREHVSDKSKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIYPVAIKYDPQFGDAFWNSSKNSMVSYLLRMMTSWALKCNVWYLPPVNRQDGEDAVQFANRVKSAIAKQGGLVELPWDGGLKRGKVKDSFKEEQQKNYSRII 434          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. TrEMBL
Match: A0A1I8J4J5 (PlsC domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 415.616 bits (1067), Expect = 6.559e-137
Identity = 212/420 (50.48%), Postives = 285/420 (67.86%), Query Frame = 1
Query:  157 IEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKF-----------NQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTHSYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            I  LYI++LL +F          EQ   KR+   R  S     RD   I R  +L  +GI+            ++A        F+L+D   FV+SGIE+IIED+VTKRF++ ++  WNLL+RT+ YQ I+ +LT  WV+G F RY IL P R+   +TA+  LV  S ++ LLP    +++ N++++  +FR+F RA+S V+RFH+ EN  ++ GICVANHT+PIDV+VLGC   +++VGQ  GGF G MQK   R +  IWFERSE+ D   V ++L +H+  PG  P+LIFPEGTCINNTSVMMF+KG FE GG +YPVA+KYD RFADCFWNSS   ++ YLFMMM+SWAIVADVWYLPP+ Q+E E+++ FANRVKR IA +GGLVD++WDG LKRS PK SL++  +++F K I
Sbjct:   40 IRRLYIRILLHLF----------EQAVEKRRPPSRKESSDNLSRDNRLIQRHAKLTTEGIELLHADCASSDDPSKASTSSQKRPFHLSDLCVFVQSGIESIIEDEVTKRFAAEDLASWNLLTRTNKYQFISSRLTCYWVLGCFLRYCILFPFRMLLALTAVLYLVIGSLIIALLPWPGLRRYLNSILTPTAFRLFARAFSAVLRFHDVENMPQNNGICVANHTSPIDVVVLGCRQVFSIVGQSHGGFTGFMQKTLHRTSPHIWFERSESSDASVVKRKLEEHVSTPGLPPVLIFPEGTCINNTSVMMFRKGGFEAGGVVYPVAIKYDPRFADCFWNSSACGMVTYLFMMMTSWAIVADVWYLPPQIQQEGESSVAFANRVKRQIAGRGGLVDLQWDGNLKRSKPKSSLQEQHREAFRKRI 449          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. TrEMBL
Match: A0A267GRC8 (PlsC domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010209g1 PE=4 SV=1)

HSP 1 Score: 415.231 bits (1066), Expect = 7.451e-137
Identity = 212/420 (50.48%), Postives = 285/420 (67.86%), Query Frame = 1
Query:  157 IEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKF-----------NQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTHSYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            I  LYI++LL +F          EQ   KR+   R  S     RD   I R  +L  +GI+            ++A        F+L+D   FV+SGIE+IIED+VTKRF++ ++  WNLL+RT+ YQ I+ +LT  WV+G F RY IL P R+   +TA+  LV  S ++ LLP    +++ N++++  +FR+F RA+S V+RFH+ EN  ++ GICVANHT+PIDV+VLGC   +++VGQ  GGF G MQK   R +  IWFERSE+ D   V ++L +H+  PG  P+LIFPEGTCINNTSVMMF+KG FE GG +YPVA+KYD RFADCFWNSS   ++ YLFMMM+SWAIVADVWYLPP+ Q+E E+++ FANRVKR IA +GGLVD++WDG LKRS PK SL++  +++F K I
Sbjct:   35 IRRLYIRILLHLF----------EQAVEKRRPPSRKESSDNLSRDNRLIQRHAKLTTEGIELLHADCASSDDPSKASTSSQKRPFHLSDLCVFVQSGIESIIEDEVTKRFAAEDLASWNLLTRTNKYQFISSRLTCYWVLGCFLRYCILFPFRMLLALTAVLYLVIGSLIIALLPWPGLRRYLNSILTPTAFRLFARAFSAVLRFHDVENMPQNNGICVANHTSPIDVVVLGCRQVFSIVGQSHGGFTGFMQKTLHRTSPHIWFERSESSDASVVKRKLEEHVSTPGLPPVLIFPEGTCINNTSVMMFRKGGFEAGGVVYPVAIKYDPRFADCFWNSSACGMVTYLFMMMTSWAIVADVWYLPPQIQQEGESSVAFANRVKRQIAGRGGLVDLQWDGNLKRSKPKSSLQEQHREAFRKRI 444          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. TrEMBL
Match: A0A087T4A4 (Glycerol-3-phosphate acyltransferase 4 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_10214 PE=4 SV=1)

HSP 1 Score: 408.683 bits (1049), Expect = 1.515e-134
Identity = 222/442 (50.23%), Postives = 302/442 (68.33%), Query Frame = 1
Query:   91 YVFILFTNLVGGIVGVLTGYRF-----IEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDV-------RLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTH-SYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSK 1374
            Y+FI+F      I+G+L    F     +   Y+ +LLK+F +    + + E    KR  I+  +   C D     I++ V       +L   GIK N+++      +F+L D + F+K+G+EAIIED+VTKRFS+ E+  WNLL+RT+ +Y  ++ +L+ILW VG   RY ILLP RLF  +  +  L+  + ++  +PE + KK+    VS + FR+  R++S ++ +HN+EN+AK GGICVANHT+PIDV++L CDN YA+VGQKQGGF G++Q+   RATS +WFER E +DR  VTKRL++H ++   LPILIFPEGTCINNTSVMMFKKGSFEVGGTIYP A+KYD RF D FWNSSK   + YL MMMSSWAIV DVWYLPP  ++E ENAI+FA RVK  I++QGGLVD++WDG LKR   K   K++QQ+ +S+
Sbjct:    7 YLFIIFWT---AIIGLLCLASFNASLGVRRKYVDILLKIFEFGRIKIEKAE----KRLKIE-PIETECNDLYHSVIDKKVNMGPLPSQLQVPGIKRNRSY-NTLKQEFDLFDVAEFIKAGVEAIIEDEVTKRFSAEELPSWNLLTRTNKNYGFVSFRLSILWGVGCILRYCILLPVRLFITVIGVGWLIICTTIIGYIPEGRFKKWLYWHVSLMCFRILARSFSAIVTYHNRENRAKGGGICVANHTSPIDVVILACDNCYALVGQKQGGFLGILQRALARATSHVWFERFEMKDRALVTKRLKEHCEDAEKLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPAAIKYDPRFGDPFWNSSKQGYVHYLLMMMSSWAIVCDVWYLPPMTRQEGENAIDFAKRVKSIISRQGGLVDLEWDGQLKRMQVKKEWKELQQQEYSR 439          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. TrEMBL
Match: W5UKL5 (Glycerol-3-phosphate acyltransferase 3 OS=Ictalurus punctatus OX=7998 GN=agpat9 PE=2 SV=1)

HSP 1 Score: 408.297 bits (1048), Expect = 2.070e-134
Identity = 211/411 (51.34%), Postives = 283/411 (68.86%), Query Frame = 1
Query:  157 IEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRDA-NNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTHS-YQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            I E Y+K+L+K   +A+  + ++ +   +++ +K S S G   RD      D  L+++  +  +   R      F  +D  YF K GIE+I+ED+VT+RFSS E+  WNLL+RT++ +Q+I+ +LT+LW VG   RY ILLP R+      +S LV  + +V  LP  + K + + +V  + +R+  R  S  I +HN+ENK + GGICVANHT+PIDV++L  D GYAMVGQ  GG  G++Q+   RA   IWFER+E +DR  VT+RLRDH+ +   LPILIFPEGTCINNTSVMMFKKGSFE+GGTIYPVA+KYD RF D FWNS KYS++ YL  MM+SWAIV +VWYLPP  Q+E E+A++FANRVK  IA+QGGLVD+ WDGGLKR+  KDS KQ QQK +S  +
Sbjct:   35 ITETYMKILIKTLEWATLKIQKSNR---EQEMLKHSTSSGLIQRD------DSSLEKELEELRRTRPRSGVGGAFAFSDVFYFSKKGIESIVEDEVTQRFSSEELVSWNLLTRTNNNFQYISLRLTVLWGVGVIIRYGILLPLRIMLACIGLSWLVIGTTIVGFLPNCRIKDWLSELVHIMCYRICARGLSATIHYHNRENKPRKGGICVANHTSPIDVVILANDGGYAMVGQVHGGLMGVVQRAMVRACPHIWFERAEMKDRHLVTQRLRDHVNDKNKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIYPVAIKYDPRFGDAFWNSGKYSMVNYLLRMMTSWAIVCNVWYLPPVTQQEGEDAVKFANRVKALIARQGGLVDLSWDGGLKRAKVKDSFKQEQQKMYSSMV 436          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. TrEMBL
Match: W5N2S0 (1-acylglycerol-3-phosphate O-acyltransferase 9, like OS=Lepisosteus oculatus OX=7918 PE=4 SV=1)

HSP 1 Score: 407.912 bits (1047), Expect = 3.228e-134
Identity = 215/440 (48.86%), Postives = 299/440 (67.95%), Query Frame = 1
Query:   88 YYVFILFTNLVGGIV------GVLTGYRFIEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRD-ANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTHS-YQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            ++V  ++  LV G++      G+  G   I E+Y+K+L+K   +A+  +        ++  IK S+S G   RD      D  ++++  +   +  +  A+  F ++D  YF + GIE+I+ED+VT+RF+S E+  WNLL+RT++ +Q+I+ +LTI+WVVG   RY +LLP R+   +  IS LV S+ LV LLP    K + + +V  + +R+  R  S  I +HNKEN+ K GGICVANHT+PIDV++L  D  YAMVGQ  GG  G++Q+   +A   +WFERSE +DR  VTKRLRDH+ +   LPILIFPEGTCINNTSVMMFKKGSFE+GGTIYPVA+KYD +F D FWNS KYS++ YL  MM+SWAIV +VWYLPP  ++E E+A++FANRVK  IA+QGGLVD+ WDGGLKR+  K++ K+ QQK +S  I
Sbjct:    9 FHVLSVWLTLVVGLIMLPAMFGISLG---ITEVYMKILMKTLEWATLRIQRGRN---EKHSIKASVSNGIIQRD-----GDSSMEKEIAELRGSRSKPPASGDFQMSDVFYFNRKGIESIVEDEVTQRFTSEELVSWNLLTRTNNNFQYISLRLTIIWVVGVLIRYCVLLPLRVTLAVIGISWLVISTSLVGLLPNSSVKNWLSELVHLMCYRICARGLSATINYHNKENRPKKGGICVANHTSPIDVVILANDGCYAMVGQVHGGLLGIIQRSIVKACPHVWFERSEMKDRHLVTKRLRDHVADKSKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIYPVAIKYDPQFGDAFWNSGKYSMVSYLVRMMTSWAIVCNVWYLPPMTRQEGEDAVQFANRVKAVIARQGGLVDLSWDGGLKRAKVKETFKEQQQKMYSNMI 437          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Cavefish
Match: agpat9l (glycerol-3-phosphate acyltransferase 3-like [Source:NCBI gene;Acc:103045911])

HSP 1 Score: 398.282 bits (1022), Expect = 5.527e-134
Identity = 205/410 (50.00%), Postives = 285/410 (69.51%), Query Frame = 1
Query:  157 IEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTHS-YQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            I E Y+K+L+K   +A+  + ++ + E+K K    +   G   RD  ++ +++   +          R+   +F L+D  YF + GIE+I+ED+VT+RF+S E+  WNLL+RT++ +Q+I+ +LT+LWV+G   RY ILLP R+      +S LV S+ +V  LP    K + + +V  + +R+  R  S  I +HN++NK K GGICVANHT+PIDV++L  D GYAMVGQ  GG  G++Q+   RA   IWFER+E +DR  VT+RLRDH+K+   LPILIFPEGTCINNTSVMMFKKGSFE+GGTIYPVA+KYD +F D FWNS+KY+++ YL  MM+SWAIV +VWYLPP  Q+E E+A++FANRVK  IA QGGL+D+ WDGGLKR+  K++ KQ QQK +S  +
Sbjct:   35 ITETYMKILIKTLKWATLKIQKSVEEESKLKSSSSN---GLIQRDDSSLEKEIGERR----------RNRGGEFILSDVFYFSRKGIESIVEDEVTQRFTSEELVSWNLLTRTNNNFQYISMKLTVLWVIGVAVRYGILLPLRVSLTAIGLSWLVISTTVVGFLPNCWLKNWLSELVHVMCYRICARGLSATIHYHNRQNKPKKGGICVANHTSPIDVVILANDGGYAMVGQVHGGLMGVLQRAMVRACPHIWFERAEMKDRHLVTQRLRDHVKDKKKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIYPVAIKYDPQFGDAFWNSAKYNMVSYLLRMMTSWAIVCNVWYLPPVTQQEGEDAVQFANRVKSAIAHQGGLLDLAWDGGLKRAKVKETYKQEQQKKYSSMV 431          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Cavefish
Match: gpat4 (glycerol-3-phosphate acyltransferase 4 [Source:NCBI gene;Acc:103029209])

HSP 1 Score: 389.037 bits (998), Expect = 2.972e-130
Identity = 205/436 (47.02%), Postives = 288/436 (66.06%), Query Frame = 1
Query:   88 YYVFILFTNLVGGIVGVLTGYRFIEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDV---RLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRT-HSYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKFNAVVSKL-SFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            ++  +L   +V  + GV  G R    LY+  LLK+F +A  T+      + K + + +  S G   +++ ++ +++   R    G     A       +F ++D  +F + G+E+I++D+VTKRF++ E+E WNLL+R+ +++ HI+ +LT+LW +G   RY ILLP R+    T +  LV  + L+ LLP    K F +  + L  +R+ VRA + +I +H+ ENK K+GGICVANHT+PIDVI+L  D  YAMVGQ  GG  G++Q+   +A   IWFERSE +DR  V KRL DH+ +   LPILIFPEGTCINNTSVMMFKKGSFE+G T+YPVA+KYD RF D FWNSSK+ ++ YL  MMSSWAIV  VWYLPP  ++ESE+A++FANRVK  IA++GGL D+ WDGGLKR   K+  K+ QQK +SK +
Sbjct:   19 WFTLLLVFIIVPAVFGVSFGIR---RLYMNTLLKIFEWA--TLRMERGAKEKNQQLYKPYSNGIIAKELASLEQEMQEMRRSGSGSALGGA-------EFEMSDIFHFCRRGVESIVDDEVTKRFTAEELESWNLLTRSNYNFNHISTRLTVLWGLGVLIRYGILLPLRVTLAFTGVGLLVFLTSLIGLLPNGGMKSFLSEKAHLMCYRICVRALTAIITYHDSENKPKNGGICVANHTSPIDVIILSSDGCYAMVGQVHGGLMGVIQRAMVKACPHIWFERSEVKDRHLVAKRLSDHVADKTKLPILIFPEGTCINNTSVMMFKKGSFEIGCTVYPVAIKYDPRFGDAFWNSSKFGMVNYLLHMMSSWAIVCSVWYLPPMSREESEDAVQFANRVKAAIARKGGLADLLWDGGLKRDKVKEVFKEEQQKLYSKVL 442          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Cavefish
Match: gpat4 (glycerol-3-phosphate acyltransferase 4 [Source:NCBI gene;Acc:103029209])

HSP 1 Score: 389.037 bits (998), Expect = 2.972e-130
Identity = 205/436 (47.02%), Postives = 288/436 (66.06%), Query Frame = 1
Query:   88 YYVFILFTNLVGGIVGVLTGYRFIEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDV---RLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRT-HSYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKFNAVVSKL-SFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            ++  +L   +V  + GV  G R    LY+  LLK+F +A  T+      + K + + +  S G   +++ ++ +++   R    G     A       +F ++D  +F + G+E+I++D+VTKRF++ E+E WNLL+R+ +++ HI+ +LT+LW +G   RY ILLP R+    T +  LV  + L+ LLP    K F +  + L  +R+ VRA + +I +H+ ENK K+GGICVANHT+PIDVI+L  D  YAMVGQ  GG  G++Q+   +A   IWFERSE +DR  V KRL DH+ +   LPILIFPEGTCINNTSVMMFKKGSFE+G T+YPVA+KYD RF D FWNSSK+ ++ YL  MMSSWAIV  VWYLPP  ++ESE+A++FANRVK  IA++GGL D+ WDGGLKR   K+  K+ QQK +SK +
Sbjct:   19 WFTLLLVFIIVPAVFGVSFGIR---RLYMNTLLKIFEWA--TLRMERGAKEKNQQLYKPYSNGIIAKELASLEQEMQEMRRSGSGSALGGA-------EFEMSDIFHFCRRGVESIVDDEVTKRFTAEELESWNLLTRSNYNFNHISTRLTVLWGLGVLIRYGILLPLRVTLAFTGVGLLVFLTSLIGLLPNGGMKSFLSEKAHLMCYRICVRALTAIITYHDSENKPKNGGICVANHTSPIDVIILSSDGCYAMVGQVHGGLMGVIQRAMVKACPHIWFERSEVKDRHLVAKRLSDHVADKTKLPILIFPEGTCINNTSVMMFKKGSFEIGCTVYPVAIKYDPRFGDAFWNSSKFGMVNYLLHMMSSWAIVCSVWYLPPMSREESEDAVQFANRVKAAIARKGGLADLLWDGGLKRDKVKEVFKEEQQKLYSKVL 442          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Cavefish
Match: gpat3 (glycerol-3-phosphate acyltransferase 3 [Source:NCBI gene;Acc:103026777])

HSP 1 Score: 385.185 bits (988), Expect = 7.460e-129
Identity = 204/442 (46.15%), Postives = 289/442 (65.38%), Query Frame = 1
Query:   67 FLALLLPYYVFILFTNLV-GGIVGVLTGYRFIEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRD-VRLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTH-SYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
             + L++  ++F++   +V   + GV  G+    +LYIK+L+K+  +A+  +   ++   ++  +   +  G  +R+  ++    V L +   KF+          F L D  YF K GIE+I++D+VT+RF+S E+  WNLL+RT+ ++ +I+ ++TI+W +G F RY ILLP R+      +S LV  + LV LLP    K + + V+    +R+  R  S  IR+H+KEN+ K GGICVANHT+PID+++L  D  YAMVGQ  GG  G++Q+   R+   +WFERSE +DR  V KRL+DHI +    PILIFPEGTCINNTSVMMFKKGSFE+GGTIYPVA+KYD +F D FWNS KY+++ YL  MM+SWAIV +VWYLPP   ++ E+A+ FANRVK  IA QGGL+D+ WDGGLKR   K S K+ QQK +S  I
Sbjct:    8 LVLLVMEVWLFVVLGLIVLPAMFGVSLGF---TDLYIKVLVKILEWATRRIQRGQK---EQDTLPAHLPNGIIERNDDSMEEQIVELRRSHPKFHSV------GDFTLCDAFYFCKKGIESIVDDEVTQRFTSEELVSWNLLTRTNINFHYISVRVTIIWGLGLFIRYCILLPLRVTLAAIGLSWLVIGTTLVGLLPNSNVKNWLSDVIHMTCYRICARGLSARIRYHSKENRPKKGGICVANHTSPIDIVILANDGCYAMVGQIHGGLMGVIQRSMVRSCPHVWFERSEMKDRHAVAKRLKDHIADKSKQPILIFPEGTCINNTSVMMFKKGSFEIGGTIYPVAIKYDPQFGDAFWNSGKYNMVSYLLRMMTSWAIVCNVWYLPPMSIQDGEDAVHFANRVKSAIALQGGLMDLSWDGGLKREKVKQSFKEEQQKMYSSMI 437          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Cavefish
Match: gpat3 (glycerol-3-phosphate acyltransferase 3 [Source:NCBI gene;Acc:103026777])

HSP 1 Score: 385.185 bits (988), Expect = 7.460e-129
Identity = 204/442 (46.15%), Postives = 289/442 (65.38%), Query Frame = 1
Query:   67 FLALLLPYYVFILFTNLV-GGIVGVLTGYRFIEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRD-VRLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTH-SYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
             + L++  ++F++   +V   + GV  G+    +LYIK+L+K+  +A+  +   ++   ++  +   +  G  +R+  ++    V L +   KF+          F L D  YF K GIE+I++D+VT+RF+S E+  WNLL+RT+ ++ +I+ ++TI+W +G F RY ILLP R+      +S LV  + LV LLP    K + + V+    +R+  R  S  IR+H+KEN+ K GGICVANHT+PID+++L  D  YAMVGQ  GG  G++Q+   R+   +WFERSE +DR  V KRL+DHI +    PILIFPEGTCINNTSVMMFKKGSFE+GGTIYPVA+KYD +F D FWNS KY+++ YL  MM+SWAIV +VWYLPP   ++ E+A+ FANRVK  IA QGGL+D+ WDGGLKR   K S K+ QQK +S  I
Sbjct:    8 LVLLVMEVWLFVVLGLIVLPAMFGVSLGF---TDLYIKVLVKILEWATRRIQRGQK---EQDTLPAHLPNGIIERNDDSMEEQIVELRRSHPKFHSV------GDFTLCDAFYFCKKGIESIVDDEVTQRFTSEELVSWNLLTRTNINFHYISVRVTIIWGLGLFIRYCILLPLRVTLAAIGLSWLVIGTTLVGLLPNSNVKNWLSDVIHMTCYRICARGLSARIRYHSKENRPKKGGICVANHTSPIDIVILANDGCYAMVGQIHGGLMGVIQRSMVRSCPHVWFERSEMKDRHAVAKRLKDHIADKSKQPILIFPEGTCINNTSVMMFKKGSFEIGGTIYPVAIKYDPQFGDAFWNSGKYNMVSYLLRMMTSWAIVCNVWYLPPMSIQDGEDAVHFANRVKSAIALQGGLMDLSWDGGLKREKVKQSFKEEQQKMYSSMI 437          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Sea Lamprey
Match: gpat4 (glycerol-3-phosphate acyltransferase 4 [Source:ZFIN;Acc:ZDB-GENE-060421-5102])

HSP 1 Score: 391.734 bits (1005), Expect = 8.324e-132
Identity = 222/451 (49.22%), Postives = 296/451 (65.63%), Query Frame = 1
Query:   43 ALMLSIVPFLALLLPYYVFILFTNLVGGIVGVLTGYRFIEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVR---LDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTHSY-QHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            AL LS+  +L +LL   VFI+     G   G+ T       +Y++ LLK+F +A+  +          +GIK S     Y+ +   I   V    L ++  K   A   +   +F LAD  YF + G+EAI+EDDVTKRF++ E+E WNLL+RT++Y Q+I+ +LT+LW +G   RY  LLP R+      I  LV S+ L+   PE + K++ +  V  +S R+  RA + +I +HN+EN  K GGICVANHT+PIDVI+L  D  YAMVGQK GG  G++Q+   +A   ++FERSE +DR  VTKRL +H+ +   LPILIFPEGTCINNTSVMMFKKGSFE+ GTIYPVA+KYD +F D FWNSSKY ++ YL  MMSSWAIV +VWYLPP  ++E E+A++FANRVK  IA QGGLVD+ WDGGLKR   K++ K+ QQK +SK I
Sbjct:   16 ALGLSLSVWLTILL---VFIVVPATFGISFGIRT-------IYMRSLLKIFEWATLRI---------ERGIKESKH-RAYNTNSNGILVKVEESSLGEEIAKGRLAVGGEPAPEFGLADTFYFCRKGLEAIVEDDVTKRFTAEEIESWNLLTRTNNYFQYISVRLTVLWGLGVAVRYGFLLPLRVTLAFIGIGWLVVSTTLLGYFPEGKMKEWLSDQVHLMSMRICARALTAIISYHNRENMPKKGGICVANHTSPIDVIILANDRCYAMVGQKHGGLMGVIQRAIVKACPHVFFERSEIKDRNLVTKRLSEHVADKNKLPILIFPEGTCINNTSVMMFKKGSFEIQGTIYPVAIKYDPQFGDAFWNSSKYGMVNYLLRMMSSWAIVCNVWYLPPMTRREDEDAVQFANRVKAEIASQGGLVDLLWDGGLKRGKVKNTFKEEQQKQYSKTI 446          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Nematostella
Match: EDO37111 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGS1])

HSP 1 Score: 386.726 bits (992), Expect = 7.039e-130
Identity = 213/463 (46.00%), Postives = 289/463 (62.42%), Query Frame = 1
Query:   67 FLALLLPYYVFILFTNLVGGIVGVLTGYRF-IEELYIKLLLKVFAYASSTVSE---------------------NEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTH-SYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQ-GKKFNAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFIK 1383
            F A LL    + LF+ L   ++    G+ F I +LY+K+L K+F + ++ +SE                      E +E  R  + R+ S G + R+                            F +AD   F KSG+EAII+DDVTKRFS+ E+E WNLL+RT+ +Y +++ +L+ +WV+G   RY +LLP R+  F   ++ L  S+  +  LP+    KK   V    SFR+  +A S VIR HNKEN AK GGICVANHT+PIDV++L CDN Y+MVGQ+Q G FG ++KV  +    IWFERSE +DR  VT+RL++H+++    PILIFPEGTCINNTSVMMFKKGSFE+GG IYPVA+KYDS F D FWNSS  S  +YLF +M+SWA+V DVWYL P +++E E+ ++FANRVK  IA QGGLVD+ WDG LKRS  K   +Q +Q+ ++  +K
Sbjct:    4 FTACLLISLCYFLFS-LSFIVIPAALGFSFGIRDLYVKILFKIFEHETNMLSEVLLNSIPLMMFLITIGVIAREQESLEPPRSPLPRNRSFGTFQRE----------------------------FEMADIMDFCKSGVEAIIDDDVTKRFSAEELECWNLLTRTNKNYHYVSKRLSFVWVLGGLFRYFVLLPVRVTIFSIGLTVLTLSTAFLSQLPQSSFRKKLERVFMLASFRILSKATSAVIRSHNKENMAKGGGICVANHTSPIDVLILQCDNCYSMVGQRQPGLFGFIEKVLEKTQDHIWFERSEMKDRIIVTRRLKEHVEDDTKNPILIFPEGTCINNTSVMMFKKGSFEIGGVIYPVAIKYDSTFGDAFWNSSSESFGQYLFSLMTSWALVCDVWYLKPMYKREDESPVQFANRVKAEIAAQGGLVDLIWDGQLKRSAVKPEYRQKRQEDYASRLK 437          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Nematostella
Match: EDO41615 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3X7])

HSP 1 Score: 62.003 bits (149), Expect = 6.866e-11
Identity = 46/177 (25.99%), Postives = 80/177 (45.20%), Query Frame = 1
Query:  769 ICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPIL-IFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQ--KESENAIEFANRVKRNIAQQGGL 1290
            + VA H+T ID + L      + V +K+     ++  V G     I+  R++   R+     ++      G  P L IFPEGTC N   ++ FK G+F  G  + P+ +KY +      W  S    L+ L++ M  +    ++  LP  +   +E  +A  FA  V+  ++   G+
Sbjct:   14 LAVAPHSTFIDALALAVIGTPSGVSRKENDKIPIIGSVIG-TLQPIYVARTDPNSRQNTISEIKKRALSHGKWPHLCIFPEGTCTNRQCLITFKPGAFYAGSPVQPIILKYPNHLDTVTWTWSGPGALKLLWLTMCQFHNFLEIEILPVYYPCTEEINDAKLFARNVRMQMSSALGV 189          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Nematostella
Match: EDO47389 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMR0])

HSP 1 Score: 52.7582 bits (125), Expect = 1.982e-7
Identity = 49/193 (25.39%), Postives = 82/193 (42.49%), Query Frame = 1
Query:  727 IRFHNKENKAKSGGICV-ANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDR-EGVTKRLRDHIKEPGSLPIL-IFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLP--PEHQKESENAIEFANRVKRNIAQQGGL 1290
            +R   K    +   ICV A H++ +DV++    +       K   F          A+ +I   R   + R + V +     +   G  P L + PEGTC N  +++ FK G+F  G  + P+  KY        W +   S  + L  +M      A+V +LP    + +E EN   FA  V+ ++A+  G+
Sbjct:    6 VRVKGKLASPQEAPICVYAPHSSFLDVLLASVLDEVPSGLSKAENFRNPFLGALFMASESIGVSRDSAKSRLQSVEEVKYRTVVTRGQWPHLGVCPEGTCTNRKALITFKAGAFIPGCPVQPILFKYPGTPDVYTWVNDGPSGFQLLMFIMCQLHHPAEVEFLPVWQPNNEEMENPKLFAENVQNSMAKALGI 198          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Medaka
Match: GPAT4 (glycerol-3-phosphate acyltransferase 4 [Source:NCBI gene;Acc:101171838])

HSP 1 Score: 392.889 bits (1008), Expect = 1.352e-131
Identity = 205/434 (47.24%), Postives = 292/434 (67.28%), Query Frame = 1
Query:   88 YYVFILFTNLVGGIVGVLTGYRFIEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVR-LDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTHS-YQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            ++  +L   +V  I GV  G R    LY+K LLK+F +A+  +    +   K   + +  S     ++  ++  +++ + + G   +      +  +F ++D  YF + G+E+I++D+VTKRFS+ E+E WNLL+R+++ +Q+I+ +LT+LW +G   RY  LLP R+    T +  LV  + +V LLP  + K F +  V  + +R+ VRA + +I +H+ ENK K+GGICVANHT+PIDVI+L  D  YAMVGQ  GG  G++Q+   +A   +WFERSE +DR  V KRL DH+++   LPILIFPEGTCINNTSVMMFKKGSFE+G T+YPVA+KYD RF D FWNSSK+ ++ YL  MMSSWAIV  VWYLPP  ++E E+A++FANRVK  IA+QGGLVD+ WDGGLKR+  KD+ K+ QQK +SK +
Sbjct:   23 WFTMLLVFIIVPAIFGVSFGIR---RLYMKTLLKIFEWATLRIERGAK--EKNHPLYKPYSNAIIAKEPTSLEEEIKEIRRSGSNKDLG----STPEFEMSDIFYFARRGVESIMDDEVTKRFSAEELESWNLLTRSNNNFQYISLRLTVLWGLGVLIRYGFLLPLRVTLAFTGVGLLVFLTSVVGLLPNGRMKGFLSEKVHLMCYRICVRALTAIITYHDSENKPKNGGICVANHTSPIDVIILASDGCYAMVGQIHGGLMGVIQRSMVKACPHVWFERSEVKDRHLVAKRLSDHVQDKSKLPILIFPEGTCINNTSVMMFKKGSFEIGATVYPVAIKYDPRFGDAFWNSSKFGMVNYLLRMMSSWAIVCSVWYLPPMSREEGEDAVQFANRVKAAIARQGGLVDLLWDGGLKRAKVKDTFKEEQQKLYSKML 447          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Medaka
Match: agpat9l (glycerol-3-phosphate acyltransferase 3-like [Source:NCBI gene;Acc:101167873])

HSP 1 Score: 388.652 bits (997), Expect = 3.866e-130
Identity = 201/419 (47.97%), Postives = 282/419 (67.30%), Query Frame = 1
Query:  157 IEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDV-RLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTHS-YQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFIKTSE*NED 1404
            I E Y+  L+K   +A+  + +    E + K +    S G   R+  ++ +++  L +   K            F L+D  YF + GIE+I+ED+VT+RFSS E+  WNLL+RT++ +Q+I+ +LT+++ +G F RY IL P R+      ++ LV  +  V LLP+ + K + +  V  + +R+  R  S  I +HN+ENK K GGICVANHT+PID+++L  D  YAMVGQ  GG  G++Q+   R+   +WFER+E +DR  VTKRLRDH+ +   LPILIFPEGTCINNTSVMMFKKGSFE+GGTIYPVA+KYD +F D FWNSSKYS++ YL  MM+SWA+V +VWYLPP HQKE E+A++FANRVK  IA +GGLVD++WDGGLKR+  K+S K+ +QK +S  +   + + D
Sbjct:   35 ISETYMTFLVKTLEWATLKIQKAHADEQELKALA---SNGLIKRENGSMEKELGELRRSRPK------PPVGGDFTLSDSFYFTRRGIESIVEDEVTQRFSSEELVSWNLLTRTNNDFQYISLRLTLVYGLGIFVRYCILAPLRITLACIGLTWLVIGTSAVGLLPDWRIKSWISEWVHVMCYRICARGLSATIHYHNRENKPKKGGICVANHTSPIDIVILCNDGCYAMVGQVHGGLMGVVQRAMVRSCPHVWFERAEMKDRHLVTKRLRDHVNDKKKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIYPVAIKYDPKFGDAFWNSSKYSMVSYLLRMMTSWALVCNVWYLPPMHQKEGEDAVQFANRVKSAIAHRGGLVDLQWDGGLKRAKVKESFKEQEQKKYSSMVVGEDSHSD 444          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Medaka
Match: agpat9l (glycerol-3-phosphate acyltransferase 3-like [Source:NCBI gene;Acc:101167873])

HSP 1 Score: 388.652 bits (997), Expect = 3.866e-130
Identity = 201/419 (47.97%), Postives = 282/419 (67.30%), Query Frame = 1
Query:  157 IEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDV-RLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTHS-YQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFIKTSE*NED 1404
            I E Y+  L+K   +A+  + +    E + K +    S G   R+  ++ +++  L +   K            F L+D  YF + GIE+I+ED+VT+RFSS E+  WNLL+RT++ +Q+I+ +LT+++ +G F RY IL P R+      ++ LV  +  V LLP+ + K + +  V  + +R+  R  S  I +HN+ENK K GGICVANHT+PID+++L  D  YAMVGQ  GG  G++Q+   R+   +WFER+E +DR  VTKRLRDH+ +   LPILIFPEGTCINNTSVMMFKKGSFE+GGTIYPVA+KYD +F D FWNSSKYS++ YL  MM+SWA+V +VWYLPP HQKE E+A++FANRVK  IA +GGLVD++WDGGLKR+  K+S K+ +QK +S  +   + + D
Sbjct:   35 ISETYMTFLVKTLEWATLKIQKAHADEQELKALA---SNGLIKRENGSMEKELGELRRSRPK------PPVGGDFTLSDSFYFTRRGIESIVEDEVTQRFSSEELVSWNLLTRTNNDFQYISLRLTLVYGLGIFVRYCILAPLRITLACIGLTWLVIGTSAVGLLPDWRIKSWISEWVHVMCYRICARGLSATIHYHNRENKPKKGGICVANHTSPIDIVILCNDGCYAMVGQVHGGLMGVVQRAMVRSCPHVWFERAEMKDRHLVTKRLRDHVNDKKKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIYPVAIKYDPKFGDAFWNSSKYSMVSYLLRMMTSWALVCNVWYLPPMHQKEGEDAVQFANRVKSAIAHRGGLVDLQWDGGLKRAKVKESFKEQEQKKYSSMVVGEDSHSD 444          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Medaka
Match: gpat3 (glycerol-3-phosphate acyltransferase 3 [Source:NCBI gene;Acc:101157182])

HSP 1 Score: 376.711 bits (966), Expect = 2.340e-125
Identity = 197/437 (45.08%), Postives = 279/437 (63.84%), Query Frame = 1
Query:   88 YYVFILFTNLVGGIVGVLTGYRFIEELYIKLLLKVFAYASSTVSENEQIE----TKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRT-HSYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            + + ++F  ++  + G+  G   +  +YI++L+++  +A+  +    Q +    T   GI      G  + +M      +RL +          R    +F+L+D  YF + G+E+I+ED VT+RFSS E+  WNLL+RT  ++Q+I+ +LTI WV+G F RY +LLP R+   +  +S LV  + +V  LPE   K + + +V    +R+  R  S  I +HNKEN+ + GGICVANHTTPIDV++L  D  YAMVGQ   G  G++Q+   R+   IWFERSE +DR  VT RLR H+     LPILIFPEGTC+NNTSV+MFKKGSFEV GTI+PVA+KYD RF D FWNS+KY+++ YL  MM+SWAIV +VWYLPP   +  E+A  FA+RVK  IA++GGL+D+ WDGGLKR   KD  ++ QQK +S  +
Sbjct:   15 WLLIVVFFIVLPAMFGISLG---VSGVYIQVLVRILQWATVRIQRGRQEQPGGATPSAGIIEHTG-GSMEEEM----EQLRLSR----------RPEAGEFSLSDAIYFCQKGLESIVEDQVTQRFSSEELASWNLLTRTNQNFQYISLRLTIFWVLGVFVRYGVLLPLRVALAVIGLSWLVLGTTVVGFLPESSMKNWLSELVHLTCYRICARGLSATIHYHNKENRPQKGGICVANHTTPIDVVILANDGCYAMVGQIHRGLMGVIQRSMVRSCPHIWFERSEMKDRHAVTSRLRAHVSARTKLPILIFPEGTCVNNTSVLMFKKGSFEVRGTIHPVAIKYDPRFGDAFWNSTKYNMVSYLLRMMTSWAIVVNVWYLPPMTIQAGEDAAHFASRVKSAIARRGGLLDLAWDGGLKRGKVKDCFREEQQKMYSSTV 433          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Medaka
Match: gpat3 (glycerol-3-phosphate acyltransferase 3 [Source:NCBI gene;Acc:101157182])

HSP 1 Score: 372.474 bits (955), Expect = 8.108e-124
Identity = 182/343 (53.06%), Postives = 241/343 (70.26%), Query Frame = 1
Query:  358 RDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRT-HSYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKF-NAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFI 1380
            R    +F+L+D  YF + G+E+I+ED VT+RFSS E+  WNLL+RT  ++Q+I+ +LTI WV+G F RY +LLP R+   +  +S LV  + +V  LPE   K + + +V    +R+  R  S  I +HNKEN+ + GGICVANHTTPIDV++L  D  YAMVGQ   G  G++Q+   R+   IWFERSE +DR  VT RLR H+     LPILIFPEGTC+NNTSV+MFKKGSFEV GTI+PVA+KYD RF D FWNS+KY+++ YL  MM+SWAIV +VWYLPP   +  E+A  FA+RVK  IA++GGL+D+ WDGGLKR   KD  ++ QQK +S  +
Sbjct:   89 RPEAGEFSLSDAIYFCQKGLESIVEDQVTQRFSSEELASWNLLTRTNQNFQYISLRLTIFWVLGVFVRYGVLLPLRVALAVIGLSWLVLGTTVVGFLPESSMKNWLSELVHLTCYRICARGLSATIHYHNKENRPQKGGICVANHTTPIDVVILANDGCYAMVGQIHRGLMGVIQRSMVRSCPHIWFERSEMKDRHAVTSRLRAHVSARTKLPILIFPEGTCVNNTSVLMFKKGSFEVRGTIHPVAIKYDPRFGDAFWNSTKYNMVSYLLRMMTSWAIVVNVWYLPPMTIQAGEDAAHFASRVKSAIARRGGLLDLAWDGGLKRGKVKDCFREEQQKMYSSTV 431          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Planmine SMEST
Match: SMESG000061821.1 (SMESG000061821.1)

HSP 1 Score: 898.271 bits (2320), Expect = 0.000e+0
Identity = 448/448 (100.00%), Postives = 448/448 (100.00%), Query Frame = 1
Query:   49 MLSIVPFLALLLPYYVFILFTNLVGGIVGVLTGYRFIEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTHSYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKFNAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVXXXXXXXXXXXXXVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFIKTSE 1392
            MLSIVPFLALLLPYYVFILFTNLVGGIVGVLTGYRFIEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTHSYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKFNAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVGQKQGGFFGMMQKVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFIKTSE
Sbjct:    1 MLSIVPFLALLLPYYVFILFTNLVGGIVGVLTGYRFIEELYIKLLLKVFAYASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQAFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTHSYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLPEQQGKKFNAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPIDVIVLGCDNGYAMVGQKQGGFFGMMQKVFGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEFANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFIKTSE 448          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Planmine SMEST
Match: SMESG000009198.1 (SMESG000009198.1)

HSP 1 Score: 67.781 bits (164), Expect = 1.171e-11
Identity = 42/136 (30.88%), Postives = 69/136 (50.74%), Query Frame = 1
Query:  883 FGRATSTIWFERSETRDREGVTKRLRDHIKEPGSLP-ILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCF-WNSSKYSLLEYLFMMMSSWAIVADVWYLP--PEHQKESENAIEFANRVKRNIAQ 1278
             G+    IW  R +   R    + L +  K  G +P I++FPEGT  N T ++ FK G+F  G  + PV +++ +R  DC  W + +  +L   +MM+  +     V YLP    ++KE  +A  F N V+  +A+
Sbjct:  174 LGKLLQPIWVNREDVNSRLRTVELLSERSKYAGKMPQIVVFPEGTTTNRTCLINFKAGAFIPGVPVQPVLIRFPNR-VDCITWTNEQLPVLLTSWMMLCQFHNRCIVEYLPVYVPNEKEKHDAKLFGNNVRDQMAR 308          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Planmine SMEST
Match: SMESG000003820.1 (SMESG000003820.1)

HSP 1 Score: 56.9954 bits (136), Expect = 2.884e-8
Identity = 36/134 (26.87%), Postives = 63/134 (47.01%), Query Frame = 1
Query:  889 RATSTIWFERSETRDREGVTKRL--RDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESE--NAIEFANRVKRNIAQ 1278
            + T  I   R +   R+     +  R H  E     +LIFPEGTC N + ++ FK G+F  G ++ PV +++ ++     W      +   L+M+ +      ++ +LP  H  E E  N   FA+ V+  +A+
Sbjct:  180 KMTQPILVTREDPNSRQTTIDEIKRRSHCCEAWP-QMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAK 312          
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Planmine SMEST
Match: SMESG000045185.1 (SMESG000045185.1)

HSP 1 Score: 55.4546 bits (132), Expect = 8.524e-8
Identity = 34/134 (25.37%), Postives = 62/134 (46.27%), Query Frame = 1
Query:  889 RATSTIWFERSETRDREGVTKRLRDHIKEPGSLP-ILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESE--NAIEFANRVKRNIAQQ 1281
            + T  +   R +   R+     +        + P +LIFPEGTC N TS++ FK G+F  G  + PV +++ +   +  W      +   L+M ++ +    ++ +LP       E  N   FAN V+  +A++
Sbjct:  175 KMTQPVLVNREDANSRQKTIDEINRRCTLTENWPQMLIFPEGTCTNRTSLINFKTGAFTSGQPVQPVILRWPNYVDNTTWTWEGPGVCMLLWMTLTQFHTRVEMEFLPAYFPSPEEKFNPSLFANNVRLLMAEK 308          
The following BLAST results are available for this feature:
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GPAT47.650e-13348.82glycerol-3-phosphate acyltransferase 4 [Source:HGN... [more]
GPAT31.990e-13248.84glycerol-3-phosphate acyltransferase 3 [Source:HGN... [more]
GPAT31.990e-13248.84glycerol-3-phosphate acyltransferase 3 [Source:HGN... [more]
GPAT31.990e-13248.84glycerol-3-phosphate acyltransferase 3 [Source:HGN... [more]
GPAT41.571e-2336.02glycerol-3-phosphate acyltransferase 4 [Source:HGN... [more]
back to top
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acl-53.109e-12354.46ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc... [more]
acl-51.030e-12246.17ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc... [more]
acl-51.030e-12246.17ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc... [more]
acl-48.368e-11450.58ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc... [more]
acl-44.456e-11350.45ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gpat43.319e-12445.29gene:FBgn0034971 transcript:FBtr0302165[more]
Gpat46.070e-12345.29gene:FBgn0034971 transcript:FBtr0072179[more]
Gpat41.141e-9259.66gene:FBgn0034971 transcript:FBtr0343336[more]
CG154502.987e-7941.14gene:FBgn0031132 transcript:FBtr0077280[more]
Gpat44.715e-7563.10gene:FBgn0034971 transcript:FBtr0343337[more]
back to top
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpat31.159e-13446.83glycerol-3-phosphate acyltransferase 3 [Source:NCB... [more]
gpat31.159e-13446.83glycerol-3-phosphate acyltransferase 3 [Source:NCB... [more]
gpat31.363e-13446.83glycerol-3-phosphate acyltransferase 3 [Source:NCB... [more]
agpat9l2.542e-13248.421-acylglycerol-3-phosphate O-acyltransferase 9, li... [more]
agpat9l2.542e-13248.421-acylglycerol-3-phosphate O-acyltransferase 9, li... [more]
back to top
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpat41.102e-13546.54glycerol-3-phosphate acyltransferase 4 [Source:NCB... [more]
hnrnpu4.011e-13450.85heterogeneous nuclear ribonucleoprotein U (scaffol... [more]
gpat46.844e-13347.38glycerol-3-phosphate acyltransferase 4 [Source:NCB... [more]
gpat45.190e-13246.78glycerol-3-phosphate acyltransferase 4 [Source:NCB... [more]
gpat46.811e-13248.41glycerol-3-phosphate acyltransferase 4 [Source:NCB... [more]
back to top
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gpat34.095e-13448.14glycerol-3-phosphate acyltransferase 3 [Source:MGI... [more]
Gpat34.095e-13448.14glycerol-3-phosphate acyltransferase 3 [Source:MGI... [more]
Gpat34.095e-13448.14glycerol-3-phosphate acyltransferase 3 [Source:MGI... [more]
Gpat45.544e-13348.58glycerol-3-phosphate acyltransferase 4 [Source:MGI... [more]
Gpat42.073e-3948.61glycerol-3-phosphate acyltransferase 4 [Source:MGI... [more]
back to top
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DG38|GPAT3_DANRE8.746e-13446.83Glycerol-3-phosphate acyltransferase 3 OS=Danio re... [more]
sp|Q8C0N2|GPAT3_MOUSE2.864e-13348.14Glycerol-3-phosphate acyltransferase 3 OS=Mus musc... [more]
sp|Q5R6J7|GPAT4_PONAB2.598e-13248.82Glycerol-3-phosphate acyltransferase 4 OS=Pongo ab... [more]
sp|Q86UL3|GPAT4_HUMAN3.674e-13248.82Glycerol-3-phosphate acyltransferase 4 OS=Homo sap... [more]
sp|Q68F37|GPAT3_XENLA3.868e-13250.49Glycerol-3-phosphate acyltransferase 3 OS=Xenopus ... [more]
back to top
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8J4J56.559e-13750.48PlsC domain-containing protein OS=Macrostomum lign... [more]
A0A267GRC87.451e-13750.48PlsC domain-containing protein (Fragment) OS=Macro... [more]
A0A087T4A41.515e-13450.23Glycerol-3-phosphate acyltransferase 4 (Fragment) ... [more]
W5UKL52.070e-13451.34Glycerol-3-phosphate acyltransferase 3 OS=Ictaluru... [more]
W5N2S03.228e-13448.861-acylglycerol-3-phosphate O-acyltransferase 9, li... [more]
back to top
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
agpat9l5.527e-13450.00glycerol-3-phosphate acyltransferase 3-like [Sourc... [more]
gpat42.972e-13047.02glycerol-3-phosphate acyltransferase 4 [Source:NCB... [more]
gpat42.972e-13047.02glycerol-3-phosphate acyltransferase 4 [Source:NCB... [more]
gpat37.460e-12946.15glycerol-3-phosphate acyltransferase 3 [Source:NCB... [more]
gpat37.460e-12946.15glycerol-3-phosphate acyltransferase 3 [Source:NCB... [more]
back to top
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gpat48.324e-13249.22glycerol-3-phosphate acyltransferase 4 [Source:ZFI... [more]
back to top
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO371117.039e-13046.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO416156.866e-1125.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473891.982e-725.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GPAT41.352e-13147.24glycerol-3-phosphate acyltransferase 4 [Source:NCB... [more]
agpat9l3.866e-13047.97glycerol-3-phosphate acyltransferase 3-like [Sourc... [more]
agpat9l3.866e-13047.97glycerol-3-phosphate acyltransferase 3-like [Sourc... [more]
gpat32.340e-12545.08glycerol-3-phosphate acyltransferase 3 [Source:NCB... [more]
gpat38.108e-12453.06glycerol-3-phosphate acyltransferase 3 [Source:NCB... [more]
back to top
BLAST of Glycerol-3-phosphate acyltransferase 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000061821.10.000e+0100.00SMESG000061821.1[more]
SMESG000009198.11.171e-1130.88SMESG000009198.1[more]
SMESG000003820.12.884e-826.87SMESG000003820.1[more]
SMESG000045185.18.524e-825.37SMESG000045185.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020521 ID=SMED30020521|Name=Glycerol-3-phosphate acyltransferase 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1717bp
TAAGAATGTCATATTTTTGAGTTAGTATTTCAAAAATCCTGAGCTCTAAT
GCTTTCTATTGTTCCATTTTTAGCTTTGTTATTACCTTATTATGTCTTTA
TTTTATTCACAAATTTAGTTGGTGGAATAGTTGGTGTGCTTACAGGATAT
AGATTTATAGAAGAGTTATACATTAAGTTACTTTTAAAAGTTTTTGCTTA
TGCTTCATCTACGGTATCGGAAAATGAGCAAATCGAAACAAAAAGAAAAG
GTATCAAACGTTCAATGAGTATAGGTTGTTATGATAGAGACATGTGTACA
ATTAATCGAGATGTACGATTAGATCAAGACGGAATAAAATTTAATCAAGC
GTTCATTAGAGATGCTAATAATAAATTTAATTTAGCTGATCCTTCTTATT
TTGTCAAATCTGGAATAGAAGCTATTATAGAAGATGATGTAACAAAGCGA
TTTTCATCAAATGAAATGGAAGTTTGGAACTTATTAAGCCGAACTCATTC
ATATCAACATATAAATCATCAATTGACAATTTTATGGGTGGTTGGATTTT
TCACTAGATACGCAATTCTGTTGCCATGCCGATTGTTTTTCTTTATCACT
GCCATTTCAACGTTAGTTGGATCTAGTTTTTTAGTTGAATTACTACCAGA
ACAACAGGGTAAAAAGTTTAATGCAGTCGTATCCAAATTGTCATTTCGAA
TGTTTGTTCGAGCTTATTCTGGAGTAATCAGATTTCATAACAAGGAAAAC
AAAGCCAAAAGTGGTGGTATCTGTGTTGCCAATCATACTACACCGATAGA
TGTGATCGTATTAGGATGTGATAACGGATATGCTATGGTCGGACAGAAAC
AAGGTGGATTTTTCGGAATGATGCAAAAGGTGTTTGGGCGAGCTACGTCT
ACTATTTGGTTTGAAAGATCAGAGACGAGGGATAGAGAAGGAGTTACAAA
AAGATTGAGAGACCATATTAAAGAGCCTGGCTCATTGCCGATTTTGATAT
TCCCCGAGGGAACGTGCATAAATAACACATCGGTTATGATGTTCAAAAAA
GGAAGCTTTGAAGTTGGTGGCACAATTTATCCTGTTGCTGTCAAGTATGA
TTCTCGATTTGCTGATTGTTTTTGGAATAGCAGCAAATACAGTCTGTTAG
AATATCTTTTTATGATGATGAGTTCTTGGGCTATTGTGGCAGACGTTTGG
TATTTGCCACCAGAACATCAGAAAGAATCAGAAAATGCCATTGAGTTTGC
TAATCGTGTTAAACGCAACATAGCACAACAGGGAGGACTTGTTGATATGA
AATGGGATGGAGGATTGAAACGGTCAGTACCAAAGGATTCATTGAAACAA
GTTCAACAGAAAAGTTTCAGCAAATTTATCAAAACATCAGAATGAAATGA
AGATTAATTATACTGCTATCACTATATGACAATTTATAAATATAAATTAT
TTTTTGAGCATGTTTTATGTTTCATTTTCCAATTATATAAATACATAGTA
TATTATTTACTGATTCGGATAACCTAATAATAGCTTTATACTTCATTTTT
ATTGTAAAACAATTTTTTCATAACATTATTTTTTTACTGTCTGGAAATAT
GATAAATGTTATATCCGTTCTATATGAACACGTTTCCACGATGCGTCAAG
TTTGTATTGTAATTTTTCTGATTTTTGTTTTAATCGACAGGAAATCCAAT
AAACTTTTGTCTAAAAA
back to top

protein sequence of SMED30020521-orf-1

>SMED30020521-orf-1 ID=SMED30020521-orf-1|Name=SMED30020521-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=449bp
MLSIVPFLALLLPYYVFILFTNLVGGIVGVLTGYRFIEELYIKLLLKVFA
YASSTVSENEQIETKRKGIKRSMSIGCYDRDMCTINRDVRLDQDGIKFNQ
AFIRDANNKFNLADPSYFVKSGIEAIIEDDVTKRFSSNEMEVWNLLSRTH
SYQHINHQLTILWVVGFFTRYAILLPCRLFFFITAISTLVGSSFLVELLP
EQQGKKFNAVVSKLSFRMFVRAYSGVIRFHNKENKAKSGGICVANHTTPI
DVIVLGCDNGYAMVGQKQGGFFGMMQKVFGRATSTIWFERSETRDREGVT
KRLRDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKY
DSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESENAIEF
ANRVKRNIAQQGGLVDMKWDGGLKRSVPKDSLKQVQQKSFSKFIKTSE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR002123Plipid/glycerol_acylTrfase
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0006629lipid metabolic process
GO:0008654phospholipid biosynthetic process
GO:0016024CDP-diacylglycerol biosynthetic process
GO:0019432triglyceride biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0016746transferase activity, transferring acyl groups
GO:00038411-acylglycerol-3-phosphate O-acyltransferase activity
GO:0004366glycerol-3-phosphate O-acyltransferase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002123Phospholipid/glycerol acyltransferaseSMARTSM00563plsc_2coord: 240..351
e-value: 3.3E-22
score: 89.8
IPR002123Phospholipid/glycerol acyltransferasePFAMPF01553Acyltransferasecoord: 227..348
e-value: 3.0E-20
score: 72.2
NoneNo IPR availablePANTHERPTHR23063:SF10GLYCEROL-3-PHOSPHATE ACYLTRANSFERASE 3coord: 95..445
NoneNo IPR availablePANTHERPTHR23063ACETYLTRANSFERASE-RELATEDcoord: 95..445
NoneNo IPR availableCDDcd07991LPLAT_LPCAT1-likecoord: 216..425
e-value: 3.76698E-93
score: 278.335
NoneNo IPR availableSUPERFAMILYSSF69593Glycerol-3-phosphate (1)-acyltransferasecoord: 177..415
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 174..196